Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.125.712ON1064106447390.0
Smik_9.135.712ON1060106440960.0
Suva_9.305.712ON106253722330.0
YIL156W (UBP7)5.712ON107154022130.0
NDAI0F002005.712ON110549614510.0
TDEL0B020805.712ON102548514311e-180
NCAS0G001705.712ON103048514171e-178
KNAG0L022005.712ON116150513701e-170
SAKL0E15136g5.712ON103749013601e-170
CAGL0H06721g5.712ON108148513511e-168
KLLA0A00396g5.712ON101248213131e-163
Kwal_55.196455.712ON97053112961e-161
Kpol_2001.785.712ON40345112281e-159
KLTH0E00814g5.712ON97447912711e-157
TPHA0D046605.712ON104548012451e-153
TBLA0E017605.712ON121250712411e-151
Ecym_40095.712ON151748912481e-149
AFR296C5.712ON116948111771e-142
YKR098C (UBP11)5.712ON71749611241e-139
Smik_11.3625.712ON72148311141e-137
Suva_11.3355.712ON72448911071e-136
Skud_11.3385.712ON71248510811e-133
KAFR0D021605.712ON84648510511e-127
ZYRO0B16544g5.712ON10444869561e-111
Kpol_304.65.712ON5624798135e-96
CAGL0G02563gsingletonON6314838021e-93
KAFR0H001505.712ON6562656662e-74
TPHA0C027708.188ON9702492802e-24
TBLA0F036108.188ON11442692793e-24
KNAG0D019308.188ON9862492766e-24
Kwal_14.20088.188ON4242622686e-24
AFR007W8.188ON8482502741e-23
YER144C (UBP5)8.188ON8052722684e-23
NDAI0A036808.188ON11162532677e-23
Skud_4.3238.188ON9262422651e-22
KAFR0C025908.188ON9782522642e-22
KLLA0E10275g8.188ON7962522632e-22
Kpol_1032.288.188ON8822492632e-22
Smik_4.3078.188ON9292422623e-22
TDEL0B042208.188ON8252572613e-22
Ecym_61848.188ON8512532595e-22
Suva_2.2288.188ON9272412589e-22
YDR069C (DOA4)8.188ON9262432589e-22
KLTH0H07678g8.188ON8612482571e-21
CAGL0I06765g8.188ON8872682533e-21
Smik_5.3098.188ON8052672499e-21
NCAS0B042808.188ON9222442453e-20
CAGL0G05247g8.188ON9472452444e-20
Suva_5.2728.188ON7882762434e-20
SAKL0H18986g8.188ON8932602434e-20
Skud_5.2818.188ON8232732435e-20
NDAI0C059008.188ON8262512372e-19
ZYRO0G06798g8.188ON8772672372e-19
NCAS0A039108.188ON7952462033e-15
NCAS0I031401.137ON12012061953e-14
AFR627C1.137ON12872201863e-13
ZYRO0C17908g1.137ON12042131845e-13
KNAG0G015908.188ON6712381801e-12
TPHA0A025401.137ON12862141783e-12
KLTH0F03674g1.137ON11982071774e-12
NDAI0B004801.137ON12532121756e-12
TDEL0C056401.137ON11782271702e-11
KNAG0C021801.137ON12312091693e-11
CAGL0L01639g1.137ON11471991684e-11
KAFR0F015601.137ON11712081659e-11
YJL197W (UBP12)1.137ON12542011632e-10
Smik_10.371.137ON12472051622e-10
Suva_6.2761.137ON12562021579e-10
Skud_10.221.137ON12552001561e-09
Kpol_2001.541.137ON12232001523e-09
Kwal_33.136281.137ON11602051523e-09
KLLA0C03476g1.137ON12522011523e-09
TBLA0J006001.137ON14622201524e-09
Ecym_81401.137ON12642201498e-09
ZYRO0F01276g3.270ON7761931415e-08
KNAG0C035807.390ON7761341399e-08
TPHA0L022905.18ON11931221381e-07
Suva_2.507.390ON7501351372e-07
TBLA0D010708.742ON4832791352e-07
NCAS0E026107.390ON7171361353e-07
Suva_4.2953.270ON7821911353e-07
KLLA0C06974g8.742ON4462491343e-07
NDAI0E041807.390ON8271361344e-07
NCAS0D023905.18ON12111051327e-07
CAGL0I05522g7.390ON7241341318e-07
Kpol_513.255.18ON11902341319e-07
Smik_2.497.390ON7451341301e-06
KNAG0B023707.390ON7531021301e-06
ZYRO0B03300g7.390ON8131301291e-06
NDAI0A016707.390ON8461341292e-06
YBL067C (UBP13)7.390ON7471351282e-06
Skud_2.387.390ON7481321272e-06
Ecym_46857.390ON7781341272e-06
SAKL0C04246g1.137ON12971391273e-06
NCAS0I016203.270ON7952731264e-06
TDEL0D035503.270ON7802361255e-06
TPHA0P006807.390ON7271301245e-06
Kwal_34.162681.369ON4491391235e-06
CAGL0A04477g7.390ON7701311237e-06
TBLA0E025703.270ON7851211237e-06
KAFR0A069102.307ON6782611237e-06
ZYRO0D07062g5.18ON11931181212e-05
Ecym_56715.18ON11762361202e-05
YMR304W (UBP15)5.18ON12302351202e-05
NDAI0I025305.18ON11971381202e-05
NCAS0C021108.540ON4942041182e-05
CAGL0M11198g8.742ON4611341182e-05
NCAS0A143707.390ON7291371183e-05
KLTH0H13354g1.369ON4951321173e-05
Skud_2.1773.270ON7821911183e-05
TBLA0C012001.369ON5031121173e-05
CAGL0M13783g5.18ON11962341174e-05
Smik_13.5215.18ON12312351174e-05
NDAI0C059508.202ON10801441166e-05
Suva_13.4955.18ON12302351166e-05
Kwal_26.91518.742ON4541291146e-05
AGL357W5.18ON11661151157e-05
KAFR0A042108.742ON4401261147e-05
YMR223W (UBP8)8.742ON4711371148e-05
Smik_13.4318.742ON4711351148e-05
Skud_13.4785.18ON12312351159e-05
TPHA0E008707.390ON7151011131e-04
TDEL0C015707.390ON7651301131e-04
TPHA0G005608.742ON4632441111e-04
KNAG0A019708.540ON4711471111e-04
ZYRO0G01188g1.369ON5001261121e-04
Suva_5.2177.390ON7541371121e-04
Kpol_534.231.369ON4961131112e-04
TBLA0C070205.18ON12471211122e-04
KLLA0D08459g2.69ON7501301112e-04
Ecym_27171.369ON4831121112e-04
SAKL0H04994g8.742ON4541291102e-04
Kpol_1045.417.390ON7121261112e-04
CAGL0H10186g3.270ON7782351102e-04
Suva_13.4078.742ON4711351102e-04
KNAG0G029308.742ON4592571093e-04
KLTH0D12760g8.742ON4531331093e-04
YER098W (UBP9)7.390ON7541361093e-04
KNAG0E012905.18ON11961211103e-04
TDEL0G004105.18ON11861181103e-04
Kpol_1018.937.390ON7551291093e-04
Skud_5.2237.390ON7481331094e-04
Skud_13.3928.742ON4731371075e-04
SAKL0H00418g5.18ON11901111085e-04
NCAS0B005808.742ON4661311066e-04
SAKL0H18656g8.202ON7721511076e-04
KAFR0I026005.18ON12132381076e-04
AEL242W8.540ON613851067e-04
NDAI0A074103.270ON8101311068e-04
Smik_5.2447.390ON7491331068e-04
ZYRO0A05962g8.742ON4651261058e-04
Kwal_26.95985.18ON11912331060.001
Klac_YGOB_Anc_5.18b5.18ON11661201050.001
KNAG0J008003.270ON7651151040.001
NCAS0D006001.369ON4931281040.001
Kpol_251.73.270ON4801161030.002
TDEL0B036708.742ON4631301030.002
TBLA0D006207.390ON11711341040.002
NDAI0E008108.742ON4931371030.002
KLTH0B09944g5.18ON11891181040.002
NDAI0F034102.69ON8702041030.002
KAFR0L017307.390ON701321030.002
KAFR0E009308.540ON4982731020.002
KNAG0C019401.369ON4991091010.003
KAFR0K018107.390ON7141301010.003
TPHA0A025101.369ON5051161000.003
Kwal_33.144302.69ON5112571000.003
Kwal_56.230843.270ON7621381000.005
AGR023C3.270ON780127990.005
CAGL0K10494g1.369ON495127980.006
KAFR0C004103.270ON769186980.006
Smik_2.1893.270ON782205980.007
Ecym_62488.742ON466107970.007
KAFR0C045201.369ON499109970.008
KLLA0E20351g7.390ON697193970.009
KLLA0A10791g1.369ON484109970.009
Kpol_1064.488.742ON466106960.009
Ecym_11668.540ON69677960.013
CAGL0I06600g8.202ON816145950.014
KLTH0H07370g8.202ON781155950.015
SAKL0E13002g2.69ON739249950.015
Skud_16.2098.540ON50372940.018
Suva_6.831.369ON500112940.018
TDEL0D024001.369ON494112940.020
Kpol_1024.448.540ON49680930.021
SAKL0D03322g3.270ON765121940.023
KLLA0F18700g3.270ON770111930.025
TPHA0J026205.443ON122526930.030
CAGL0J11352g2.69ON771194920.035
TDEL0B030608.540ON73479920.035
NDAI0H035501.369ON502114910.038
SAKL0H10076g8.540ON76779920.040
AGR370W7.390ON740141910.045
YFR010W (UBP6)1.369ON499122900.049
SAKL0D10120g1.369ON492112900.055
Kpol_219.1singletonON24979880.055
YPL072W (UBP16)8.540ON49972900.057
ZYRO0D03982g8.540ON82179900.058
ZYRO0G01606g5.443ON130539900.068
AEL029W1.369ON446109890.073
KNAG0B041905.443ON126289890.082
KLLA0E01013g8.202ON774146880.092
Kpol_1016.15.443ON125133890.098
KNAG0A054502.307ON764274880.099
KLLA0E08801g2.307ON771313880.11
CAGL0H05335g8.540ON483159870.11
Smik_16.1638.540ON50172870.12
SAKL0F12430g7.390ON754134870.13
YBR058C (UBP14)3.270ON781131870.13
Kpol_1062.235.443ON126695870.15
SAKL0G02728g5.443ON123753870.15
TPHA0E017105.443ON128331870.15
Smik_7.3141.369ON49945860.16
ZYRO0B11044g8.202ON826143860.17
NCAS0A038408.202ON917141860.17
CAGL0K10252g5.443ON126730860.19
KLLA0E02377g5.443ON1220139850.23
TPHA0D043508.202ON854133850.24
TBLA0A064705.443ON132030850.24
Kwal_55.213935.443ON123330850.25
KLTH0E12540g8.540ON75277850.26
NDAI0C015505.443ON129590850.28
TBLA0B019308.202ON1019144850.28
KLLA0E23387g8.540ON78285840.29
Suva_8.1765.443ON127038840.30
Kwal_27.120308.540ON74979840.30
Skud_6.941.369ON499109830.33
TDEL0D025805.443ON127226830.42
KLTH0F15862g5.443ON124126830.47
KLTH0C07326g3.270ON762118820.53
Ecym_55448.202ON834148820.56
TDEL0A016208.202ON795142820.58
Ecym_45145.443ON124626820.62
Skud_15.2865.443ON127826820.65
KAFR0D050705.443ON122788810.69
Kwal_14.19578.202ON444157800.70
TBLA0H036008.540ON482205810.70
YOR124C (UBP2)5.443ON127226810.74
Smik_15.3015.443ON127226810.75
ACL164C5.443ON138934810.75
KLTH0C06732g7.390ON714127800.91
Kwal_27.108427.390ON711131801.0
TPHA0M010903.270ON780140791.2
KLLA0E14125g8.97ON477129781.3
KNAG0G016708.202ON897143781.4
AGR139C8.202ON78977781.4
NDAI0B034302.307ON856290781.5
NDAI0E028208.540ON49578762.2
TPHA0L016708.540ON52468762.6
NCAS0H021005.443ON126926762.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.12
         (1064 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...  1830   0.0  
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...  1582   0.0  
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   864   0.0  
