Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.155.709ON40240220650.0
Suva_9.355.709ON39339318170.0
YIL153W (RRD1)5.709ON39339318120.0
Smik_9.165.709ON39339317930.0
TDEL0B021105.709ON38935010981e-148
KLTH0E00880g5.709ON37135510341e-139
NDAI0F002405.709ON46433010421e-139
SAKL0E15070g5.709ON38534610291e-138
NCAS0G002005.709ON43834310341e-138
ZYRO0B16478g5.709ON39133710121e-135
Kpol_2001.775.709ON4133479991e-133
Kwal_55.196615.709ON3713409771e-130
Ecym_40125.709ON3953339381e-124
KAFR0D021905.709ON4263369401e-124
TBLA0E016905.709ON4883409371e-122
TPHA0D046505.709ON4213629121e-120
CAGL0H06655g5.709ON4243489101e-119
KLLA0A00462g5.709ON3533528901e-117
AFR293C5.709ON3653278871e-117
KNAG0L021705.709ON3963968591e-112
NCAS0C016908.674ON3592944082e-45
KAFR0H024408.674ON3532604003e-44
NDAI0E024108.674ON3592473986e-44
TPHA0D012408.674ON3592883986e-44
ZYRO0F07326g8.674ON3522443933e-43
Kpol_1013.48.674ON3582473924e-43
KLLA0F11187g8.674ON3602503918e-43
KNAG0J016908.674ON3632503882e-42
CAGL0M02255g8.674ON3582463872e-42
Ecym_23998.674ON3512533863e-42
KLTH0D11176g8.674ON3532483838e-42
TDEL0A062008.674ON3552553838e-42
Smik_6.3498.674ON3582703821e-41
ACR139C8.674ON3592773812e-41
YPL152W (RRD2)8.674ON3582693777e-41
Suva_16.1588.674ON3582563778e-41
SAKL0H06622g8.674ON3552473723e-40
TBLA0C018608.674ON3562823723e-40
Skud_16.1308.674ON3582523707e-40
Kwal_26.87838.674ON3552543558e-38
CAGL0I06985g3.530ON8431760.11
YGL220W (FRA2)3.530ON12052750.25
TDEL0H021607.228ON304127712.9
KNAG0A014803.66ON28274677.0
Smik_12.1448.258ON43861679.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.15
         (402 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   800   0.0  
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   704   0.0  
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   702   0.0  
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   695   0.0  
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   427   e-148
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   402   e-139
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      405   e-139
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   400   e-138
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      402   e-138
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   394   e-135
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   389   e-133
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   380   e-130
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   365   e-124
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   366   e-124
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   365   e-122
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   355   e-120
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   355   e-119
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   347   e-117
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   346   e-117
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   335   e-112
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   161   2e-45
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   158   3e-44
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   157   6e-44
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   157   6e-44
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   155   3e-43
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   155   4e-43
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   155   8e-43
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   154   2e-42
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   153   2e-42
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   153   3e-42
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   152   8e-42
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   152   8e-42
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   151   1e-41
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   151   2e-41
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   149   7e-41
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   149   8e-41
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   147   3e-40
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   147   3e-40
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   147   7e-40
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   141   8e-38
CAGL0I06985g Chr9 (672970..673224) [255 bp, 84 aa] {ON} highly s...    34   0.11 
YGL220W Chr7 (82374..82736) [363 bp, 120 aa] {ON}  FRA2Protein i...    33   0.25 
TDEL0H02160 Chr8 (367235..368149) [915 bp, 304 aa] {ON} Anc_7.22...    32   2.9  
KNAG0A01480 Chr1 (60537..61385) [849 bp, 282 aa] {ON} Anc_3.66 Y...    30   7.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...    30   9.6  

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/402 (95%), Positives = 385/402 (95%)

Query: 1   MDKHERNGIMSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSH 60
           MDKHERNGIMSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSH
Sbjct: 1   MDKHERNGIMSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSH 60

Query: 61  CPDPDAHAASSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQ 120
           CPDPDAHAASSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQ
Sbjct: 61  CPDPDAHAASSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQ 120

Query: 121 WLQEMLPAEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGN 180
           WLQEMLPAEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGN
Sbjct: 121 WLQEMLPAEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGN 180

Query: 181 DVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPR 240
           DVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPR
Sbjct: 181 DVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPR 240

Query: 241 EVLDKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMY 300
           EVLDKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMY
Sbjct: 241 EVLDKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMY 300

Query: 301 SVEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRF 360
           SVEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRF
Sbjct: 301 SVEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRF 360

Query: 361 XXXXXXXXXXXXXXXXXINYLLSHQNSSHRNQASSSKDRLRR 402
                            INYLLSHQNSSHRNQASSSKDRLRR
Sbjct: 361 PGSLSMPPPMGPPSGSSINYLLSHQNSSHRNQASSSKDRLRR 402

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/393 (84%), Positives = 355/393 (90%)

Query: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69
           MSLDHVDW HA FSTPVKRIFDTQTT DFQSSLAIHRIKYHLHKYTTLMSHC DPD HA 
Sbjct: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60

Query: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129
           +SSI MVNGLM VLD+ AQLID+TPPLPGPRRYGNLACREWHYKLD HL+QWL+E+LPA+
Sbjct: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120

Query: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKY 189
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLG+FPHLRG DVFLLF+KY
Sbjct: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY 180

Query: 190 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVH 249
           Y IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA+APLQPR+VLDKSLV 
Sbjct: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240

Query: 250 DYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309
           +Y+DTNFYCQGINFIN+VKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVL+KFP
Sbjct: 241 EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300

Query: 310 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRFXXXXXXXXX 369
           VVQHFWFGTGFFPW+N+QNGTDLPVFEEKE+E+I+QANA S  P+ TSTRF         
Sbjct: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFPASTSMPPP 360

Query: 370 XXXXXXXXINYLLSHQNSSHRNQASSSKDRLRR 402
                   +N LLSHQN +HRNQ SSS+DRLRR
Sbjct: 361 MAPPSANNVNSLLSHQNHTHRNQTSSSRDRLRR 393

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/393 (87%), Positives = 358/393 (91%)

Query: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69
           MSLD VDW HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTL+SHC DPD HA 
Sbjct: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60

Query: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129
           +SSIAMVNGLMGVLDKLA LIDETPPLPGPRRYGNLACREWH+KLDE L QWLQEMLP+E
Sbjct: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120

Query: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKY 189
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALD+LG+FPH+RG DVFLLFNKY
Sbjct: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY 180

Query: 190 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVH 249
           YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA+APLQPRE+LDKSLV 
Sbjct: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240

Query: 250 DYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309
           +YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP
Sbjct: 241 EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300

