Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.135.711ON64964933100.0
YIL155C (GUT2)5.711ON64964931880.0
Smik_9.145.711ON65262931550.0
Suva_9.325.711ON53853828120.0
KAFR0D021705.711ON66062522050.0
KLTH0E00836g5.711ON64161921900.0
CAGL0H06699g5.711ON65062621910.0
Kwal_55.196495.711ON64162821810.0
SAKL0E15114g5.711ON64963321710.0
NCAS0G001805.711ON65459921470.0
KLLA0A00418g5.711ON64260021200.0
TDEL0B020905.711ON64362121150.0
NDAI0F002105.711ON65360121060.0
TPHA0E001505.711ON64661620880.0
Kpol_1043.775.711ON65763520590.0
Ecym_40105.711ON64460520550.0
TBLA0E017505.711ON66560720530.0
AFR295W5.711ON63160220490.0
ZYRO0B16522g5.711ON64361020070.0
KNAG0L021905.711ON64560318870.0
Smik_13.4086.294ON256159810.24
SAKL0G16610g4.296ON1966131743.1
CAGL0M00770g4.327ON1088136724.9
Smik_15.4398.702ON806178715.7
SAKL0E06512gna 1ON40327707.3
TBLA0H020705.191ON152146707.6
Kpol_1008.77.505ON79995708.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.13
         (649 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...  1279   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...  1232   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...  1219   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...  1087   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   853   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   848   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   848   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   844   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   840   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   831   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   821   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   819   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   815   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   808   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   797   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   796   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   795   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   793   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   777   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   731   0.0  
Smik_13.408 Chr13 (648920..649690) [771 bp, 256 aa] {ON} YMR200W...    36   0.24 
SAKL0G16610g Chr7 (1434140..1440040) [5901 bp, 1966 aa] {ON} sim...    33   3.1  
CAGL0M00770g Chr13 (86290..89556) [3267 bp, 1088 aa] {ON} weakly...    32   4.9  
Smik_15.439 Chr15 complement(757966..760386) [2421 bp, 806 aa] {...    32   5.7  
SAKL0E06512g Chr5 (532120..533331) [1212 bp, 403 aa] {ON} conser...    32   7.3  
TBLA0H02070 Chr8 (492770..497335) [4566 bp, 1521 aa] {ON} Anc_5....    32   7.6  
Kpol_1008.7 s1008 complement(9101..11500) [2400 bp, 799 aa] {ON}...    32   8.2  

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score = 1279 bits (3310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/649 (95%), Positives = 619/649 (95%)

Query: 1   MFSVSXXXXXXXXXXXXXXXGSVYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLD 60
           MFSVS               GSVYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLD
Sbjct: 1   MFSVSRRRAAAAAAAIATATGSVYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLD 60

Query: 61  RLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL 120
           RLAKTHQFDVLII               RGLNVALVEKGDFASGTSSKSTKMIHGGVRYL
Sbjct: 61  RLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL 120

Query: 121 EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDF 180
           EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDF
Sbjct: 121 EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDF 180

Query: 181 FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT 240
           FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT
Sbjct: 181 FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT 240

Query: 241 VLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSG 300
           VLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSG
Sbjct: 241 VLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSG 300

Query: 301 QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF 360
           QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF
Sbjct: 301 QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF 360

Query: 361 FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP 420
           FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP
Sbjct: 361 FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP 420

Query: 421 LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG 480
           LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG
Sbjct: 421 LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG 480

Query: 481 RFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE 540
           RFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE
Sbjct: 481 RFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE 540

Query: 541 SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR 600
           SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR
Sbjct: 541 SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR 600

Query: 601 TRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649
           TRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV
Sbjct: 601 TRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/649 (91%), Positives = 608/649 (93%)

Query: 1   MFSVSXXXXXXXXXXXXXXXGSVYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLD 60
           MFSV+               G++YW T+QGDR LV ND SYMV FPTAAPPQVSRRDLLD
Sbjct: 1   MFSVTRRRAAGAAAAMATATGTLYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLD 60

Query: 61  RLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL 120
           RLAKTHQFDVLII               RGLNVALVEKGDFASGTSSKSTKMIHGGVRYL
Sbjct: 61  RLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYL 120

Query: 121 EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDF 180
           EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIY+TWQVPYIYMGCKFYDF
Sbjct: 121 EKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDF 180

Query: 181 FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT 240
           FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT
Sbjct: 181 FAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGAT 240

Query: 241 VLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSG 300
           VLNYVEVQ+LIKDP SGKV+GAEARDVETNELV+INAKCVVNATGPYSDAILQMDRNPSG
Sbjct: 241 VLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSG 300

Query: 301 QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF 360
            P+SPLNDNS IKSTFNQIAV DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF
Sbjct: 301 LPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMF 360

Query: 361 FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP 420
           FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP
Sbjct: 361 FLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRP 420

Query: 421 LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG 480
           LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG
Sbjct: 421 LVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVG 480

Query: 481 RFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE 540
            FHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE
Sbjct: 481 GFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKE 540

Query: 541 SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR 600
           SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR
Sbjct: 541 SMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRR 600

Query: 601 TRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649
           TRFAFLDAKEALN+ HATVKVMGDEFNWSEKKRQWELEKT+NFIKTFGV
Sbjct: 601 TRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score = 1219 bits (3155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/629 (93%), Positives = 597/629 (94%)

Query: 21  GSVYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXX 80
           GS+YW  TQG+R  V NDASYMV FPTAAPPQVSRRDLL+RL KTHQFDVLII       
Sbjct: 24  GSLYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIGGGATGT 83

Query: 81  XXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN 140
                   RGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN
Sbjct: 84  GCALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN 143

Query: 141 ERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE 200
           ERKHLINTAPHLCTVLPILIPIY+T QVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE
Sbjct: 144 ERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE 203

Query: 201 KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVV 260
           KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQ+LIKDPASGKV+
Sbjct: 204 KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVI 263

Query: 261 GAEARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSGQPNSPLNDNSLIKSTFNQIA 320
           GAEARDVETNEL++I AKCVVNATGPYSDAILQMDRNPSGQP+SPLNDNS  KS FNQIA
Sbjct: 264 GAEARDVETNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLNDNSKAKSAFNQIA 323

Query: 321 VTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQV 380
           V DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQV
Sbjct: 324 VMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQV 383

Query: 381 PENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQG 440
           PENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQG
Sbjct: 384 PENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQG 443

Query: 441 VVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEE 500
           VVRSHFLFTSDN LITIAGGKWTTYRQMAEET+DKVVEVG FHNL PCHTRDIKLAGAEE
Sbjct: 444 VVRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEE 503