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   857   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     563   0.0  
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   555   e-180
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     550   e-178
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   532   e-170
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   528   e-170
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   525   e-168
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   510   e-163
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   503   e-161
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   477   e-159
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   494   e-157
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   484   e-153
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   482   e-151
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   485   e-149
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   457   e-142
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   437   e-139
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   433   e-137
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   431   e-136
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   421   e-133
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   409   e-127
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   372   e-111
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   317   5e-96
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   313   1e-93
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   261   2e-74
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   112   2e-24
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   112   3e-24
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   110   6e-24
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   107   6e-24
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   110   1e-23
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   107   4e-23
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             107   7e-23
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   106   1e-22
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   106   2e-22
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   105   2e-22
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   105   2e-22
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   105   3e-22
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   105   3e-22
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   104   5e-22
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   103   9e-22
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   103   9e-22
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   103   1e-21
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...   102   3e-21
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   100   9e-21
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     99   3e-20
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    99   4e-20
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    98   4e-20
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    98   4e-20
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    98   5e-20
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    96   2e-19
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    96   2e-19
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     83   3e-15
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    80   3e-14
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    76   3e-13
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    75   5e-13
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    74   1e-12
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    73   3e-12
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    73   4e-12
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    72   6e-12
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    70   2e-11
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    70   3e-11
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    69   4e-11
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    68   9e-11
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    67   2e-10
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    67   2e-10
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    65   9e-10
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    65   1e-09
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    63   3e-09
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    63   3e-09
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    63   3e-09
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    63   4e-09
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    62   8e-09
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    59   5e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    58   9e-08
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    58   1e-07
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    57   2e-07
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    57   2e-07
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    57   3e-07
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    57   3e-07
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    56   3e-07
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    56   4e-07
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    55   7e-07
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    55   8e-07
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    55   9e-07
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    55   1e-06
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    55   1e-06
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    54   1e-06
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    54   2e-06
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    54   2e-06
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    54   2e-06
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    54   2e-06
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    54   3e-06
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    53   4e-06
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    53   5e-06
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    52   5e-06
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    52   5e-06
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    52   7e-06
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    52   7e-06
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    52   7e-06
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    51   2e-05
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    51   2e-05
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    51   2e-05
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    51   2e-05
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    50   2e-05
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    50   2e-05
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    50   3e-05
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    50   3e-05
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    50   3e-05
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    50   3e-05
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    50   4e-05
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    50   4e-05
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    49   6e-05
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    49   6e-05
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    49   6e-05
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    49   7e-05
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    49   7e-05
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    49   8e-05
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    49   8e-05
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    49   9e-05
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    48   1e-04
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    48   1e-04
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    47   1e-04
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    47   1e-04
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    48   1e-04
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    48   1e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    47   2e-04