Query: 310 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRFXXXXXXXXX 369
           VVQHFWFGTGFFPWVNIQNGTDLPVFEEKE+E+IEQANA SPG   TSTRF         
Sbjct: 301 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360

Query: 370 XXXXXXXXINYLLSHQNSSHRNQASSSKDRLRR 402
                   INYLLSHQN SHRNQ S S+DRLRR
Sbjct: 361 GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/393 (87%), Positives = 354/393 (90%)

Query: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69
           MSLDHVDW HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHC DPD  A 
Sbjct: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60

Query: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129
           +SSI M NGLM VLDKLA LIDETPPLPGPRRYGNLACREWH+KLDE L QWL+EMLP E
Sbjct: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120

Query: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKY 189
           YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATV ALDLLG+FPHLRG DVFLLFNKY
Sbjct: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY 180

Query: 190 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVH 249
           YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA+APLQPRE+LDKSLV 
Sbjct: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240

Query: 250 DYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309
           +YK+TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP
Sbjct: 241 EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300

Query: 310 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRFXXXXXXXXX 369
           VVQHFWFGTGFFPWVNIQNGT+LPVFEEKE+ETIEQANA  PGP HTSTRF         
Sbjct: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP 360

Query: 370 XXXXXXXXINYLLSHQNSSHRNQASSSKDRLRR 402
                   INYLLSHQN S RNQ SS +DRLRR
Sbjct: 361 ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  427 bits (1098), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 205/350 (58%), Positives = 258/350 (73%), Gaps = 5/350 (1%)

Query: 9   IMSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHA 68
           ++S   +D     F +PVK IFD+Q   DFQ S+AI R+KYHL KY  ++     P  H 
Sbjct: 1   MISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHG--QPIVHE 58

Query: 69  ASSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPA 128
            S  I +VN ++ +L +L++L+DETPP  GPRRYGNLACR+WH KLD +L++ LQ++LP 
Sbjct: 59  PSG-IEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQ 117

Query: 129 EYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF-PHLRGNDVFLLFN 187
           +YH  +PEL YYLGNSFGSSTRLDYGTGHELSF+A + ALD+LG++     G DV LLF+
Sbjct: 118 DYHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFD 177

Query: 188 KYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSL 247
            YY ++R+LILTYTLEPAGSHGVWGLDDHFH++YILGSSQW   D   P+ PR+V +K L
Sbjct: 178 TYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSS-DPAVPMTPRDVKNKVL 236

Query: 248 VHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 307
           V DY DTN YCQ I+FI  VK GPF EHS +LYDIA TV  WSKV  GLLKMY VEVLKK
Sbjct: 237 VQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKK 296

Query: 308 FPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTS 357
           FPVVQHFWFG GF+PW++ +NG  LP++E  E E  +  +  +  P++T+
Sbjct: 297 FPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTT 346

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  402 bits (1034), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 254/355 (71%), Gaps = 11/355 (3%)

Query: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69
           MSL+ +D   ATF+ P KRIFD++ +  FQSS+A+ R+K +LHKY + MS    P+    
Sbjct: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE---- 56

Query: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129
           +S+   V     +L  L++L+D TP LPGPRRYGNLACR WH K+DE L   L + LP  
Sbjct: 57  TSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP 116

Query: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF-PHLRGNDVFLLFNK 188
            H  + ELQYYLGN+FGS  RLDYGTGHELSF A + ALD+LGV+    + +DV  LF+K
Sbjct: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDK 176

Query: 189 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAR-APLQPREVLDKSL 247
           YY ++R+L+LTYTLEPAGSHGVWGLDDHFHL+YI G+SQW  +D + AP+ PREV DK +
Sbjct: 177 YYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW--VDGKCAPIAPREVQDKLI 234

Query: 248 VHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 307
           V +Y  TNFYCQ I+FI +VK GPF EHSP+L+DI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 235 VDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 308 FPVVQHFWFGTGFFPWVNIQNGTDLPVFE---EKEDETIEQANAASPGPNHTSTR 359
           FPVVQHFWFGTG FPW ++ +G  LP +E   E + + ++   A +P   +++ R
Sbjct: 295 FPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARR 349

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  405 bits (1042), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 190/330 (57%), Positives = 245/330 (74%), Gaps = 9/330 (2%)

Query: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHC---PDPDAHAASS 71
           +D     FS PVKRIFD+QTT DFQSS+A+ R+++ L +Y  L+++    P PD++   S
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYV--S 71

Query: 72  SIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPA-EY 130
            I MVN ++ +L++L+ ++ +TPPL GPRRYGNLACR+WH K++  L + L++ +P+ + 
Sbjct: 72  EILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDL 131

Query: 131 HVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYY 190
              + EL YY+ NSFGSSTRLDYGTGHELSFMA +AALD+LG+FP L G D+ ++FN YY
Sbjct: 132 QPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYY 191

Query: 191 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHD 250
           +++R LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      APL P+E+ +  LV D
Sbjct: 192 SLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWL---NNAPLTPKEITNSRLVKD 248

Query: 251 YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
           Y   N YCQ I F+  VK GPF EHSPILYDI+ +V  W KV +GL+KMY  EVL KFPV
Sbjct: 249 YSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPV 308

Query: 311 VQHFWFGTGFFPWVNIQNGTDLPVFEEKED 340
           VQHFWFGTGF+PW+N Q   +LPV+E   +
Sbjct: 309 VQHFWFGTGFYPWINFQTLRELPVYEHSPE 338

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  400 bits (1029), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 249/346 (71%), Gaps = 6/346 (1%)

Query: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74
           +D  H  F+ PVK+IFDTQ T DFQSS+ ++R++ +LHKY TL+     P    ++S+  
Sbjct: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIP----STSNND 65

Query: 75  MVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVV 134
            VN    ++D L++ IDETPPLPGPRR+GN ACR WH K+   L   LQ  +P +YHV +
Sbjct: 66  AVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCI 125

Query: 135 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF-PHLRGNDVFLLFNKYYTIM 193
            E++YYLGN+FGS  RLDYGTGHELSF+A V+A+D+L ++  +  G D+  LFN YYT++
Sbjct: 126 VEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLV 185

Query: 194 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKD 253
           ++LI TYTLEPAGSHGVWGLDDHFHL YILGSSQ   + +  PL+P ++LD+  V DY  
Sbjct: 186 KKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPI-SHNPLRPSDILDRHTVEDYAK 244

Query: 254 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 313
           TN Y Q I FI++VK G F EHSP+LYDIA TV  WSKV +GLLKMYS EVL KFPVVQH
Sbjct: 245 TNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQH 304