Query: 501 WTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYS 560
           WTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICE+FKESMENKLPLSLADKENNVIYS
Sbjct: 504 WTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYS 563

Query: 561 SEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVK 620
           SEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNS HATVK
Sbjct: 564 SEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVK 623

Query: 621 VMGDEFNWSEKKRQWELEKTINFIKTFGV 649
           VMGDEFNWSEKKRQWELEKT+NFIKTFGV
Sbjct: 624 VMGDEFNWSEKKRQWELEKTVNFIKTFGV 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/538 (95%), Positives = 527/538 (97%)

Query: 112 MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 171
           MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 172 YMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 231
           Y GCKFYDFFAG QNLK SYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 232 ITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAI 291
           ITAVENGATVLNYVEVQ+LIKDPASGKVVGAEARDVETNELV+INAKCVVNATGPYSDAI
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 292 LQMDRNPSGQPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 351
           LQMDRN SGQPNSPLNDNS IKS FNQ+AV DP+MVIPSIGVHIVLPSFYCPKD+GLLDV
Sbjct: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240

Query: 352 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 411
           RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV
Sbjct: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300

Query: 412 LSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 471
           LSAWAGVRPLVRDPR+IPA GKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE
Sbjct: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360

Query: 472 TVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRS 531
           T+DKVVEVG FHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV+NYGTRS
Sbjct: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420

Query: 532 SIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCR 591
           SIICEFFK+SMENKLPLSLADKENN IYS+EENNLVNFDTFRYPFTIGELKYSMQYEYCR
Sbjct: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480

Query: 592 TPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649
           TPLDFLLRRTRFAFLDAKEALNS HATVKVMGDEFNWS+KKRQWELEKT+NFIKTFGV
Sbjct: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/625 (64%), Positives = 491/625 (78%), Gaps = 16/625 (2%)

Query: 36  RNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVAL 95
           + D   + P    +    +R DL+ +L KT+QFDVL+I               RGLNVAL
Sbjct: 41  QEDGKLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVAL 100

Query: 96  VEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTV 155
           VEK DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +
Sbjct: 101 VEKYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKI 160

Query: 156 LPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLV 215
           LPI+IP+YN WQ+PY Y GCK YD FAGSQNLK SYLLSK +  + APML T  LKA LV
Sbjct: 161 LPIMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLV 220

Query: 216 YHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKI 275
           YHDG+FNDSR+N+TLA+TA+ENG+TVLNY+EV++L+K+  SGK+ GA   D+ET +   I
Sbjct: 221 YHDGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNI 280

Query: 276 NAKCVVNATGPYSDAILQMDRNPSGQPNSPLNDNSLIKSTF-NQIAVTDPKMVIPSIGVH 334
            AK V+NATGPYSDAILQMD+NP+G P+ PLN N    +    +++V++PKMV+PS GVH
Sbjct: 281 KAKVVINATGPYSDAILQMDQNPTGLPD-PLNVNLKTNNDIATKVSVSNPKMVVPSAGVH 339

Query: 335 IVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDI 394
           I+LPSFYCPKD+GLLD +TSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENP  TEADIQDI
Sbjct: 340 IILPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDI 399

Query: 395 LKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGL 454
           LKELQHYI FPVKREDVLSAWAG+RPLV+DPRT+  +G    +TQG+VRSHF+FTSD+GL
Sbjct: 400 LKELQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGD--GSTQGLVRSHFIFTSDHGL 457

Query: 455 ITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYH 514
           +TIAGGKWTTYR MAEETVD+ ++VG+F N+KPC TRDIKLAG E W  N  ALLAQ YH
Sbjct: 458 VTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYH 517

Query: 515 LSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLA----------DKENNVIYSSEEN 564
           LSSK+S +L  NYGTR+ IICE + +  +NKLP++LA          +  N++IY++E  
Sbjct: 518 LSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERG 577

Query: 565 NLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGD 624
           ++  F+ FRYPFT+GE+KYS+ YEY  T LDFL+RR+RFAFLDAKEA+++   TVK+MGD
Sbjct: 578 DV--FECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGD 635

Query: 625 EFNWSEKKRQWELEKTINFIKTFGV 649
           E NW E +R  E+E TI +IKTFGV
Sbjct: 636 ELNWDESRRHKEIENTIKYIKTFGV 660

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/619 (65%), Positives = 479/619 (77%), Gaps = 9/619 (1%)

Query: 33  RLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLN 92
           R   N+    +P    AP   SR +LLD++AKT QFDVL+I               RGLN
Sbjct: 30  RSAHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLN 89

Query: 93  VALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHL 152
           VALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHL
Sbjct: 90  VALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHL 149

Query: 153 CTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKA 212
           C VLPI+IP+YN WQVPY Y+GCK YD FAGSQNLK SY+++     E APML    LKA
Sbjct: 150 CKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKA 209

Query: 213 SLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNEL 272
            LVYHDGSFNDSR+NA LA+TA+E GATVLNY+EV RL+K+  +G+V GA ARD ET + 
Sbjct: 210 GLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKE 269

Query: 273 VKINAKCVVNATGPYSDAILQMDRNPSGQPNSPLND--NSLIKSTFNQIAVTDPKMVIPS 330
            +INAK VVN+TGP+SD ILQMD    G P + L    N    S  +++AV++P+MV+PS
Sbjct: 270 FRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPS 329

Query: 331 IGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEAD 390
            GVHIVLP+FYCPK +GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEAD
Sbjct: 330 AGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEAD 389

Query: 391 IQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTS 450
           IQDILKELQHYI+FPVKREDVLSAWAG+RPLVRDPRT+  +G   S+TQG+VR+HFLFTS
Sbjct: 390 IQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLK-EGDDVSSTQGLVRNHFLFTS 448

Query: 451 DNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLA 510
           DNGL+TIAGGKWTTYR+MAEET+D+VV+ G F   KPC T+ IKLAGAE W  N+VA+LA
Sbjct: 449 DNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQ-AKPCITKKIKLAGAEGWDPNFVAMLA 507

Query: 511 QNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD 570
           Q YHLSSKM+ +L  NYGTRS IICE F+   +N+LP++   +EN  +Y +     VNFD
Sbjct: 508 QEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKN-----VNFD 562

Query: 571 TFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSE 630
           +FRYPFTI ELKYS++YEY RT LDFL+RRTRF FLDAK+AL +   TV +MGDE  W E
Sbjct: 563 SFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDE 622

Query: 631 KKRQWELEKTINFIKTFGV 649
            KR  E+++  +FIKTFGV
Sbjct: 623 NKRLSEIQQASDFIKTFGV 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/626 (66%), Positives = 485/626 (77%), Gaps = 17/626 (2%)