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    48   2e-04
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    47   2e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    47   2e-04
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    47   2e-04
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    47   2e-04
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    47   2e-04
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    47   2e-04
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    47   3e-04
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    47   3e-04
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    47   3e-04
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    47   3e-04
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    47   3e-04
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    47   3e-04
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    47   4e-04
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    46   5e-04
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    46   5e-04
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       45   6e-04
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    46   6e-04
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    46   6e-04
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    45   7e-04
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    45   8e-04
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    45   8e-04
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    45   8e-04
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    45   0.001
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    45   0.001
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    45   0.001
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    45   0.001
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    44   0.002
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    44   0.002
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    45   0.002
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    44   0.002
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    45   0.002
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    44   0.002
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    44   0.002
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    44   0.002
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    44   0.003
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    44   0.003
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    43   0.003
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    43   0.003
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    43   0.005
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    43   0.005
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    42   0.006
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    42   0.006
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    42   0.007
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    42   0.007
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    42   0.008
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    42   0.009
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    42   0.009
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    42   0.009
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    42   0.013
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    41   0.014
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    41   0.015
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    41   0.015
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    41   0.018
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    41   0.018
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    41   0.020
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    40   0.021
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    41   0.023
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    40   0.025
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    40   0.030
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    40   0.035
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    40   0.035
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.038
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    40   0.040
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    40   0.045
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    39   0.049
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    39   0.055
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    39   0.055
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    39   0.057
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    39   0.058
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    39   0.068
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    39   0.073
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    39   0.082
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    39   0.092
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    39   0.098
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    39   0.099
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    39   0.11 
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    38   0.11 
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    38   0.12 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    38   0.13 
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    38   0.13 
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    38   0.15 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    38   0.15 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    38   0.15 
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    38   0.16 
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    38   0.17 
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    38   0.17 
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    38   0.19 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    37   0.23 
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    37   0.24 
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    37   0.24 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    37   0.25 
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    37   0.26 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    37   0.28 
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    37   0.28 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    37   0.29 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    37   0.30 
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    37   0.30 
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    37   0.33 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    37   0.42 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    37   0.47 
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    36   0.53 
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    36   0.56 
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    36   0.58 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    36   0.62 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    36   0.65 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    36   0.69 
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    35   0.70 
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    36   0.70 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    36   0.74 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    36   0.75 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    36   0.75 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   0.91 
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    35   1.0  
TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {...    35   1.2  
KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} simi...    35   1.3  
KNAG0G01670 Chr7 complement(366899..369592) [2694 bp, 897 aa] {O...    35   1.4  
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    35   1.4  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     35   1.5  
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    34   2.2  
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    34   2.6  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    34   2.6  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    33   3.7  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    33   3.8  
CAGL0A02486g Chr1 (266055..268655) [2601 bp, 866 aa] {ON} some s...    33   4.3  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    32   9.0  