Query: 314 FWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTR 359
           FWFGTGFFPWVN+++G  LP +E  ++E    ++  S     T+T+
Sbjct: 305 FWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATK 350

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  402 bits (1034), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 195/343 (56%), Positives = 248/343 (72%), Gaps = 16/343 (4%)

Query: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74
           +D     FS P KRIFD+QTT DFQSS+A++R+++ L KY +++++   P      SS+ 
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTP-PEGTLSSVT 91

Query: 75  MVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEML-------- 126
           +VN ++ +L+ L+ LIDETPPL GPRRYGNLACR+WH K++  L   L E+L        
Sbjct: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151

Query: 127 --PAEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPH-LRGNDVF 183
              +  H  + EL YY+ N+FGSSTRLD+GTGHELSFMA +AA+D+LG++   ++G D+ 
Sbjct: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211

Query: 184 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVL 243
           LLFN YY ++R+LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      AP++PR+V 
Sbjct: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMRPRDVK 268

Query: 244 DKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 303
           D SLV  Y  +N YCQ I FI +VK GPF EHSPILYDIA +V  WSKV +GL+KMY  E
Sbjct: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328

Query: 304 VLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEK-EDETIEQ 345
           VLKKFPVVQHFWFG GF+PW+N   G  LP++E   ED+  EQ
Sbjct: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQ 371

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  394 bits (1012), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 247/337 (73%), Gaps = 8/337 (2%)

Query: 22  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNGLMG 81
           F+TPVKRIFD+Q TL+FQ+S+AI R+KY + KY  +++    P      S I++VN  +G
Sbjct: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQG---PSRISVVNEFVG 67

Query: 82  VLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVVPELQYYL 141
           VL+ ++ L+D+TPPL GPRRYGNLACR+WH K+DE +    +++LP  +H  + EL +YL
Sbjct: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127

Query: 142 GNSFGSSTRLDYGTGHELSFMATVAALDLLGVFP-HLRGNDVFLLFNKYYTIMRRLILTY 200
           GNSFGS+TRLDYGTGHELSF+A V A+D+LG+F    +G D  L+ N YY ++R+LILTY
Sbjct: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187

Query: 201 TLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTNFYCQG 260
           TLEPAGSHGVWGLDDHFHL Y+ GS+QW      APL+PR++L+  LV +Y   N YCQ 
Sbjct: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYK-EAPLRPRDILNHHLVQEYAHLNLYCQT 246

Query: 261 INFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGTGF 320
           I FI +VK GPF EHS +LYD+A TV  W+K+  GL+KMY+VEVL KFPVVQHFWFGTGF
Sbjct: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306

Query: 321 FPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTS 357
           +PWV+ Q G  L +++  +    ++ N +S G  + +
Sbjct: 307 YPWVDNQTGKQLLIYDPAD---ADRRNTSSTGGKYAA 340

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  389 bits (999), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 190/347 (54%), Positives = 246/347 (70%), Gaps = 11/347 (3%)

Query: 22  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNGLMG 81
           F  PVKRI+D+Q T  FQSS+AI R+KY + KY  L+ +   PD  +  S I  VN L+ 
Sbjct: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD-ESYVSEIPTVNKLVK 73

Query: 82  VLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV-------V 134
           ++ +L+ L+DETPP PGPRR+GNL+CREWH K+D +L   L +ML  +   +       V
Sbjct: 74  LISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133

Query: 135 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFP-HLRGNDVFLLFNKYYTIM 193
            EL YYLGNSFGSSTRLDYGTGHELSF+A +A +D+LG++  +++G D+ ++FN+YY +M
Sbjct: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193

Query: 194 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKD 253
           ++LILTYTLEPAGSHGVWGLDDHFH  YILGS+QW   +   PL+P ++++K LV +Y +
Sbjct: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKDLVCEYAN 252

Query: 254 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 313
           TN YC  I FI+ VK GPF EHSP+LYDI+ +V  WSKV  GLLKMY VEVL KFPVVQH
Sbjct: 253 TNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312

Query: 314 FWFGTGFFPWVNIQNGTDLPVFEEKEDETIE-QANAASPGPNHTSTR 359
           FWFGTG FPW++      LP++E    +T      + SP P   STR
Sbjct: 313 FWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTR 359

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  380 bits (977), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 241/340 (70%), Gaps = 9/340 (2%)

Query: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69
           M  D +D    TF+ PVKRIFD++ T  FQSS+A+ R+K HLHKY  ++S    P    +
Sbjct: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIP----S 56

Query: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129
            +S   V  L  +L   ++L+DETP LPGPRRYGNLACR+WH K++E + + LQE LP +
Sbjct: 57  ETSNPNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEK 116

Query: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF-PHLRGNDVFLLFNK 188
           Y+  + EL YYLGN+FGS  RLDYGTGHELSF + + ALD+LG++    +  D+  LFN+
Sbjct: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNE 176

Query: 189 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAR-APLQPREVLDKSL 247
           YY+++R+LI  Y+LEPAGSHGVWGLDDHFHL+YI G+SQW   D++ A   PRE+  K +
Sbjct: 177 YYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWA--DSKDAEASPREIQSKMI 234

Query: 248 VHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 307
           V +Y  +NFYCQ I+FI +VK GPF EHSP+LYDI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 308 FPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQAN 347
           FPVVQHFWFGT  FPW +   G  LP +E  + ET  QA 
Sbjct: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQ-ETDTQAQ 333

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  365 bits (938), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 228/333 (68%), Gaps = 14/333 (4%)

Query: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74
           V+     FS PVKRIFD+  T DFQ SL ++R++ HL +Y  L+ +   P      S  +
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62

Query: 75  MVNGLMGVLDKLAQLIDETPPLPG-PRRYGNLACREWHYKLDEHLSQWLQEMLPAE---- 129
            V+     LD+  +LIDETPP    PRR+GN+ACR+WH K+ E +    +  LP E    
Sbjct: 63  FVSIF---LDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119

Query: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPH------LRGNDVF 183
           Y   + EL+YYLGN+FGS  RLDYGTGHELSF+A V A+D+LG++        L G D+ 
Sbjct: 120 YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179

Query: 184 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVL 243
            L+NKYY+I+ +LILTYTLEPAGSHGVWGLDDH HL YI+G+SQW   D  AP+Q  ++L
Sbjct: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239

Query: 244 DKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 303
           D   ++ Y+DTN YC  I F+ +VK GPF +HSP+LYDI+ TVP WSK   GL+KMY VE
Sbjct: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299

Query: 304 VLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFE 336
           VL KFPVVQHFWFGTGFFPWV+++ G  LP +E
Sbjct: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYE 332

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  366 bits (940), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 181/336 (53%), Positives = 231/336 (68%), Gaps = 8/336 (2%)