Query: 31  DRRLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRG 90
           + +L+ ND S + P         +R +LLD+L++T+QFDVLII               RG
Sbjct: 35  NNKLISNDVSLISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRG 94

Query: 91  LNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAP 150
           LNVALVEK DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAP
Sbjct: 95  LNVALVEKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAP 154

Query: 151 HLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNL 210
           HLC +LPI+IP+YN WQVPY Y GCK YD FAGSQNLK SYL+SK+AT+E APML   NL
Sbjct: 155 HLCKLLPIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNL 214

Query: 211 KASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETN 270
           KA LVYHDGSFND+R+NATLA+TA+EN ATVLNY+EV++L+KD   GKV GA   D ET 
Sbjct: 215 KAGLVYHDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKD-KDGKVAGAVVEDRETG 273

Query: 271 ELVKINAKCVVNATGPYSDAILQMDRNPSGQPN------SPLND-NSLIKSTFNQIAVTD 323
           +   + AK VVNATGPYSD +LQMD NP G P+       P+ D N+ +KS  +Q+AVT 
Sbjct: 274 KTYSVRAKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTK 333

Query: 324 PKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPEN 383
           P MV+PS GVHI+LPSFYCPK+MGLLD +TSDGRVMFFLPWQGKVLAGTTDIPLKQVPEN
Sbjct: 334 PNMVVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPEN 393

Query: 384 PMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVR 443
           P  TEADIQDILKELQ YI+FPVKREDVLSAWAG+RPLV DPR      K   +TQG+VR
Sbjct: 394 PTATEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRK---KSKADGSTQGLVR 450

Query: 444 SHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQ 503
           SHF+FTSD+GL+TIAGGKWTTYR MAEET+D+VV+ G+F + KPC TR +KLAGAE W  
Sbjct: 451 SHFIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKF-DAKPCITRKLKLAGAENWDP 509

Query: 504 NYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEE 563
           N  ALLAQ YHLS KMS+YL +NYGTR+ +ICE F E  EN+LPL LADKE   +     
Sbjct: 510 NLPALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGH-- 567

Query: 564 NNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMG 623
              V+FD+FRYP TI ELKY+++YEY RT LDFL+RRTRFAFLDAK+ALN+   TV++MG
Sbjct: 568 ---VDFDSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMG 624

Query: 624 DEFNWSEKKRQWELEKTINFIKTFGV 649
           D   W E++RQ E+  +  FIKTFGV
Sbjct: 625 DSLGWDEQRRQDEIRYSTEFIKTFGV 650

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/628 (64%), Positives = 484/628 (77%), Gaps = 9/628 (1%)

Query: 24  YWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXX 83
           Y A    + ++ R++     P    AP   +R +LL+++AKT QFDVLII          
Sbjct: 21  YAAYMVQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIGGGATGTGCA 80

Query: 84  XXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERK 143
                RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER 
Sbjct: 81  VDAATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERG 140

Query: 144 HLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAP 203
           H++NTAPHLC VLPI+IP+YN WQVPY Y+GCK YD FAGSQNLK SY++S     E AP
Sbjct: 141 HMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAP 200

Query: 204 MLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAE 263
           ML    LKA LVYHDGSFNDSR+NA LA+TA+E GATVLNY+EV +L+K+  SG++ GA 
Sbjct: 201 MLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAM 260

Query: 264 ARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSGQPNSPLND--NSLIKSTFNQIAV 321
            RD ET E  +I AK VVN+TGP+SD +LQMD    G+P + L    N    S  ++IAV
Sbjct: 261 VRDRETGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAV 320

Query: 322 TDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVP 381
           ++P+MV+PS GVHIVLP+FYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVP
Sbjct: 321 SNPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVP 380

Query: 382 ENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGV 441
           ENP  TEADIQDILKELQHYI+FPVKR DVLSAWAG+RPL+RDPRTI  +G   S+TQG+
Sbjct: 381 ENPTATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTI-KEGDDVSSTQGL 439

Query: 442 VRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEW 501
           VR+HFL+TSDNGL+TIAGGKWTTYR+MAEET+D+VV+ G+F   KPC T+ IKLAGAE W
Sbjct: 440 VRNHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFQ-AKPCITKKIKLAGAEGW 498

Query: 502 TQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSS 561
             N+VA+LAQ YHLSSKM+ +L  NYGTRS IICE FK   +N+LP++   +EN  +Y +
Sbjct: 499 DPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKN 558

Query: 562 EENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKV 621
                VNFD+FRYPFTIGELKYSMQYEY RT LDFL+RRTRF FLDA++AL +   TV V
Sbjct: 559 -----VNFDSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSV 613

Query: 622 MGDEFNWSEKKRQWELEKTINFIKTFGV 649
           MGDE  WS+ +RQ E ++   FIKTFG+
Sbjct: 614 MGDELGWSDDRRQAERQQASEFIKTFGL 641

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/633 (63%), Positives = 486/633 (76%), Gaps = 10/633 (1%)

Query: 21  GSVYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXX 80
            ++ W   Q  + ++ ND +   P   +     +R+DLL +L+KT+QFDVLII       
Sbjct: 23  ATILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGT 82

Query: 81  XXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN 140
                   RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLV+EALN
Sbjct: 83  GSALDAATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALN 142

Query: 141 ERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE 200
           ER H++ TAPHLC +LPI+IP+YN WQ PY Y+GCK YD FAGSQNLK SY+L+ S   E
Sbjct: 143 ERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAE 202

Query: 201 KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVV 260
            APML    LKA LVYHDGSFNDSR+NATLA+TAVE GATVLNY+EV++LIK+  +GKV 
Sbjct: 203 VAPMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVE 262

Query: 261 GAEARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSGQPNSPLNDNSLIKSTF-NQI 319
           GA A+D ET E  +I AK VVNATGP+SD ILQMD +  G P+  L  +S I +T  +++
Sbjct: 263 GAVAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKV 322

Query: 320 AVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQ 379
           AV +P+MV+PS GVHIVLPSFYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQ
Sbjct: 323 AVANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQ 382

Query: 380 VPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKK---GS 436
           +PENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR    +       S
Sbjct: 383 IPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAAS 442

Query: 437 ATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLA 496
           +TQ +VRSHFLFTSDN L+TIAGGKWTTYR+M+EET+++VV+VG+F N KPC TR +KLA
Sbjct: 443 STQELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKLKLA 501

Query: 497 GAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENN 556
           GAE +  N  A+LAQ YHLSSKM+ YL  NYGTR+ +ICE FK+  +NKLP++   KEN 
Sbjct: 502 GAENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENV 561

Query: 557 VIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAH 616
            +Y +     V+FD+FRYPFTIGELKYS+  EY RT LDFL+RRTR+AFLDAK+AL +  
Sbjct: 562 TVYGN-----VDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVD 616