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score = 1830 bits (4739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 925/1064 (86%), Positives = 925/1064 (86%)

Query: 1    MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRH 60
            MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQ                     DSMRH
Sbjct: 1    MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRH 60

Query: 61   NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
            NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE
Sbjct: 61   NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120

Query: 121  IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDA 180
            IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDA
Sbjct: 121  IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDA 180

Query: 181  EQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDGG 240
            EQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDGG
Sbjct: 181  EQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDGG 240

Query: 241  ASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQ 300
            ASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQ
Sbjct: 241  ASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQ 300

Query: 301  KQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTP 360
            KQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTP
Sbjct: 301  KQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTP 360

Query: 361  VYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTS 420
            VYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTS
Sbjct: 361  VYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTS 420

Query: 421  VPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPYXXXXXXXXXXXXXXXXXXXXXXXXX 480
            VPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPY                         
Sbjct: 421  VPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPYSQKAHQQQQQEQQQSNAQDSSSSKE 480

Query: 481  XXXXXXXXXXWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYSHDNSFSRKPP 540
                      W                                   MVYSHDNSFSRKPP
Sbjct: 481  SSAKVPEPPSWKPPDLPIRLRKRPPPPPPVSMPTTPGIPPPLPPKIMVYSHDNSFSRKPP 540

Query: 541  IPAKQHVKKQQLNSNEIIXXXXXXXXXXXXXXXLLQPQPQRAYNIPTIEQSSNVYVSLSI 600
            IPAKQHVKKQQLNSNEII               LLQPQPQRAYNIPTIEQSSNVYVSLSI
Sbjct: 541  IPAKQHVKKQQLNSNEIIQRKRQQQKHRHYGQQLLQPQPQRAYNIPTIEQSSNVYVSLSI 600

Query: 601  TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF
Sbjct: 601  TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660

Query: 661  NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND
Sbjct: 661  NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720

Query: 721  YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
            YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS
Sbjct: 721  YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780

Query: 781  TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCGPTXXXX 840
            TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCGPT    
Sbjct: 781  TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCGPTASSS 840

Query: 841  XXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINESNSSNTVTFERERS 900
                         PIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINESNSSNTVTFERERS
Sbjct: 841  SASASASAFESESPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINESNSSNTVTFERERS 900

Query: 901  RSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKTINFVTLPKILVIHLSRF 960
            RSPFKMLGSSGKRSNSSTPFA                LTTVKTINFVTLPKILVIHLSRF
Sbjct: 901  RSPFKMLGSSGKRSNSSTPFANNNNDGNNINDFKNKKLTTVKTINFVTLPKILVIHLSRF 960

Query: 961  YYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVD 1020
            YYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVD
Sbjct: 961  YYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVD 1020

Query: 1021 IGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYERVHDQ 1064
            IGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYERVHDQ
Sbjct: 1021 IGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYERVHDQ 1064

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score = 1582 bits (4096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 808/1064 (75%), Positives = 858/1064 (80%), Gaps = 5/1064 (0%)

Query: 1    MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRH 60
            MHPHTTLFTPEYS+ELLRRVQDLYHEDIKHYYPQ                     DSM H
Sbjct: 1    MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHH 60

Query: 61   NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
             RPNDALTAF+IGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE
Sbjct: 61   GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120

Query: 121  IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDA 180
            IGVVLDESVKH VGIEHRI KKRAFSVPANDLSGQVASLSL+ AGP  H  K   TE+D 
Sbjct: 121  IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM 180

Query: 181  EQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDGG 240
            +QSSPVWTAPNLEPNDQLKLALLPEVIPT  + E  RK++SP RPSVLLEDVP   +D  
Sbjct: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDND 240

Query: 241  ASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQ 300
            AS+ASLNP F +IT DRS+THRKDSYHS+YMVDSD LKEDND+ LNVE D FIQSLDILQ
Sbjct: 241  ASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQ 300

Query: 301  KQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTP 360
            KQSIITAPELFSILSN +EREK+LLIDLRIP+RS +NHIVAPNLVK+DPNLLWD+KTNTP
Sbjct: 301  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTP 360

Query: 361  VYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTS 420
            VYQDDILEHLL+ENE F NRDKF+Y+VYY+DVKTFM +NFDYVFIFFYLMLTSQKT LT+
Sbjct: 361  VYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTT 420

Query: 421  VPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPYXXXXXXXXXXXXXXXXXXXXXXXXX 480
            VPTALLGGYEKWKKTLH+YAQEY +S+EDYLYRPY                         
Sbjct: 421  VPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRPYSQKARAQQQQQQQQPNSQDSSSSKE 480

Query: 481  XXXXXXXXXXWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYSHDNSFSRKPP 540
                      W                                   MVY H+ S  RKPP
Sbjct: 481  TPTKVPEPPSWKPPDLPIRLRKRPPPPPPASMPTTPEIPPPLPPKIMVYPHEGSVPRKPP 540

Query: 541  IPAKQHVKKQQLNSNEIIXXXXXXXXXXXXXXXLLQPQPQRAYNIPTIEQSSNVYVSLSI 600
            IPAKQHVKK+Q NSNEII               LLQP P + Y+IPTIE++ NVYVSLSI
Sbjct: 541  IPAKQHVKKKQSNSNEIIQRKRQQQHYGQQ---LLQPLPPKDYSIPTIERNPNVYVSLSI 597

Query: 601  TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            TGLRNLGNTCYINSMIQCLFAAK FRTLFIS+NYKNYL+P   +R  HS KLSNSL+MLF
Sbjct: 598  TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657

Query: 661  NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            NKMYLNGGCSVVPTGFLKV+NQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND
Sbjct: 658  NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717

Query: 721  YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
            YPNLLLYNAD LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS
Sbjct: 718  YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777

Query: 781  TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCGPTXXXX 840
            TFYVLSLAIP RSMKLSKLGRSTEKRVKLEDCINMFT DEVLSGENAWDCPRCGPT    
Sbjct: 778  TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPTASFT 837

Query: 841  XXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINESNS-SNTVTFERER 899
                          I KSKKKKSRFFTLHTGSKRRHLD FGD+  E N+ +NT+ FERER
Sbjct: 838  ASASASALENESS-ILKSKKKKSRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERER 896

Query: 900  SRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKTINFVTLPKILVIHLSR 959
            SRSPFKMLG SGKRS+SSTPFA                +TTVKTINFVTLPKILVIHLSR
Sbjct: 897  SRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSR 956

Query: 960  FYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSV 1019
            FYYDLTKKN+TVITYPLILNIILKNN+TMKYRLFGVVNHTGTL+SGHYTSLVNKDLEHSV
Sbjct: 957  FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSV 1016