Query: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74
           VD   + FS P KRIFD+QTT  FQ S+A +R+KY  +KY  L+   P P +   + +I 
Sbjct: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTIT 69

Query: 75  MVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEML----PAEY 130
               ++ +LDK +Q IDETPPL  PRR+GNL+CR WH K++ +L   L+ ++      E 
Sbjct: 70  RY--ILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127

Query: 131 HVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYY 190
             +  EL YYL NSFGS TRLDYGTGHELSF+A ++ +D++ +   +  +D  L++  YY
Sbjct: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYY 187

Query: 191 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHD 250
            + R+LILTYTLEPAGSHGVWGLDDHFHL YI GSSQ  L+   + L P+++L K +V +
Sbjct: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQ--LISDISHLAPKDILKKDVVAE 245

Query: 251 YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
           +K+ N YCQ INFI  VK GPF EHSPILYDI+  V  WSKV KGLLKMY+ EVL KFPV
Sbjct: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305

Query: 311 VQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQA 346
           VQHFWFG GFFPW +  +G DLPVFE  E E+   A
Sbjct: 306 VQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPA 341

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  365 bits (937), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/340 (50%), Positives = 230/340 (67%), Gaps = 18/340 (5%)

Query: 19  HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNG 78
           +  FS P K+IFD+Q T  F  S+A HRI+Y + KYT L+     P     SS+   ++G
Sbjct: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSN-DTISG 70

Query: 79  LMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPA-----EYHVV 133
           +  +++ L +L++ETPPLPGPRRYGNL+CR+WH ++D+++++  ++ L           +
Sbjct: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYYTIM 193
             EL YY   S GS TRLDYGTGHELSF+A + ALD+L +   + G D+  +FN+YY ++
Sbjct: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLI 190

Query: 194 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA------------RAPLQPRE 241
           R+LIL YTLEPAGSHGVWGLDDHFHL+YI GSSQW   +A            +AP++P +
Sbjct: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250

Query: 242 VLDKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 301
           +L+K+L+  +K +NFYCQ I FI  VK GPF EHSPIL+DIA  V  W KV  GLLKMY 
Sbjct: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310

Query: 302 VEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDE 341
           VEVL KFPVVQHFWFGTGF+PW+N      LP +E   D+
Sbjct: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDD 350

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  355 bits (912), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 176/362 (48%), Positives = 242/362 (66%), Gaps = 16/362 (4%)

Query: 12  LDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASS 71
           L  ++    +FS P+KRI+D+Q+T  FQSS+AI+R+KY+LHKY  ++ +   PD     S
Sbjct: 4   LSTINIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDL-TYVS 62

Query: 72  SIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYH 131
            I +VN +  +L +L+  ID  PP  GPRRYGNLACR WH  +D  +   L+++L    H
Sbjct: 63  EITIVNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNH 122

Query: 132 V-----------VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFP-HLRG 179
                        + EL YYL NS GS+TRLDYGTGHELSF+A +AA+D+LG++  + +G
Sbjct: 123 ATEKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKG 182

Query: 180 NDVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQP 239
            D+  +F+ YY ++++LI+TYTLEPAGSHGVWGLDDHFHL YILGSSQ    +   P  P
Sbjct: 183 VDLLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSE-NPNPPFSP 241

Query: 240 REVLDKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKM 299
            ++++K +V +Y   NFYC  I+FI +VK GPF EHSPILYDI+ TV  W KV  GL+KM
Sbjct: 242 SDIINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKM 301

Query: 300 YSVEVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVF--EEKEDETIEQANAASPGPNHTS 357
           Y VEVL KFPVVQHFWFG GF+PW N++    L V+  +  ++  +  ++ +S  PN+  
Sbjct: 302 YMVEVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSSIPNNAM 361

Query: 358 TR 359
            +
Sbjct: 362 NK 363

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  355 bits (910), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 183/348 (52%), Positives = 238/348 (68%), Gaps = 17/348 (4%)

Query: 22  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNGLMG 81
           FS PVKRI+D+Q    FQSS AI R++  + KYT L+      D   +     +V     
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGVVK---- 57

Query: 82  VLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEML----PAEYHVVVPEL 137
           VLD+L QL+ ETPP+PGPRRYGN+ACR+WH K++  +   L++++    P+E   VV EL
Sbjct: 58  VLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-EL 116

Query: 138 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYYTIMRRLI 197
           +YYL NSFGS+TRLD+GTGHELSF+ATVAALD+LG      G+ V  +F++YY+++ RLI
Sbjct: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLGA--SFDGDQVLYIFDRYYSLVHRLI 174

Query: 198 LTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTNFY 257
           L+YTLEPAGSHGVWGLDDHFHL YILGSSQW     +  ++P ++ D  LV  Y  TN +
Sbjct: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQW-CNRKKLAMEPNDLSDPVLVEQYSRTNIF 233

Query: 258 CQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFG 317
           C+ +NF+  VK G F EHSP+L+DI+ +V  W+KV KGL KMY  EVL KFPV+QHFWFG
Sbjct: 234 CKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293

Query: 318 TGFFPWVNIQNGTDLPVFEEKE--DETIE---QANAASPGPNHTSTRF 360
           TGF+PWV+ +NG  LP +E     DET +   QA A   G     +RF
Sbjct: 294 TGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRF 341

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  347 bits (890), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 228/352 (64%), Gaps = 13/352 (3%)

Query: 16  DWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAM 75
           D+ +A FS P KRIFD+Q TLDFQ+S+A+ RI+YHL KY TL      PD    S     
Sbjct: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKES---FF 60

Query: 76  VNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVVP 135
            N ++ +L +L+ LIDETPP     RYGNL+ R+W  K    L  WL E+LP +Y+  + 
Sbjct: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120

Query: 136 ELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYYTIMRR 195
           EL YY+ N+FGS  R+DYGTGHELSF+A +  LD+L +   ++G  +   FN YY ++++
Sbjct: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDVIQK 179

Query: 196 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTN 255
           LILTY LEPAGSHGVWGLDDHFH  YILG++Q  LLD    L P+++ +  L+     +N
Sbjct: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQ--LLDVNTSLIPKDISNTRLMEQNSSSN 237

Query: 256 FYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFW 315
            +C+ I FIN VK GPF  HSP+LY+I+ +V  W K+ +GL+KMY VEVL KFPVVQHFW
Sbjct: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297

Query: 316 FGTGFFPWVNIQNGTDLPVFEEKEDE------TIEQANAASPGPNHTST-RF 360
           FGT FFPW +  N   LP+++  E+       T   A    P P  TST RF
Sbjct: 298 FGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTSTSRF 349