Query: 617 ATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649
            TVKVMGDE +W   +RQ E EK   FIKTFGV
Sbjct: 617 GTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/599 (67%), Positives = 472/599 (78%), Gaps = 8/599 (1%)

Query: 54  SRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 113
           +R  LL +L +  QFDVLII               RGL VALVE+ DFASGTSSKSTKM 
Sbjct: 61  TRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKMA 120

Query: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYM 173
           HGGVRYLEKAF++ SK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y  WQVPY Y 
Sbjct: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180

Query: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233
           GCK YD FAG+QNLK SYLLS+S  +E APML   NLKA+LVYHDGSFNDSRLNATLAIT
Sbjct: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240

Query: 234 AVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQ 293
           A+E GATVLNYVEVQ+L+KD  +G + G   RD+ET + + + +K VVNATGP+SD ILQ
Sbjct: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300

Query: 294 MDRNPSGQPNSPLNDNSLI--KSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 351
           MD+NP+G P+    +  +I  +   ++IAV +P MV+PS GVHI+LPS+YCPK MGLLDV
Sbjct: 301 MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV 360

Query: 352 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 411
           RTSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P+  EADIQDILKELQHYI+FPVKREDV
Sbjct: 361 RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV 420

Query: 412 LSAWAGVRPLVRDPRTIPADGKKG-SATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAE 470
           LSAWAG+RPLVRDPR +  D KK   +TQG+VRSHF+FTSDNGL+TIAGGKWTTYR+MAE
Sbjct: 421 LSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMAE 480

Query: 471 ETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTR 530
           ET+D+VV+ G F + KPC TR++KLAGAE W  N  ALL+Q Y+L S M+NYL  NYGTR
Sbjct: 481 ETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGTR 540

Query: 531 SSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYC 590
           S IICE F     NKLP+ LA +E   I  +      +F+TFRYP TIGELKYSM+YEY 
Sbjct: 541 SPIICELFLNDEINKLPVLLAGEEKEQILGN-----TDFNTFRYPITIGELKYSMRYEYA 595

Query: 591 RTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649
           RT LDFL+RRTRFAFLDAKEAL +   TVK+MGDEFNWS ++RQ E EKTI FIK+FGV
Sbjct: 596 RTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/600 (66%), Positives = 473/600 (78%), Gaps = 16/600 (2%)

Query: 54  SRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 113
           SR +LL RL+KT +FDVLII               RGLNVALVE  DFASGTSSKSTKM 
Sbjct: 55  SRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTKMA 114

Query: 114 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYM 173
           HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+YN WQVPY Y+
Sbjct: 115 HGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYV 174

Query: 174 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 233
           G K YD FAGSQNLK SYLLS S   E APML    LKA LVYHDGSFNDSR+N++LAIT
Sbjct: 175 GTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAIT 234

Query: 234 AVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQ 293
           A+E GATVLNYV++++L+K+  +GKV GA A D ET +  +I AK VVNATGPYSD +LQ
Sbjct: 235 AIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQ 294

Query: 294 MDRNPSGQPN----SPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLL 349
           MD++P+G P+      +N+N+ + +   +IAV +PKMV+PS GVHIVLPSFYCPK++GLL
Sbjct: 295 MDQSPTGLPDDSVLQKINENATVST---KIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLL 351

Query: 350 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 409
           D +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI FPVKRE
Sbjct: 352 DAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKRE 411

Query: 410 DVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469
           DVLSAWAG+RPLV+DPR   AD   GS TQ +VRSHFLFTS + L+TI+GGKWTTYR+MA
Sbjct: 412 DVLSAWAGIRPLVKDPRK--ADSGSGS-TQQLVRSHFLFTSPSNLVTISGGKWTTYREMA 468

Query: 470 EETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGT 529
           EET+D+VV+VG+F N KPC T+ +KL G E W  N  ALL+Q YHLSS MS +L  NYGT
Sbjct: 469 EETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGT 527

Query: 530 RSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEY 589
           R+ +ICE F E   NKLP++LA +EN  ++       V++D+FRYP+TIGELKYS++YEY
Sbjct: 528 RAPLICELFNEDPRNKLPVALAGQENVSVFGH-----VDYDSFRYPYTIGELKYSLKYEY 582

Query: 590 CRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649
            R  LDFL+RRTR+AFLDAK+ALN+   TVKVMGDE  W  KKRQ E+++   +IKTFGV
Sbjct: 583 ARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/621 (62%), Positives = 476/621 (76%), Gaps = 14/621 (2%)

Query: 31  DRRLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRG 90
           ++R + ND +      T      SR DLL +L+KT QFDVL+I               RG
Sbjct: 35  EQRRIANDVALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRG 94

Query: 91  LNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAP 150
           LNVALVE  DFASGTSSKSTKM HGGVRYLEKA ++ SKAQLDLVIEALNER H++NTAP
Sbjct: 95  LNVALVEMHDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAP 154

Query: 151 HLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNL 210
           HLC +LPI+IP+Y  WQ+PY Y+GCK YD FAGSQNLK SYLL+K    + APML    L
Sbjct: 155 HLCKILPIMIPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTL 214

Query: 211 KASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETN 270
           KA LVYHDGSFNDSR+N  LA+TA+ENGATVLNY+EV++LIKD  +GKV GA   + ET 
Sbjct: 215 KAGLVYHDGSFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETG 274

Query: 271 ELVKINAKCVVNATGPYSDAILQMDRNPSGQPN--SPLNDNSLIKSTFNQIAVTDPKMVI 328
           E   + AK  VNATGPYSD +LQMD N  G+P+   PL  N+ I +   ++AV +PKMV+
Sbjct: 275 EQFTVKAKVTVNATGPYSDKLLQMDENKDGKPDPTKPL-PNATIST---KVAVENPKMVV 330

Query: 329 PSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTE 388
           PS GVHI+LPSFYCP++MGLLDV+TSDGRVMFFLPWQGKVLAGTTDIP+KQVP+ P   E
Sbjct: 331 PSAGVHIILPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAE 390

Query: 389 ADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLF 448
           +DIQDIL+ELQHYI+FPVKREDVLSAWAG+RPLV DPR   + G  G +TQG+VRSH  F
Sbjct: 391 SDIQDILQELQHYIKFPVKREDVLSAWAGIRPLVIDPRK--SQGNTGGSTQGLVRSHLCF 448

Query: 449 TSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVAL 508
           T+DNG++TIAGGKWTTYR+MAEET+++VV+VG+F N+KPC TR +KL+GAE W  N  AL
Sbjct: 449 TTDNGMVTIAGGKWTTYREMAEETINEVVKVGKF-NVKPCITRKLKLSGAENWNPNLAAL 507