Query: 1020 DIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYERVHD 1063
            DIGRSKWYYFDDEVVKAD KHGSDKNLKISSSDVYVLFYERV+D
Sbjct: 1017 DIGRSKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERVYD 1060

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/537 (80%), Positives = 455/537 (84%), Gaps = 3/537 (0%)

Query: 527  MVYSHDNSFSRKPPIPAKQHVKKQQLNSNEIIXXXXXXXXXXXXXXXLLQPQPQRAYNIP 586
            MV+ HDN   R+PPIPA+QHVKKQQLNSNEII               L     QR Y+IP
Sbjct: 529  MVHPHDNFQLRQPPIPARQHVKKQQLNSNEIIQKKRQHQHQHYDQQLLQPQP-QRVYHIP 587

Query: 587  TIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRS 646
            TIEQSSN YVSLSITGLRNLGNTCYINSMIQCLFAAK+FRTLFIS+ YK+YLQ  +G+R 
Sbjct: 588  TIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNR- 646

Query: 647  AHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDR 706
             HS +LSNSLNMLF+KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDR
Sbjct: 647  LHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDR 706

Query: 707  LHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENS 766
            LHDELSNQ HVANDYPNLLLY+AD LKVSN EYKHWFDKNVIGNGISPIDDIFQGQMENS
Sbjct: 707  LHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENS 766

Query: 767  LQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGEN 826
            LQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGR  EKRVKLEDCINMFT DEVLSGEN
Sbjct: 767  LQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGEN 826

Query: 827  AWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINE 886
            AWDCPRCGPT                  I KS+KKKSRFFTLHT SKRRHLDFFGD+ NE
Sbjct: 827  AWDCPRCGPTASTSLSASASALENDSN-IVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNE 885

Query: 887  SNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKTINF 946
            S S+N V FERERSRSPFKMLG  GKRS+S+TPFA                LTTVKTINF
Sbjct: 886  STSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFANSSNDGNNFNDFKNKKLTTVKTINF 945

Query: 947  VTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGH 1006
            VTLPKILVIHLSRFYYDLTKKN+TVITYPLILNIILKNN+TMKYRLFGVVNHTGTL+SGH
Sbjct: 946  VTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGH 1005

Query: 1007 YTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYERVHD 1063
            YTSLVNKDLEH+VDIGRSKWYYFDDEVVKAD KHGSDK+LKISSSD YVLFYERVHD
Sbjct: 1006 YTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERVHD 1062

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/455 (80%), Positives = 393/455 (86%)

Query: 1   MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRH 60
           MHPHTT FTPEYSNELLRRV+DLYHEDIKHYYPQ                     DSMRH
Sbjct: 1   MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRH 60

Query: 61  NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
            RPNDALTAF+IGCYYVFLIIPQSLQFQTRNKSYSIY+DLKKMYENEMNMTNVVLMVKKE
Sbjct: 61  ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120

Query: 121 IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDA 180
           IGVVLD+SVKH VGIEHRITKKRAFSVP  DLS Q+ASLSL+ AGP GH  K S TEEDA
Sbjct: 121 IGVVLDDSVKHVVGIEHRITKKRAFSVPGIDLSDQLASLSLDAAGPRGHLHKTSSTEEDA 180

Query: 181 EQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDGG 240
           +QSSPVWTAPNLEPNDQLKLALLPEVIPTP +PESGRKTS+PVR SVLLEDVPY   D  
Sbjct: 181 DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDND 240

Query: 241 ASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQ 300
            +SAS +  FGEIT DRS+THRKDSYHS+YMVDSDT K DNDDLL+VETD FIQSL+ILQ
Sbjct: 241 GTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQ 300

Query: 301 KQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTP 360
           KQSIITAPELF+ILSN  E EK+LLIDLRIP+RS +N+IVAPNLVKIDPNLLWD+KTN P
Sbjct: 301 KQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKP 360

Query: 361 VYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTS 420
           VYQDDILE LLE NE FINRDKF+YVV Y+DVKTFM MNFDY FIFFYL+LTSQKT L +
Sbjct: 361 VYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLAT 420

Query: 421 VPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPY 455
           VPTALLGGYEKWKKTLHTYAQ+Y +SI+DYLYRPY
Sbjct: 421 VPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPY 455

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/540 (81%), Positives = 466/540 (86%), Gaps = 9/540 (1%)

Query: 527  MVYSHDNSFSRKPPIPAKQHVKKQQLNSNEIIXXXXXXXXXXXXXXXLLQPQPQRAYNIP 586
            MV+S  +S SRKPPIPAKQHVKK+QLNSNEII               L   QPQRAYNIP
Sbjct: 538  MVHSQVSSISRKPPIPAKQHVKKEQLNSNEIIQRKRQHQHQHYDQQIL---QPQRAYNIP 594

Query: 587  TIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRS 646
            TIE+S NVYVSLSITGLRNLGNTCYINSMIQCLFAAK FRTLFIS+ YK+YLQP + + S
Sbjct: 595  TIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSNGS 654

Query: 647  AHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDR 706
             +S KLSNSL+MLFNKMYLNGGCSVVPTGFLKV+NQLRPDLKIPDDQQDTQEFLMILLDR
Sbjct: 655  HYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDR 714

Query: 707  LHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENS 766
            LHDELS+QQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENS
Sbjct: 715  LHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENS 774

Query: 767  LQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGEN 826
            LQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFT DEVLSGEN
Sbjct: 775  LQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGEN 834

Query: 827  AWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINE 886
            AWDCPRCGPT                  I KSKKKKSRFFTLHTG+KRRHLDFFGD I E
Sbjct: 835  AWDCPRCGPTASVSTSVSALENEPS---IVKSKKKKSRFFTLHTGTKRRHLDFFGDGITE 891

Query: 887  ---SNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKT 943
               SN++NT  FERERSRSPF+MLG SGKRS+SSTPF+                LTTVKT
Sbjct: 892  GHNSNNNNTTIFERERSRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSSDYKNKKLTTVKT 951

Query: 944  INFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLV 1003
            INFVTLPKILVIHLSRFYYDLTKKN+TV+TYPLILNIILKNN+TMKY+LFGVVNHTGTL+
Sbjct: 952  INFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTGTLI 1011