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  346 bits (887), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 221/327 (67%), Gaps = 9/327 (2%)

Query: 22  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNGLMG 81
           FS PVKRIFDT  T DFQ SL ++R++ HL +Y  L+     P     SS    V   + 
Sbjct: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPK----SSQNRAVVRFVC 65

Query: 82  VLDKLAQLIDETPPLPG-PRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVVPELQYY 140
           +L++L  L+DETPP  G  RR+G+LACR+WH ++   L   L+ +LP        EL+YY
Sbjct: 66  ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125

Query: 141 LGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPH--LRGNDVFLLFNKYYTIMRRLIL 198
           LG++FGS  RLDYGTGHEL+F+A V ALD+LG++      G D+  ++ +YY ++ RLIL
Sbjct: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185

Query: 199 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTNFYC 258
           TY LEPAGSHGVWGLDDH HL YILG+SQW   D   P+QP ++LD   V  Y +TN YC
Sbjct: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQ-DRNVPMQPSDILDPKAVARYSETNLYC 244

Query: 259 QGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGT 318
             I F+  VK G F +HSP+L+DIA TVP WSKV  GL+KMY VEVL KFPVVQHFWFGT
Sbjct: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304

Query: 319 GFFPWVNIQNGTDLPVFEEKEDETIEQ 345
           GFFPWV++ +G  LP + E   ET E+
Sbjct: 305 GFFPWVDMAHGMSLPNY-EAPSETSEK 330

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  335 bits (859), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 178/396 (44%), Positives = 237/396 (59%), Gaps = 23/396 (5%)

Query: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74
           +D  HA F  P KRIFD+QTT  FQ S+A+ RI++H+ KY  +M          +    A
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR------GDTSGGISA 69

Query: 75  MVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVV 134
            V  ++ +LD+L  L+DETPPL GPRRYGNLACR+WH K+D  L     ++         
Sbjct: 70  SVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129

Query: 135 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYYTIMR 194
            E +YYL NSFGS  RLDYGTGHELSF+A VAALD++     +   ++  L+++YY ++R
Sbjct: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189

Query: 195 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLV-HDYKD 253
           RLI+ Y LEPAGSHGVWGLDDHFHL Y+ G+SQ+   +    +QPR+VL   +   D   
Sbjct: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVIPGRDDAP 247

Query: 254 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 313
            NF  + I F+  VK GPF E+SP+L DI   V  W K+ +GL +MY+ EVL KFPVVQH
Sbjct: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307

Query: 314 FWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANA-ASPGPNHT------STRFXXXXXX 366
           FWFGT FFPW ++++GT LPV+E+  D   E  ++ A PGP  T      ++        
Sbjct: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDTSTMASVPSR 367

Query: 367 XXXXXXXXXXXINYLLSHQNSSHRNQASSSKDRLRR 402
                      +N  + H  +SHR       DRLRR
Sbjct: 368 RPAMGPPAGRQVNKFIQHTTASHR-------DRLRR 396

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  161 bits (408), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 166/294 (56%), Gaps = 26/294 (8%)

Query: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPR--RYGNLACREWHYKLDEHLSQWLQEMLP 127
           S SIA ++ L   LD++ +L+D+ P +   +  R+G +  R+++ +L+E  S  ++    
Sbjct: 49  SPSIASLSSL---LDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFS 105

Query: 128 AEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRG--NDVFLL 185
                 + +L  YL  S+G+  R+DYG+GHEL+F+  +  L   G+F   +   N V ++
Sbjct: 106 TLSDEQLEQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVV 165

Query: 186 FNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDK 245
           F KY  IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++
Sbjct: 166 FLKYLNIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LVPHKHLKPMSIHNE 222

Query: 246 SLVHDYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEV 304
            LV  +KD   Y   I+FIN VK       HSP+L DI+  V +WSKV +G++KMY+ EV
Sbjct: 223 ELVELFKDKFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEV 281

Query: 305 LKKFPVVQHFWFG------TGFFPWVN--IQNGTDLPVFEEKEDETIEQANAAS 350
           L K P++QHF+F        G  P  +  I NGTD      ++DE +++ +  S
Sbjct: 282 LGKLPIMQHFYFSEFLKCPEGISPARSNHIHNGTD------EDDECLQEGHTHS 329

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  158 bits (400), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 140/260 (53%), Gaps = 14/260 (5%)

Query: 74  AMVNGLMGVLDKLAQLIDETPPL-PGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHV 132
           A V+  + +LD +  ++DE P L     R+G    R ++  +  +    L +        
Sbjct: 52  AEVSSTLALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTN 111

Query: 133 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRG--NDVFLLFNKYY 190
            + +L  Y   S+G+  R+DYG+GHEL+F+  +  L    VF   R   N V L+F KY 
Sbjct: 112 QIEQLSIYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYL 171

Query: 191 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHD 250
            IMRRL   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +  +V  
Sbjct: 172 KIMRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSNHKHLKPKSIHNDEIVDM 228

Query: 251 YKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309
           +KD   Y   I FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K P
Sbjct: 229 FKDKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLP 287

Query: 310 VVQHFWFG------TGFFPW 323
           V+QHF+F       TG  P+
Sbjct: 288 VMQHFYFSEFLACPTGISPY 307

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  157 bits (398), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 142/247 (57%), Gaps = 11/247 (4%)

Query: 76  VNGLMGVLDKLAQLIDETPPLPGPR--RYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           +N L  +L  + ++ID+ P L      R+G    R ++ +++E   + + E  P+  H  
Sbjct: 52  INTLEQILVSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAAL---DLLGVFPHLRGNDVFLLFNKYY 190
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   D+L +    R N V ++F KY 
Sbjct: 112 LEQLTIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDAR-NMVLIIFIKYL 170

Query: 191 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHD 250
            IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++ LV  
Sbjct: 171 DIMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQ---LATHKHLKPLSIHNEELVEM 227

Query: 251 YKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309
           +     Y   I FIN VK       HSP+L DI+  V RWSKV +G++KMY+ EVL K P
Sbjct: 228 FAKKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLP 286

Query: 310 VVQHFWF 316
           ++QHF+F
Sbjct: 287 IMQHFYF 293

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  157 bits (398), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 151/288 (52%), Gaps = 24/288 (8%)

Query: 76  VNGLMGVLDKLAQLIDETPPLPGP--RRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           V  +M +L K+  ++ + P +      R+G +  R+++  L       L+E  P+     
Sbjct: 52  VESMMKLLHKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRG--NDVFLLFNKYYT 191
           + +L  Y+  S+G+  R+DYG+GHEL+FM  +  L    +F   R   N V  +F +Y  
Sbjct: 112 IEQLYVYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLK 171