Query: 509 LAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVN 568
           LAQ YHLS  MSN+L +NYGTR+ +ICE F+E   N+LP++   +EN  +Y +     VN
Sbjct: 508 LAQKYHLSGAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGN-----VN 562

Query: 569 FDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNW 628
           FD+FRYPFTIGEL YS+ YEY RT LDFL+RRTRFAFLDA++AL++   TV VMGD+ NW
Sbjct: 563 FDSFRYPFTIGELNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNW 622

Query: 629 SEKKRQWELEKTINFIKTFGV 649
              +R+ E+EK+  FI+TFGV
Sbjct: 623 DSTRRKHEIEKSKEFIRTFGV 643

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/601 (65%), Positives = 472/601 (78%), Gaps = 10/601 (1%)

Query: 54  SRRDLLDRLA-KTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKM 112
           SR  L ++L  K HQFD+LII               RGLNVALVE+ DFASGTSSKSTKM
Sbjct: 58  SRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTKM 117

Query: 113 IHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIY 172
            HGGVRYLEKAF +FSK+QLDLVIEALNER HL+NTAPHLC +LPILIP+YN WQ+PY Y
Sbjct: 118 AHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFY 177

Query: 173 MGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAI 232
            GCKFYDFFAG QNLK SYL+S+   +E APML   NLKA+LVYHDGSFNDSRLN+++AI
Sbjct: 178 AGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAI 237

Query: 233 TAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAIL 292
           TA+ENGATVLNYVEV++L+KDP S K++G   +D ET E+  + +K +VNATGPYSD IL
Sbjct: 238 TAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTIL 297

Query: 293 QMDRNPSGQPNSPLNDNSLI--KSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLD 350
           QMD+N SG P+    D  +       ++IAV++PKMV+PS GVHI+LPS+YCPK MGLLD
Sbjct: 298 QMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLD 357

Query: 351 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 410
            RT+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P+  E DIQDILKELQHYI+FPV+RED
Sbjct: 358 ARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRED 417

Query: 411 VLSAWAGVRPLVRDPRTIPADG-KKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469
           VLSAWAG+RPLVRDPR I  D  +K   TQG+VRSHFLFTSDNGLITIAGGKWTTYR+MA
Sbjct: 418 VLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMA 477

Query: 470 EETVDKVVEVGRFHNL-KPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYG 528
           EET+D+VV+ G F N  KPC T+D+KL GAE W  N VALL+Q ++LSS M+ YL +NYG
Sbjct: 478 EETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYG 537

Query: 529 TRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYE 588
           TRS+IIC+ F+    NKLP+ LA  E+  I  +     V+F+TFRYP TI ELKY+M+YE
Sbjct: 538 TRSTIICQLFEREEMNKLPVQLAGIEDKPILGN-----VDFNTFRYPITIAELKYAMKYE 592

Query: 589 YCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFG 648
           Y RTPLDFL+RRTRFA+LDA +AL +   TVKVMGDEF W  K+R+ E++    FI++FG
Sbjct: 593 YARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFG 652

Query: 649 V 649
           V
Sbjct: 653 V 653

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/616 (63%), Positives = 473/616 (76%), Gaps = 12/616 (1%)

Query: 34  LVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNV 93
           +++N+A    P  +      +R +L++ L  T QFDVLII               RGLNV
Sbjct: 43  IIQNEAVLANPVDSPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNV 102

Query: 94  ALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLC 153
           ALVEK DFASGTSSKSTKM HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC
Sbjct: 103 ALVEKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLC 162

Query: 154 TVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKAS 213
            +LPI+IP+Y  WQVPY Y G K YD FAGSQNLK SYL+SK+   E APML    LKA 
Sbjct: 163 KILPIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAG 222

Query: 214 LVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELV 273
           LVYHDG+FNDSR+N+TLAITA+ENGATVLNY+EV++L+KDP+S ++ GA   D+ET E +
Sbjct: 223 LVYHDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKI 282

Query: 274 KINAKCVVNATGPYSDAILQMDRNPSGQPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGV 333
           +INAK +VNATGPYSD ILQMD N +G+P+      S   S   ++AV +P MV+PS GV
Sbjct: 283 QINAKVIVNATGPYSDKILQMDNNKNGKPDE--FTQSAETSIATKVAVQNPHMVVPSAGV 340

Query: 334 HIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQD 393
           HI+LPSFYCP++MGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+K VPENP  TEADIQD
Sbjct: 341 HIILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQD 400

Query: 394 ILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNG 453
           ILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR  P +G    ATQ +VRSHF+FTSD+G
Sbjct: 401 ILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPKEG----ATQELVRSHFIFTSDHG 456

Query: 454 LITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNY 513
           L+TIAGGKWTTYR+MAEET+D VV+ G+F N+KPC TR +KLAG E +  N  ALLAQ Y
Sbjct: 457 LVTIAGGKWTTYREMAEETIDTVVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKY 515

Query: 514 HLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFR 573
           HL SK+S +L  NYGTRS +IC+ F     N+LP+ LA KE N +Y +     V+FD+FR
Sbjct: 516 HLPSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGT-----VDFDSFR 570

Query: 574 YPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKR 633
           YP++I E+KY + +EY RT LDFL+RR+RFAFLDAK+AL S   TVK+MGDE NW E++R
Sbjct: 571 YPYSIAEVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERR 630

Query: 634 QWELEKTINFIKTFGV 649
           + E + +I +IKTFGV
Sbjct: 631 KQETDYSIEYIKTFGV 646

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/635 (63%), Positives = 475/635 (74%), Gaps = 23/635 (3%)

Query: 27  TTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXX 86
           T       V ND S   P  T      SR DLL +L KT+QFDVLII             
Sbjct: 34  TNNSSNNAVYNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDA 93

Query: 87  XXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLI 146
             RGLNVALVEK D+ASGTSSKSTKM HGGVRYLEKA ++ SKAQLDLVIEALNER HL+
Sbjct: 94  ATRGLNVALVEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLL 153

Query: 147 NTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLT 206
            TAPHLC +LPI+IP+Y  WQVPY Y+G K YD FAGSQNLK SYLLSKS+  E APML 
Sbjct: 154 YTAPHLCKILPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLD 213

Query: 207 TDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARD 266
           +  LKA LVYHDGSFNDSR+NATLAI+A+E GATVLNY+EV++L+KD  + K+ GA   D
Sbjct: 214 SSKLKAGLVYHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVED 273

Query: 267 VETNELVKINAKCVVNATGPYSDAILQMDRNPSGQPN------------SPLNDNSLIKS 314
            ET E  +I AK +VNATGPYSD ILQMD N +G P+            +PLN  +  +S
Sbjct: 274 TETGETYQIKAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVIT-PES 332