Query: 1004 SGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYERVHD 1063
            SGHYTSLVNKDLEH+V+IGRSKWYYFDDEVVKAD KHGSDKNLKISSSDVYVLFYERV+D
Sbjct: 1012 SGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERVYD 1071

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/455 (80%), Positives = 394/455 (86%)

Query: 1   MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRH 60
           MHPH T FTPEYSNELLRRVQDLYHEDIKHYYPQ                     DS+ H
Sbjct: 10  MHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHH 69

Query: 61  NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
           +RPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE
Sbjct: 70  DRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 129

Query: 121 IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDA 180
           IGVVLDESVKH  GIEHRITKKRAFSVPA+DLSGQVASLSL+ A P  HG K +FTE+DA
Sbjct: 130 IGVVLDESVKHGAGIEHRITKKRAFSVPADDLSGQVASLSLDTAAPQDHGLKGTFTEDDA 189

Query: 181 EQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDGG 240
           EQSSPVWTAPNLEPNDQLKLALLPEVIPTP + E  RKTS PVRPSVLLEDVP   ++  
Sbjct: 190 EQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFREPERKTSVPVRPSVLLEDVPSIYHEDD 249

Query: 241 ASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQ 300
            S ASLNP F EIT DRS+THRKDSYHS+YMVDS  LKEDNDDL NVE D FIQSLDILQ
Sbjct: 250 TSFASLNPPFREITADRSVTHRKDSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQ 309

Query: 301 KQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTP 360
           KQSIITAPELFSILSN +EREK+LLIDLRIP+RS INHIVAPNLV +DPNLLWD++TNTP
Sbjct: 310 KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTP 369

Query: 361 VYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTS 420
           +Y+DDILEHLL+ENE FINR+KF+Y+VYYTDVKTFM +NFDY FIFFYLMLTSQKT LT+
Sbjct: 370 IYKDDILEHLLKENENFINRNKFDYIVYYTDVKTFMTINFDYAFIFFYLMLTSQKTPLTT 429

Query: 421 VPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPY 455
           VPT LLGGYEKWKKTLH+YAQEY +SIEDYLYRPY
Sbjct: 430 VPTTLLGGYEKWKKTLHSYAQEYHISIEDYLYRPY 464

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/496 (58%), Positives = 350/496 (70%), Gaps = 61/496 (12%)

Query: 581  RAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP 640
            R ++IPTIE+S N+YVSLSITGLRNLGNTCYINSM+QCLFA ++FR LFIS+ +++++  
Sbjct: 658  RKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN- 716

Query: 641  PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFL 700
               S+  ++ K+SNS N+LF KMYLNGGCSVVPT FLK  N LRPDL+IPDDQQDTQEFL
Sbjct: 717  --DSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFL 774

Query: 701  MILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760
            MI+LDRLHDELSNQQ V N+YPNLLLY+ + LKV N EYKHWFDKNVIGNG+SPID IF 
Sbjct: 775  MIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFS 834

Query: 761  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
            GQMENSLQC+RCG +++NYSTFYVLSLAIP+ S   +   RS  KRVKLE+CINMFT DE
Sbjct: 835  GQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSS--TTFSRS--KRVKLEECINMFTSDE 890

Query: 821  VLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKK-----------KSRFFTLH 869
            VLSGENAWDCP+CG +                  +  SKKK           KS+FFTLH
Sbjct: 891  VLSGENAWDCPKCGSSASSTISDSEKLLN-----VTSSKKKNMSSHNEHHRYKSKFFTLH 945

Query: 870  TGSKRRHLDFFGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXX 929
            T S                          RS SPF+      K S ++ P +        
Sbjct: 946  TRS-------------------------HRSISPFR-----KKTSPAAVPSSTKNEPWKS 975

Query: 930  XXXXXXXXLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMK 989
                    L T+KT+NF+ LP ILVIHLSRFYYDLTKKN+TVITYPLILNI+LKNNE  K
Sbjct: 976  KK------LITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAK 1029

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKN-LK 1047
            YRL+G+VNH+G L+SGHYTSLVNK+  H +   + +WYYFDDE VK +  HG  DK  L+
Sbjct: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQ 1089

Query: 1048 ISSSDVYVLFYERVHD 1063
            +SS DVYVLFYER+++
Sbjct: 1090 VSSRDVYVLFYERIYE 1105

 Score =  223 bits (568), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 115/207 (55%), Positives = 152/207 (73%), Gaps = 13/207 (6%)

Query: 256 DRSITHRKDSYHSIYMVD---SDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFS 312
           DR+  HRKDSYHSIYMVD   +D + +  D      ++ +I SL+ LQKQ IITA ELFS
Sbjct: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYD------SNPYIHSLERLQKQCIITAQELFS 384

Query: 313 ILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLE 372
           ILSN IE+ K+LLIDLR P+R   NHIVAPNL+ IDP LLW+ KTNTP+Y    LE+LL 
Sbjct: 385 ILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLY 444

Query: 373 E---NEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKT-HLTSVPTALLGG 428
           E    ++  NR +FEY+V+YTD KT+M  NFDY F FFYL++TS+   ++ S PT LLGG
Sbjct: 445 EPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGG 504

Query: 429 YEKWKKTLHTYAQEYDVSIEDYLYRPY 455
           Y+KWKK L++Y+++Y+ ++ DYLY+P+
Sbjct: 505 YDKWKKVLYSYSEQYNFNMGDYLYKPH 531

 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/225 (46%), Positives = 135/225 (60%), Gaps = 31/225 (13%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXX-XDSMRHNRPNDA 66
           FTPEYSNELL++VQ +YH+DIKHYYPQ                       +  +    D 
Sbjct: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDV 68

Query: 67  LTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAFI+GCYY+FLIIPQS+QFQ++NKSY IYT+LKK+YENE +MTNV+LMVK EI  VLD
Sbjct: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128

Query: 127 -ESVKHAVGIEHRITKK-RAFSVPANDLSGQVASLSLENA----------------GPHG 168
            +   +   + HRI K+ RA+S+  N+LS QV SLS+ N+                 P  
Sbjct: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188