Query: 192 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDY 251
           +MR L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + +  L+  +
Sbjct: 172 LMRVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQ---LSTHKHLKPSSIHNDDLIEMF 228

Query: 252 KDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
            D   Y   I FIN VK       HSP+L DI+  V +WSKV +G+ KMY  EV+KK P+
Sbjct: 229 ADKYLYFGCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPI 287

Query: 311 VQHFWFGTGFF--------PWVNIQNGTDLPVFEEKEDETIEQANAAS 350
           +QHF+F   F         P  +I +G +       EDE + + +A S
Sbjct: 288 MQHFYFNDMFLICPENVSPPREHIHDGGE-------EDECLAEGHAHS 328

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  155 bits (393), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 137/244 (56%), Gaps = 9/244 (3%)

Query: 80  MGVLDKLAQLIDETPPL--PGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVVPEL 137
           M +L K+  LID+ P +      R+G +  R+++  L  H  + +    P+     V EL
Sbjct: 56  MQLLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEEL 115

Query: 138 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLR--GNDVFLLFNKYYTIMRR 195
             YL  S+G+  R+DYG+GHEL+F+  +  L +  VF   R   + V  +F +Y  IMR 
Sbjct: 116 AVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRI 175

Query: 196 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTN 255
           L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + ++ +V  + D  
Sbjct: 176 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQ---LATHPHLRPKSIHNEEVVEMFMDKY 232

Query: 256 FYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHF 314
            Y   I FIN VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P++QHF
Sbjct: 233 IYFGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHF 291

Query: 315 WFGT 318
           +FG 
Sbjct: 292 YFGN 295

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  155 bits (392), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 138/247 (55%), Gaps = 9/247 (3%)

Query: 76  VNGLMGVLDKLAQLIDETPPLPGPR--RYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           +   MG+L  +  +ID+ P +   +  R+G +  R+++ +L       +    P+     
Sbjct: 52  IESFMGLLKSVNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRG--NDVFLLFNKYYT 191
           + +L  YL  S+G+  R+DYG+GHEL+F+  +  L    +F   +   N V  +F +Y  
Sbjct: 112 LDQLYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEYLR 171

Query: 192 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDY 251
           +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++ LV  +
Sbjct: 172 VMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPLSIHNEELVEMF 228

Query: 252 KDTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
           +D   Y   + FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K P+
Sbjct: 229 QDKYLYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPI 287

Query: 311 VQHFWFG 317
           +QHF+FG
Sbjct: 288 MQHFYFG 294

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  155 bits (391), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 141/250 (56%), Gaps = 12/250 (4%)

Query: 76  VNGLMGVLDKLAQLID--ETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           V  +  +L K+ ++I   E        R+G +  R+++  + EH ++ + ++        
Sbjct: 51  VQRVSNLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPD 110

Query: 134 VPELQ---YYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF--PHLRGNDVFLLFNK 188
             +L     Y  NS+G  +R+DYG+GHEL+F+  +  L    VF   +   N V +LF K
Sbjct: 111 TGKLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNIVLMLFIK 170

Query: 189 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLV 248
           Y  IMR L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +  +V
Sbjct: 171 YLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPKSIHNPEVV 227

Query: 249 HDYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 307
             ++D   Y   I FIN+VK       HSP+L DI+  V RWSKV +G++KMY  EVL+K
Sbjct: 228 EMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQK 286

Query: 308 FPVVQHFWFG 317
            P++QHF+FG
Sbjct: 287 LPIMQHFYFG 296

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  154 bits (388), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 136/250 (54%), Gaps = 11/250 (4%)

Query: 74  AMVNGLMGVLDKLAQLIDETPPLPG---PRRYGNLACREWHYKLDEHLSQWLQEMLPAEY 130
           A V  LMG+L ++  +I+  P         R+G +  R+++ +L    +  +    P   
Sbjct: 53  ASVEALMGLLQQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLT 112

Query: 131 HVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFP---HLRGNDVFLLFN 187
              V +LQ YL  S+G   R+DYG+GHEL+FM  +  L    VF      R N V   F 
Sbjct: 113 QNQVRQLQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLGGTDRANLVLKPFI 172

Query: 188 KYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSL 247
           +Y  IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++ +
Sbjct: 173 EYLKIMRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPLSIHNEEV 229

Query: 248 VHDYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLK 306
           V  + D   Y   I+FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL 
Sbjct: 230 VELFADKYLYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLS 288

Query: 307 KFPVVQHFWF 316
           K P++QHF+F
Sbjct: 289 KLPIMQHFYF 298

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  153 bits (387), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/246 (37%), Positives = 136/246 (55%), Gaps = 9/246 (3%)

Query: 76  VNGLMGVLDKLAQLIDETPPL--PGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           V   + VL ++ +LI   P +      R+G +  R+++  + E     L    PA     
Sbjct: 52  VQSTIAVLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRG--NDVFLLFNKYYT 191
           + +L  YL  S+G+  R+DYG+GHEL+F+  +  L    +F   R   N V +LF +Y  
Sbjct: 112 IEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLK 171

Query: 192 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDY 251
           IMR +   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + ++ LV  +
Sbjct: 172 IMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LAPHKHLKPKSIHNEELVEMF 228

Query: 252 KDTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
            D   Y   I FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K P+
Sbjct: 229 ADKYLYFGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPI 287

Query: 311 VQHFWF 316
           +QHF+F
Sbjct: 288 MQHFYF 293

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  153 bits (386), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/253 (35%), Positives = 141/253 (55%), Gaps = 9/253 (3%)

Query: 74  AMVNGLMGVLDKLAQLIDETPPL--PGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYH 131
           + +  L  +LD +A+++D+ P +   G  R+G +  R+++ ++ E   + +  +      
Sbjct: 50  SQIENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLSSELTD 109

Query: 132 VVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHL-RGNDVFLLFNKYY 190
             V EL  Y   S+G   R+DYG+GHEL+F+  +  L    V     + N V  +F KY 
Sbjct: 110 EQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYL 169

Query: 191 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHD 250
            +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +  +V  
Sbjct: 170 DVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPKSIHNPEIVEV 226

Query: 251 YKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309
           ++    Y + + FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P
Sbjct: 227 FEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLGKLP 285

Query: 310 VVQHFWFGTGFFP 322
           ++QHF+F T F P
Sbjct: 286 IMQHFFFST-FLP 297

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  152 bits (383), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 133/248 (53%), Gaps = 9/248 (3%)