Query: 315 TFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTD 374
              ++AV +P MV+PS GVHI+LPS+YCP +MGLLD  T+DGRVMFFLPWQGKVLAGTTD
Sbjct: 333 ISKEVAVQNPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTD 392

Query: 375 IPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKK 434
           IP+K VPENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR      +K
Sbjct: 393 IPMKTVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV-----QK 447

Query: 435 GSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIK 494
           G ATQ VVRSHF+FTSDNGL+TIAGGKWTTYR+MAEET+D+VV+ G+F N KPC TR +K
Sbjct: 448 GGATQEVVRSHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLK 506

Query: 495 LAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKE 554
           LAGAE W  N  ALL+Q Y++S+ M+ +L  NYGTRS IICE  KES ENKLP++LA +E
Sbjct: 507 LAGAENWDANLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRE 566

Query: 555 NNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNS 614
           N  I     N  V +D+FRYP+TI ELKYSM YEY RT LDFL+RRTR+AFLDAKEAL++
Sbjct: 567 NESI----SNAHVGYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDA 622

Query: 615 AHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649
            + TVK+MGD  NW   +R+ E     ++IKTFGV
Sbjct: 623 VNGTVKIMGDHLNWDNDRREREKVYATDYIKTFGV 657

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/605 (63%), Positives = 462/605 (76%), Gaps = 21/605 (3%)

Query: 49  APPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSK 108
           AP   SR  LL++L KT QFDVL+I               RGLNVAL+E  D+ASGTSSK
Sbjct: 57  APAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSK 116

Query: 109 STKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQV 168
           STKM HGGVRYLEKAFWE SKAQLDLVIEALNER H+++TAPHLC +LPI+IP+Y  WQV
Sbjct: 117 STKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQV 176

Query: 169 PYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNA 228
           PY Y+G K YDFFAG QNLK SYLLS +   + APML    LKA LVYHDGSFNDSR+N+
Sbjct: 177 PYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNS 236

Query: 229 TLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYS 288
           TLA+TA+ENGAT+LNY+EV++L+K+P +GKV GA A D ET +   + AK VV+ATGP+S
Sbjct: 237 TLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFS 296

Query: 289 DAILQMDRNPSGQPN----SPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPK 344
           D ILQM+ +P G P+    S  N+ + I +   ++AV DPKMV+PS GVHI+LPSFYCPK
Sbjct: 297 DRILQMENHPKGLPDDLSLSKANEGATITT---KVAVADPKMVVPSSGVHIILPSFYCPK 353

Query: 345 DMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEF 404
           DMGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+F
Sbjct: 354 DMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKF 413

Query: 405 PVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTT 464
           PVKREDV SAWAG+RPLV+DPR      K  S TQ +VRSHFLFTSD+GL+TI+GGKWTT
Sbjct: 414 PVKREDVQSAWAGIRPLVKDPR------KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTT 467

Query: 465 YRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV 524
           YR+MA+ET+D+VV+VG F N KPC TR IKL G+E W  N  A+L+Q Y+L   +S YL 
Sbjct: 468 YREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLS 527

Query: 525 QNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYS 584
           +NYGT+++ ICE F+    N+LP+SLA        + +    V++D FRYPFT+GELKY+
Sbjct: 528 ENYGTKAAAICEIFQSDKRNQLPVSLA--------AEKAAANVDYDAFRYPFTVGELKYN 579

Query: 585 MQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFI 644
           ++ EY R PLDFL+RRTR+AFLDAK+A+ +   TVK+MGDE  W   KR+ E +  I FI
Sbjct: 580 IRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFI 639

Query: 645 KTFGV 649
           KTFGV
Sbjct: 640 KTFGV 644

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/607 (62%), Positives = 467/607 (76%), Gaps = 15/607 (2%)

Query: 50  PPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKS 109
           PP  SR +LL  L KT +FDVLII               RGLNVAL+E  DFAS TSSKS
Sbjct: 67  PP--SRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKS 124

Query: 110 TKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVP 169
           TKM HGGVRYLEKA ++ SKAQLDLVIEALNERKH++ TAPHLC +LPI+IP+YN W+VP
Sbjct: 125 TKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVP 184

Query: 170 YIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNAT 229
           Y Y GCK YDFFAGSQNLK +YLLSK++  + APML    LKA+LVYHDGSFND+R+N +
Sbjct: 185 YFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVS 244

Query: 230 LAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSD 289
           LA+TA+ENGATVLNY+EV++LIKDP +GK+ GA  RD ET++   + AK VVN+TGP+SD
Sbjct: 245 LAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSD 304

Query: 290 AILQMDRNPSGQPNSPLNDN-------SLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYC 342
            ILQMDRN SG P+     N       S+     ++IAV +PKMV+PS GVHI+LPS+YC
Sbjct: 305 NILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYC 364

Query: 343 PKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYI 402
           PKDMG+LDV+T+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP+ TEADI+DIL ELQHY 
Sbjct: 365 PKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYC 424

Query: 403 EFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKW 462
           +FPVKREDVLSAWAG+RPLVRDPR +  + K   +TQG+VRSHF+FTS+N L+TIAGGKW
Sbjct: 425 KFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKW 484

Query: 463 TTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNY 522
           TTYR+MAEET+D+ ++VG+  N KP  T+D+ L+G E WT N  ALL+Q YH+ S +S Y
Sbjct: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543

Query: 523 LVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELK 582
           L +NYGTR+ IICE  K+  +N+LP++LA KE+N I  +     V+F   RYP+T+ E+K
Sbjct: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGN-----VDFQALRYPYTVAEVK 598

Query: 583 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTIN 642
           Y +  EY RT LDFLLRRTRF FLDAKEA+N+   TV +MGDE NW  +KR  E++K+  
Sbjct: 599 YCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKE 658

Query: 643 FIKTFGV 649
           +IKT GV
Sbjct: 659 YIKTLGV 665

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/602 (63%), Positives = 460/602 (76%), Gaps = 16/602 (2%)

Query: 49  APPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSK 108
           AP   SR +LL++L KT+QFDVL+I               RGLNVAL+E  DFASGTSSK
Sbjct: 45  APAPPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSK 104

Query: 109 STKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQV 168
           STKM HGGVRYLEKA WE SKAQLDLVIEALNER HL+ TAPHLC VLPI+IP+Y  WQV
Sbjct: 105 STKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQV 164

Query: 169 PYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNA 228
           PY Y+G K YDFFAGSQNLK SYLLS SA  E APML    LKA LVYHDGSFNDSR+NA
Sbjct: 165 PYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNA 224