Query: 169 HGF-------KASFTEE-----DAEQSSPVWTAPNLEPNDQLKLA 201
           H            F+ E     D +++SP+WTAP+LEP DQLKLA
Sbjct: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  555 bits (1431), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 281/485 (57%), Positives = 344/485 (70%), Gaps = 50/485 (10%)

Query: 580  QRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ 639
            QR Y+IPTIE+SSN YVSLSITGLRNLGNTCYINSM+QCLFA   FR LF+S  ++ +  
Sbjct: 587  QRHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEFFN 646

Query: 640  PPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEF 699
                +R     +LS S N+LF KMY+NGGCSVVPT FLKV++ LRPDL+IPDDQQDTQEF
Sbjct: 647  QNYSNRP----QLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEF 702

Query: 700  LMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIF 759
            LM+ LDRLHDELSNQ  VAN+YP+LLLY+   + V+  EYK WF+++VIGNG++PID IF
Sbjct: 703  LMVTLDRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIF 762

Query: 760  QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDD 819
            QGQ+EN L+C+RCG ++F+YSTFYVLSLAIP+ S   S   R+  KRVKLEDCINMFT+D
Sbjct: 763  QGQIENILECQRCGNSSFSYSTFYVLSLAIPKPST--STFSRA--KRVKLEDCINMFTND 818

Query: 820  EVLSGENAWDCPRCGPTXXXXX-XXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLD 878
            E+LSGENAWDCP+CG                     + + ++ KS FF +H+ SK     
Sbjct: 819  EILSGENAWDCPKCGSAVTDMGPNHLKKSKKKKKSELGEERRSKSGFFRIHSKSK----- 873

Query: 879  FFGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXL 938
                                RS+SPF+MLGS      +  P A                L
Sbjct: 874  --------------------RSKSPFRMLGS------TKFPLA--------MEDWKSKEL 899

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNH 998
            +T KT+NF+ LP +L+IHLSRFYYDLTKKN T++TYPL+LNIILKNNET +YRL+ VVNH
Sbjct: 900  STKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNIILKNNETARYRLYAVVNH 959

Query: 999  TGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKN-LKISSSDVYVL 1056
            TG L+SGHYTSLVNK+  H +D GR KWYYFDDEVVK + KHG+ D+  LK+SSSDVYVL
Sbjct: 960  TGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKHGNIDQGILKVSSSDVYVL 1019

Query: 1057 FYERV 1061
            FYER+
Sbjct: 1020 FYERL 1024

 Score =  392 bits (1006), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/478 (44%), Positives = 295/478 (61%), Gaps = 36/478 (7%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           FTPEYSNELLR VQ+LY +DIKHY+ Q                       +      DAL
Sbjct: 8   FTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDAL 67

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           TAFIIGCYY++LI+PQS++FQTRNKSYSI+ DL KMY+N+ NMTNV+LMVK E+  +LD 
Sbjct: 68  TAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSILDR 127

Query: 128 SVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGP-----HGHGFKASFTEEDA-- 180
           + +     EH+  + RA+SVP  +   ++ +L++ N  P     H    K+    ED   
Sbjct: 128 NAREFKEFEHQKARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQGREDMNN 187

Query: 181 ----EQSSPVWTAPNLEPNDQLKLAL-----------LPEVIPTPIYPESGRKTSSPVRP 225
               E SSPVWTAP LEPNDQL++AL           L + + T     S  + +   R 
Sbjct: 188 LQNDEDSSPVWTAPPLEPNDQLRIALDATPLSPSIMALDQPMATKELAISTSRKALSRRA 247

Query: 226 SVL------LEDVPYNCYDGGASSASL--NPSFGEITVDRSITHRKDSYHSIYMVDSDTL 277
           S +      +E++  +  DG +    L  N +     VDR  THRKDSYHS+YM +  + 
Sbjct: 248 SAMGPTPYPIEELDISGQDGNSHYDELGFNKTLWNANVDRQTTHRKDSYHSVYMFEGGS- 306

Query: 278 KEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEIN 337
               DD +   + +F Q L+ LQKQSIITAPELF+ILS+S E EK+LLID R+ +RS++N
Sbjct: 307 ----DDHMPSISKDFTQGLERLQKQSIITAPELFTILSSSEESEKLLLIDFRLSKRSKVN 362

Query: 338 HIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMY 397
           HI+AP  V+IDP  LWD KTNTP+     L+ ++++   F+ R  ++Y+VYYTD+KT+M 
Sbjct: 363 HIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKK-PAFLERGSYDYIVYYTDMKTYMT 421

Query: 398 MNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPY 455
           +++DY+F  FYL+  S   +L S+PT LLGGYEKWKK +  Y+ ++ V++++Y+YRPY
Sbjct: 422 IDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDHGVNMDNYIYRPY 479

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  550 bits (1417), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 286/485 (58%), Positives = 343/485 (70%), Gaps = 44/485 (9%)

Query: 581  RAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP 640
            R  +IPTIE+S N+YVSLSITGLRNLGNTCYINSM+QCLFA + FR LF+++ Y ++L  
Sbjct: 588  RRPSIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLN- 646

Query: 641  PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFL 700
              GS+  +S  +SNS N+LF KMYLNGGCSVVPT FLK  N LRPDLKIPDDQQDTQEFL
Sbjct: 647  --GSKFPNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFL 704

Query: 701  MILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760
            MI+LDRLHDELSNQQ V N+YP+L+LY+ + L+V + EYKHWF+K+VIGNG+SPID+IFQ
Sbjct: 705  MIILDRLHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQ 764

Query: 761  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
            GQ+EN LQC+RCG+++FNYSTFYVLSLAIP    K S  G S  KRVKLEDCINMFT+DE
Sbjct: 765  GQIENGLQCQRCGHSSFNYSTFYVLSLAIP----KPSPTGFSRSKRVKLEDCINMFTNDE 820

Query: 821  VLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFF 880
            +LSGENAWDCP CG                      +  + KSRFF L T   R H    
Sbjct: 821  MLSGENAWDCPNCGSNAQDRVRVNTDQSVKKKRQ-GEEHRHKSRFFGLPT---RPH---- 872