Query: 76  VNGLMGVLDKLAQLIDETPPLPGPR--RYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           +     +L+++A L ++ P        R+G +  R ++  L       +Q    A     
Sbjct: 52  IESCCQLLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF--PHLRGNDVFLLFNKYYT 191
             EL  Y   S+G  +R+DYG+GHEL+F+  +  L   GVF  P    N V  LF KY  
Sbjct: 112 CEELSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLG 171

Query: 192 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDY 251
           +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +  +V  +
Sbjct: 172 VMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPKSIHNSEVVEMF 228

Query: 252 KDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
                Y   I+FIN+VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P+
Sbjct: 229 GKRYLYFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPI 287

Query: 311 VQHFWFGT 318
           +QHF+FG+
Sbjct: 288 MQHFFFGS 295

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  152 bits (383), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 139/255 (54%), Gaps = 12/255 (4%)

Query: 72  SIAMVNGLMGVLDKLAQLIDETP-PLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEY 130
           SI  V  L+  +D   Q I+  P    GP R+G    R+ +  +    S  ++E   +  
Sbjct: 52  SIQSVEALIECVD---QCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLT 108

Query: 131 HVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGND--VFLLFNK 188
              V +L  Y   S+G  +R+DYG+GHEL+F+  +  L   GVF   + N   V ++F K
Sbjct: 109 DEQVAQLSVYFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMK 168

Query: 189 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLV 248
           Y   MR +   Y LEPAGSHGVWGLDD+  L ++ G+SQ   L     L+P+ + +  +V
Sbjct: 169 YLKTMRVIETVYWLEPAGSHGVWGLDDYHFLPFLFGASQ---LSTHRHLKPKSIHNPEVV 225

Query: 249 HDYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 307
             + +   Y   I+FIN VK       HSP+L DI+  V  W+KV +G++KMY  EVL K
Sbjct: 226 EMFSEKYLYFGCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCK 284

Query: 308 FPVVQHFWFGTGFFP 322
            P++QHF+F + F P
Sbjct: 285 LPIMQHFYF-SEFLP 298

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  151 bits (382), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 151/270 (55%), Gaps = 18/270 (6%)

Query: 76  VNGLMGVLDKLAQLIDETPPL--PGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           ++ +M +L  +  +I + P +      R+G +  R+++ ++ +   ++L+   P+     
Sbjct: 52  ISRMMNLLSYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF--PHLRGNDVFLLFNKYYT 191
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   GVF   +   N +  +F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLK 171

Query: 192 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDY 251
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L +   L+P  + +  LV  +
Sbjct: 172 IMRILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTSHKHLKPISIHNNELVEMF 228

Query: 252 KDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
            +   Y   I+FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 ANRYLYFGCIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPI 287

Query: 311 VQHFWFGTGFFPWV--------NIQNGTDL 332
           +QHF+F + F P          +I +GTD+
Sbjct: 288 MQHFYF-SDFLPCPEGVSPPRGHIHDGTDV 316

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  151 bits (381), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 149/277 (53%), Gaps = 13/277 (4%)

Query: 67  HAASSSIAMVNGLMGVLDKLAQLIDETPPL--PGPRRYGNLACREWHYKLDEHLSQWLQE 124
           HA   S A +  L  +L+++  +    P L      R+G +  R++H ++       + +
Sbjct: 52  HAEPVSPA-IEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQ 110

Query: 125 MLPAEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFP-HLRGNDVF 183
           + P+       EL  YLGN++G   R+DYG+GHEL+F+  +  L   GV   H   N V 
Sbjct: 111 VDPSLTDEQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVL 170

Query: 184 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVL 243
            +F KY  +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + 
Sbjct: 171 RVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPKSIH 227

Query: 244 DKSLVHDYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV 302
           +  +V  +++   Y   I FIN VK       HSP+L DI+  V  W+KV +G++KMY  
Sbjct: 228 NPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKA 286

Query: 303 EVLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKE 339
           EVL K P++QHF+F + F P   + +G   P   E+E
Sbjct: 287 EVLGKLPIMQHFFF-SRFLP---VPDGVSPPRTSEEE 319

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  149 bits (377), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 146/269 (54%), Gaps = 18/269 (6%)

Query: 76  VNGLMGVLDKLAQLIDETPPLPGP--RRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           +N +M +L ++  +  + P +      R+G +  R+++ ++  +  + L+   P+     
Sbjct: 52  INSMMNLLSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF--PHLRGNDVFLLFNKYYT 191
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F   +   N V  +F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLK 171

Query: 192 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDY 251
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + +  LV  +
Sbjct: 172 IMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNNELVEMF 228

Query: 252 KDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
                Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 AHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPI 287

Query: 311 VQHFWFGTGFFPWVN--------IQNGTD 331
           +QHF+F + F P  +        I +GTD
Sbjct: 288 MQHFYF-SEFLPCPDGVSPPRGHIHDGTD 315

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  149 bits (377), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 146/256 (57%), Gaps = 18/256 (7%)

Query: 76  VNGLMGVLDKLAQLIDETPPL--PGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           +  ++ +L ++  +I++ P +      R+G +  R+++    + +SQ  +++L +E+ ++
Sbjct: 52  ITRMLSLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFY----DEVSQNSRKLLKSEFSLL 107

Query: 134 VPE----LQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF--PHLRGNDVFLLFN 187
             E    L  YL  S+G+  R+DYG+GHEL+FM  +  L   GVF   +   N +  +F 
Sbjct: 108 TDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFI 167

Query: 188 KYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSL 247
           +Y  IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + +  L
Sbjct: 168 EYLDIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNSEL 224

Query: 248 VHDYKDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLK 306
           V  + D   Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL 
Sbjct: 225 VEMFSDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLS 283

Query: 307 KFPVVQHFWFGTGFFP 322
           K P++QHF+F + F P
Sbjct: 284 KLPIMQHFYF-SEFLP 298

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  147 bits (372), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 136/247 (55%), Gaps = 9/247 (3%)

Query: 76  VNGLMGVLDKLAQLIDETPPL--PGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           ++ L  +LDK+ +++   P +      R+G +  R+++  L    S+ +  +        
Sbjct: 52  IDELCSLLDKVNKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRG--NDVFLLFNKYYT 191
           V EL  Y   S+G+ TR+DYG+GHEL+F+  +  L+    F   +   N V  +F KY  
Sbjct: 112 VDELAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLD 171

Query: 192 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDY 251
           +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +K  V  +
Sbjct: 172 VMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPKSIHNKEFVEMF 228

Query: 252 KDTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
           +    Y   I FIN VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 EKRYLYFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPI 287

Query: 311 VQHFWFG 317
           +QHF+FG
Sbjct: 288 MQHFYFG 294

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  147 bits (372), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 149/282 (52%), Gaps = 16/282 (5%)