Query: 229 TLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYS 288
           T+A+TA+ENGATVLNY+EV+RLIK+P  GKV GA A D ET +   + AK VVNATGP+S
Sbjct: 225 TIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFS 284

Query: 289 DAILQMDRNPSGQPNSPLNDNSLIKSTF-NQIAVTDPKMVIPSIGVHIVLPSFYCPKDMG 347
           D +LQMD +P G P+  + D     ST   ++AV +PKMV+PS GVHI+LPS+YCPK+MG
Sbjct: 285 DRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMG 344

Query: 348 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 407
           LLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NP  TEADIQDILKELQHYI+FPVK
Sbjct: 345 LLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVK 404

Query: 408 REDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 467
           REDV SAWAG+RPLV+DPR      K  S TQG+VRSH +FTS NG++TI+GGKWTTYR+
Sbjct: 405 REDVQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYRE 458

Query: 468 MAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNY 527
           MAEETV++VV+VG+F N KPC TR +KL+GAE W  N  ALL+  Y++   ++ +L QNY
Sbjct: 459 MAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNY 518

Query: 528 GTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQY 587
           GT+++ +CE F++   N LP+SLA         +++   ++++ FRYP+TIGELK++M +
Sbjct: 519 GTKAAQVCELFEDDRANMLPVSLA---------ADKPTSIDYNAFRYPYTIGELKFTMTH 569

Query: 588 EYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTF 647
           EY RTPLDFL+RRTR+AFLDAK+AL +   TVKVMGD   W   KR  E +  I +IKTF
Sbjct: 570 EYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTF 629

Query: 648 GV 649
           GV
Sbjct: 630 GV 631

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/610 (62%), Positives = 454/610 (74%), Gaps = 20/610 (3%)

Query: 44  PFPTAAPPQVSRRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFAS 103
           P P+   P  SR DLL  L KT +FDVLII               RGLNVA VE  DFAS
Sbjct: 50  PRPSVNLP--SREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVACVEANDFAS 107

Query: 104 GTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIY 163
           GTSSKSTKM HGGVRYLEKA +E S+AQLDLVIEALNER H++ TAPHLC +LPI+IP+Y
Sbjct: 108 GTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVY 167

Query: 164 NTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFND 223
           + WQVPY + GCK YD+FAG QNL+ SYLLSK+   E APML    LKA LVYHDGSFND
Sbjct: 168 SYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFND 227

Query: 224 SRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNA 283
           SR+N+TLAI+A+E+GATVLNYV+V +L+KD ++ KV GA   D ET +  ++ AK  VNA
Sbjct: 228 SRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNA 287

Query: 284 TGPYSDAILQMDRNPSG----QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPS 339
           TGPYSD ILQMD+N +G    QP  P N      S   ++AV  P MV+PS GVHI+LPS
Sbjct: 288 TGPYSDLILQMDKNKNGLPDPQPPQPAN-----VSIATEVAVNKPNMVVPSAGVHIILPS 342

Query: 340 FYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQ 399
           +YCPK +GLLDV+T+DGRVMFFLPWQGKVLAGTTDIP+K VP+NP  TEADIQDIL+ELQ
Sbjct: 343 YYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQ 402

Query: 400 HYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAG 459
           HYI+FPV+REDVLSAWAG+RPLV DPR        G +T+G+VR+H +FTS+ GLIT+AG
Sbjct: 403 HYIKFPVRREDVLSAWAGIRPLVMDPRK---RKDTGGSTEGLVRNHLIFTSETGLITLAG 459

Query: 460 GKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKM 519
           GKWTTYR+MAE+T+D+VV+ G F ++KPC TR IKLAG E WT N  ALLAQ+Y LS  M
Sbjct: 460 GKWTTYREMAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAM 518

Query: 520 SNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIG 579
           S +L  NYGTR+ IICE FKE   N+LP++   +EN  +        VNFD+FRYPFTIG
Sbjct: 519 SQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHH-----VNFDSFRYPFTIG 573

Query: 580 ELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEK 639
           E  YS+++EY R   DFL+RRTR+AFLDA  AL +   TVKVMGDE NW   +RQ E+E+
Sbjct: 574 EFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEE 633

Query: 640 TINFIKTFGV 649
              FIKTFGV
Sbjct: 634 CTEFIKTFGV 643

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/603 (60%), Positives = 433/603 (71%), Gaps = 26/603 (4%)

Query: 55  RRDLLDRLAKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIH 114
           R  +L RL  T +FDVL++               RGL VALVEK DFA+GTSSKSTK+ H
Sbjct: 61  RAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKLAH 119

Query: 115 GGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMG 174
           GGVRYLEKA +E SK QLDLV+EALNER HL+  APHL  +LPI+IP+Y  W+VPY Y G
Sbjct: 120 GGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAG 179

Query: 175 CKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITA 234
           CK YDFFAG+QNLK SYLLS+      APML    LK  LVYHDG FNDSRL ATLAI+A
Sbjct: 180 CKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISA 239

Query: 235 VENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQM 294
           VE GATV NYV V++LIKD  +G + GA+  D ET     +NAK VVNATGPYSD ILQM
Sbjct: 240 VERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQM 299

Query: 295 DRNPSG----QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLD 350
           D NP G    +P     +N+L       IAV +PKMV+PS GVHI LPSFYCP +MGLLD
Sbjct: 300 DANPQGLPEKEPEKATPENAL-------IAVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352

Query: 351 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 410
             TSDGRVMFFLPWQGKV+AGTTDIPLKQVP +P PTEADIQDIL+ELQHYI+FPV+RED
Sbjct: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412

Query: 411 VLSAWAGVRPLVRDPRTIPADGKKGSA-TQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469
           VLSAWAG+RPLVRDPR   A+G  GS  T+G+VRSHF+FTS   L+TIAGGKWTTYR+MA
Sbjct: 413 VLSAWAGIRPLVRDPRV--AEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMA 470

Query: 470 EETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYH-LSSKMSNYLVQNYG 528
           EETVD+V++VG+F  LKPC TR  KL GA+ W  N+ A L Q Y  L   ++ +L  NYG
Sbjct: 471 EETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYG 530

Query: 529 TRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD--TFRYPFTIGELKYSMQ 586
            R+ IICE F+    +KLP+ L        Y   ++ + N D   F YPFTI ELKY ++
Sbjct: 531 DRAPIICEMFEADKSSKLPVGL--------YGDGDDKVKNMDANAFDYPFTIAELKYCIR 582

Query: 587 YEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKT 646
           +EY RT LDFLLRR+RFAFLDA+EALN+   TV ++GDE  W  +KR  E  KT  +IKT
Sbjct: 583 FEYVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKT 642

Query: 647 FGV 649
           FGV
Sbjct: 643 FGV 645

>Smik_13.408 Chr13 (648920..649690) [771 bp, 256 aa] {ON} YMR200W
           (REAL)
          Length = 256

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 65/159 (40%), Gaps = 30/159 (18%)

Query: 162 IYNTW--QVPYIYMGCKFYD----FFAGSQNLKKSYLLSKSATVEKAPMLTTDNL----- 210
           +Y TW  +   ++ G  FYD              SY  ++    E+A    + N      
Sbjct: 31  LYGTWSSKSNQVFTGPGFYDPVDELLIEPSLPGLSYSFTEDGWYEEATYQVSGNPRDPTC 90

Query: 211 -KASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEV--QRLIKDPASGKVVGAEARDV 267
            KASL+Y  G++N S           ENG   LN +EV  ++L  DP + + V   +R  
Sbjct: 91  PKASLIYQHGTYNIS-----------ENGTLTLNPIEVDGRQLFSDPCTDQGVSTYSRYN 139

Query: 268 ETNELVKINAKCVVNATGPYSDAILQMDRNPSGQPNSPL 306
           +T E+ K     +    G Y+  + Q D    G P  PL
Sbjct: 140 QT-EIFKEYNVGIDPYHGIYTLQLYQFD----GTPMQPL 173

>SAKL0G16610g Chr7 (1434140..1440040) [5901 bp, 1966 aa] {ON} similar
            to uniprot|Q06409 Saccharomyces cerevisiae YLR422W
            Hypothetical ORF
          Length = 1966

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 56/131 (42%), Gaps = 32/131 (24%)

Query: 240  TVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKC--VVNATGPYSDAILQMDRN 297
            T++N  EV+++ +   S       +  ++  EL  +   C  ++   G YS+   ++ RN
Sbjct: 1685 TLMNRTEVKKISEKVLSPVENAIRSLQLKIQELTGLENMCYKLIKENGEYSEIFGELSRN 1744

Query: 298  PSGQPNSPLN----------------------DNSLIKSTFNQIAVTDPKMVIPSIGVHI 335
             SG  ++P+N                      D +L++S F+++AV   +     + +H 
Sbjct: 1745 ISGTIDAPINGGVSRYREFFEATEAKAEFKESDTNLLQSAFDELAVVLSR----CLALHD 1800

Query: 336  VLPSFYCPKDM 346
             L    CP D+
Sbjct: 1801 EL----CPVDL 1807

>CAGL0M00770g Chr13 (86290..89556) [3267 bp, 1088 aa] {ON} weakly
           similar to uniprot|P06701 Saccharomyces cerevisiae
           YLR442c SIR3 silencing regulatory and DNA-repair protein
          Length = 1088

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 64/136 (47%), Gaps = 6/136 (4%)

Query: 468 MAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQ--NYVALLAQNYHLSSKMSNYLVQ 525
           +  + +DK  E      LKP  T    L   +++ Q  N V L AQ+ + S  +   L +
Sbjct: 569 LCHQPIDKTPEKSNDEKLKPLLTALSDLTTNKQFVQLRNIVGLTAQSKN-SGSIFEKLRK 627

Query: 526 NYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSM 585
              + S I C    +S+ + + LS+ +KE   IY S  N ++N    +  +  G+ +Y++
Sbjct: 628 CTTSESLIQC--MSDSITSDIILSMRNKEFVTIYGSLFNAIINGRN-KSLYLTGDDEYTI 684

Query: 586 QYEYCRTPLDFLLRRT 601
           +Y + +   + LL  T
Sbjct: 685 KYVFNKVAHELLLSAT 700

>Smik_15.439 Chr15 complement(757966..760386) [2421 bp, 806 aa] {ON}
           YOR256C (REAL)
          Length = 806

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 72/178 (40%), Gaps = 39/178 (21%)

Query: 173 MGCKFYDFFAGSQNLKKSYLLSKSATVEKAPM-LTTDNL----------KASLVYH-DGS 220
           MGC  Y  + G  N+  SY  +++   EK  + L+T+N           K SL+Y   G+
Sbjct: 213 MGCLVYSNYPG--NVTISYYDNEN---EKHDLRLSTENFNPLSSNGKLSKVSLIYGGKGT 267

Query: 221 FND-SRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKC 279
            ND   L  +  I   ++   +LNY E+        S +V+ AE          K  AK 
Sbjct: 268 TNDLQNLKNSKTIEDGKDYVLLLNYDEI-------VSQQVLIAE----------KFGAKA 310

Query: 280 VVNATGPYSDAILQMDRNPSGQPNSPLNDNSLIKSTFNQIAVTDPKMV----IPSIGV 333
           V+  + PY D I  +   P G P     D S        +   DPK      IP+I +
Sbjct: 311 VIFISEPYGDNIDVIQSKPVGLPQYSTGDASTPTWFHPNVEEEDPKFWRLAHIPTIPI 368

>SAKL0E06512g Chr5 (532120..533331) [1212 bp, 403 aa] {ON} conserved
           hypothetical protein
          Length = 403

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 268 ETNELVKINAKCVVNATGPYSDAILQM 294
           E+NE V+IN + V+NA+G Y+D +  M
Sbjct: 222 ESNEKVEINVENVINASGLYADQVANM 248

>TBLA0H02070 Chr8 (492770..497335) [4566 bp, 1521 aa] {ON} Anc_5.191
           YLR024C
          Length = 1521

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 556 NVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRT 601
           N+IY    NN  NF +F  P TI  LK  ++++  +  L  +LR T
Sbjct: 830 NLIYICLLNNFKNFQSFFTPITISHLKSLLKFDSIQLLLQNILRMT 875

>Kpol_1008.7 s1008 complement(9101..11500) [2400 bp, 799 aa] {ON}
           complement(9101..11500) [2400 nt, 800 aa]
          Length = 799

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 128 SKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNL 187
           +  +L+  +E ++   +LIN      ++LP+     +   VP+IY+G KF  F     +L
Sbjct: 404 TDEELEKYLEYVSHPMNLINLPRAEGSLLPVFGKRISGMTVPWIYVGSKFSTF---CWHL 460

Query: 188 KKSYLLSKSATVEKAPML-------TTDNLKASLV 215
           +  Y LS +   E AP +       + D+L++ LV
Sbjct: 461 EDQYTLSANYQHEGAPKVWYSIPEYSCDSLRSYLV 495

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,423,881
Number of extensions: 2881183
Number of successful extensions: 8219
Number of sequences better than 10.0: 33
Number of HSP's gapped: 8406
Number of HSP's successfully gapped: 33
Length of query: 649
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 533
Effective length of database: 40,180,143
Effective search space: 21416016219
Effective search space used: 21416016219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)