Query: 76  VNGLMGVLDKLAQLIDETPPLPG----PRRYGNLACREWHYKLDEHLSQWLQEMLPAEYH 131
           +N    +L  +  +I+  P          R+G +  + ++  ++++  + ++        
Sbjct: 51  INNAFSLLQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDP 110

Query: 132 VVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRG--NDVFLLFNKY 189
             + EL  YL  S+G+  R+DYG+GHEL+F+  +  L    +F  L    N V  +F +Y
Sbjct: 111 NQIQELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEY 170

Query: 190 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVH 249
             IMR +   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++ +V 
Sbjct: 171 INIMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSKHKHLKPISIHNEEMVE 227

Query: 250 DYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKF 308
            +KD   Y   I+FIN +K       HSP+L DI+  V +WSKV +G++KMYS EVL K 
Sbjct: 228 MFKDKYMYFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKL 286

Query: 309 PVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAAS 350
           P++QHF+F + F P      G  LP    K D  IE+ +  S
Sbjct: 287 PIMQHFYF-SDFLP---CPQGVSLPHIHGK-DGNIEETHVHS 323

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  147 bits (370), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 139/252 (55%), Gaps = 10/252 (3%)

Query: 76  VNGLMGVLDKLAQLIDETPPL--PGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV 133
           +  +M +L ++  +I + P +      R+G +  R+++ ++ ++  + L+   P      
Sbjct: 52  IISMMNLLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQ 111

Query: 134 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF--PHLRGNDVFLLFNKYYT 191
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F       N +  +F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQ 171

Query: 192 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDY 251
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + +  LV  +
Sbjct: 172 IMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNNELVEMF 228

Query: 252 KDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310
                Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY VEVL K P+
Sbjct: 229 AHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPI 287

Query: 311 VQHFWFGTGFFP 322
           +QHF+F   F P
Sbjct: 288 MQHFYF-CEFLP 298

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  141 bits (355), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 135/254 (53%), Gaps = 17/254 (6%)

Query: 74  AMVNGLMGVLDKLAQLIDETPPLPGPR--RYGNLACREWHYKLDEHLSQWLQEMLPAEYH 131
           A ++    +LD++  +  + P        R+G +  R ++    + L    Q+++  E+ 
Sbjct: 50  ASIDKCCSLLDEVFSIAKQHPVKEDAETSRFGKIEFRHFY----DDLRIKAQDLISKEFD 105

Query: 132 VV----VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRG--NDVFLL 185
            +      EL  Y   S+G   R+DYG+GHEL+F+  +  L   G+F   R   N V  +
Sbjct: 106 QLSQDQAEELVAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKV 165

Query: 186 FNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDK 245
           F  Y  +MR L  TY LEPAGSHGVWGLDD+  L ++ G+SQ   L     L+P+ + + 
Sbjct: 166 FIHYLELMRVLETTYWLEPAGSHGVWGLDDYHFLPFLFGASQ---LAPHKHLKPKSIHNN 222

Query: 246 SLVHDYKDTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEV 304
            LV  +     Y   I+FIN VK       HSP+L DI+     WSKV +G++KMY  EV
Sbjct: 223 ELVDMFASRYLYFGCIDFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEV 281

Query: 305 LKKFPVVQHFWFGT 318
           L K P++QHF FG+
Sbjct: 282 LAKLPIMQHFLFGS 295

>CAGL0I06985g Chr9 (672970..673224) [255 bp, 84 aa] {ON} highly
           similar to uniprot|P53082 Saccharomyces cerevisiae
           YGL220w
          Length = 84

 Score = 33.9 bits (76), Expect = 0.11,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 115 DEHLSQWLQEMLPAEYHVVVPELQYYLGNSF 145
           +EHL + L+  +P  YHV+V +L Y  G SF
Sbjct: 4   EEHLREKLKTSIPDVYHVIVTDLSYGCGQSF 34

>YGL220W Chr7 (82374..82736) [363 bp, 120 aa] {ON}  FRA2Protein
           involved in negative regulation of transcription of iron
           regulon; forms an iron independent complex with Fra2p,
           Grx3p, and Grx4p; null mutant fails to repress iron
           regulon and is sensitive to nickel
          Length = 120

 Score = 33.5 bits (75), Expect = 0.25,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 108 REWHYKL---DEHLSQWLQEMLPAEYHVVVPELQYYLGNSFGSSTRLDYGTG 156
           R+ HYK+   ++ L + ++  +P  YH++V +L Y  G SF      D+  G
Sbjct: 30  RQRHYKMPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQG 81

>TDEL0H02160 Chr8 (367235..368149) [915 bp, 304 aa] {ON} Anc_7.228
           YER053C
          Length = 304

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 49/127 (38%), Gaps = 28/127 (22%)

Query: 186 FNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDK 245
           F K +T      + Y+L+ AG +G +    HF+                       VL  
Sbjct: 67  FGKVFTGFGATAIGYSLQGAGKYGGYEFFKHFY--------------------SNNVLSP 106

Query: 246 SLVHDYKDTNFYCQG---INFINEVKMGPFEEHSPILYDIAVTVPRW-SKVCKGLLKMYS 301
            L   Y  T  Y        FI ++ + PFE    I      TVP + + V +GL K+YS
Sbjct: 107 ELASRY-TTGVYLAASATAEFIADIMLCPFEA---IKVRQQTTVPPFCNNVFQGLSKVYS 162

Query: 302 VEVLKKF 308
            E LK F
Sbjct: 163 TEGLKGF 169

>KNAG0A01480 Chr1 (60537..61385) [849 bp, 282 aa] {ON} Anc_3.66
           YOL110W
          Length = 282

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query: 220 VYILGSSQWQLLDARAPLQPREV--LDKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSP 277
           V IL    W LL     LQP  +  LD+ ++H    T F  QGI+ IN  + G       
Sbjct: 211 VGILTLGLWSLLSHWHELQPVSLKKLDRYILHLNSSTKFSSQGISIINPKRSGFLS---- 266

Query: 278 ILYDIAVTVPRWSK 291
              D  V  PR +K
Sbjct: 267 --LDFQVPRPRLAK 278

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 81  GVLDKLAQLIDETPPLPGPRRYGNLACREWHYKL---DEHLSQWLQEMLPAEY--HVVVP 135
           G+++ + + +   P +  P   GN+ C   ++ L    + L+  LQ  LP ++  HV VP
Sbjct: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388

Query: 136 E 136
           E
Sbjct: 389 E 389

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,569,854
Number of extensions: 1956025
Number of successful extensions: 3947
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3909
Number of HSP's successfully gapped: 49
Length of query: 402
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 290
Effective length of database: 40,638,807
Effective search space: 11785254030
Effective search space used: 11785254030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)