Query: 881  GDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTT 940
                              RS SPF+  GSS   S S                     L T
Sbjct: 873  ------------------RSLSPFRKSGSSSTNSTSKI---------KHEQQWKTKKLIT 905

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTG 1000
            +KT+NF+ LP +LVIHLSRF+YDLTKKN TVITYPLILNI+LKNNE  KY+L+G+VNHTG
Sbjct: 906  IKTLNFIMLPPVLVIHLSRFFYDLTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVNHTG 965

Query: 1001 TLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKN--LKISSSDVYVLFY 1058
             L+SGHYTSLVNK+  H+++  + +WYYFDDEVVKA+  HG   N   K+SS DVYVLFY
Sbjct: 966  NLISGHYTSLVNKEPGHNLNHNQQRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYVLFY 1025

Query: 1059 ERVHD 1063
            ER+++
Sbjct: 1026 ERLYE 1030

 Score =  414 bits (1065), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 237/492 (48%), Positives = 309/492 (62%), Gaps = 56/492 (11%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           FTPEYSNELLRR+Q +Y EDIKHYYPQ                              DAL
Sbjct: 10  FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           T+FI+GCYY+FLI+PQS+QFQ+RNKSY IY+DLKK+YEN+ +MTNV+LMVK EI  +L++
Sbjct: 70  TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEK 129

Query: 128 SVKHAVG-IEHRITKKRAFSVP-ANDLSGQVASLSLEN----AGPHGHGFKASFTEEDA- 180
           + +  +    +RI ++RA+SVP +NDL+ Q+ SLS+ +    + P       SF   D+ 
Sbjct: 130 TAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSVSDRNLKSPPRKILMNNSFEHSDSD 189

Query: 181 ------EQSSPVWTAPNLEPNDQLKLALLP-EVIPTPIYP-------------------- 213
                 + SSP+WTAP LEP DQLKLA+L  E +P P+ P                    
Sbjct: 190 VINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLPPPVIPYEADIQERTDLLKQPSIPEL 249

Query: 214 -------ESGRKTSSPVRPSVLLE-DVPYNCYDGGASSASLNPSFGEITVDRSITHRKDS 265
                  ++ +  +SP +  + L+ D+P           S N SF E   DRS THRKDS
Sbjct: 250 SPTTTSLKNSKDFNSPFQSVISLDNDIPL------VREPSNNRSFRETNADRSQTHRKDS 303

Query: 266 YHSIYMVDSDTLKEDNDDLLN--VETDEFIQSLDILQKQSIITAPELFSILSNSIEREKI 323
           YHS+YM+D     E++ D LN   ++ ++IQ L  LQKQSIITA EL SILS   ER K+
Sbjct: 304 YHSVYMID-----EESTDKLNQFYDSTDYIQDLQRLQKQSIITAQELLSILSCPPERIKL 358

Query: 324 LLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKF 383
           LLIDLR  +R+ +NHIVAPN+V IDP+LLWD  T+TP+Y  + LE LL +NE+F  R +F
Sbjct: 359 LLIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLL-DNELFNRRHEF 417

Query: 384 EYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEY 443
           EYVVYYTD+KT+M+ +FDY F  FYL+ T     L S PT LLGGY+KWK  LH YA+EY
Sbjct: 418 EYVVYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDKWKVFLHHYAKEY 477

Query: 444 DVSIEDYLYRPY 455
           D++I DYLYRPY
Sbjct: 478 DINIPDYLYRPY 489

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1161

 Score =  532 bits (1370), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 276/505 (54%), Positives = 343/505 (67%), Gaps = 40/505 (7%)

Query: 582  AYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ-- 639
             Y+IPTIEQ+ N+YVSLSITGLRNLGNTCYINSMIQCLFA K FR LFIS  YK +L+  
Sbjct: 672  TYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEV 731

Query: 640  PPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEF 699
             PK   +     +S +  +LF KMYLNGGCSVVP  FLK  + LRPD KIPDDQQDT EF
Sbjct: 732  APKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEF 791

Query: 700  LMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIF 759
            LM++LDRLHDELSNQ  V N+YP+L+LY+   L V N EYK WFDK+VIGNG+SPIDDIF
Sbjct: 792  LMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIF 851

Query: 760  QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDD 819
            QGQMENSL C+RCG+++FNYSTFYVLSLAIP+ +   S   RS  KRV LE+C+NM+T D
Sbjct: 852  QGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATS--STFSRS--KRVSLEECLNMYTSD 907

Query: 820  EVLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTL---HTGSKRRH 876
            EVLSGENAWDCP C                     + K+K+ K+   TL    + S  + 
Sbjct: 908  EVLSGENAWDCPNCCKITKDYKGM-----------VEKTKRNKAARDTLSPGSSSSSSKK 956

Query: 877  LDFFGDNINESNSSNTVTFER-----ERSRSPFKMLGSSGKRS-------------NSST 918
               F  +++  +   +   E       RS SPF++LG S  +S             ++  
Sbjct: 957  GKLFSFSLHHRHHHRSELGELNVSKINRSLSPFRVLGGSSSKSVRKSEDSHSRADVDAQR 1016

Query: 919  PFAXXXXXXXXXXXXXXXXLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLIL 978
                               L T+KT+NF+ +P+ L+IHLSRFYYDLTKKNST++TYPLIL
Sbjct: 1017 DIDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLIL 1076

Query: 979  NIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
            NI+LK+NE +KY+L+GVVNHTG L+SGHYTS+V+K L+HS++     WYYFDDEVVK + 
Sbjct: 1077 NIVLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRET 1136

Query: 1039 KHGSDKN--LKISSSDVYVLFYERV 1061
            +HG  K+  +KISSSDVYVLFYER+
Sbjct: 1137 RHGDVKHGVMKISSSDVYVLFYERI 1161

 Score =  214 bits (546), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 150/215 (69%), Gaps = 7/215 (3%)

Query: 239 GGASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDI 298
           GGA     + SF + T DRS+THRK+SYHS+YM++     + N  L   E++ +IQSL+ 
Sbjct: 338 GGAH----DRSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGN--LYYDESNAYIQSLER 391

Query: 299 LQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTN 358
           LQKQSIITAPELFSILSN  + +++LLIDLR+  R   + I+APN V IDP +LW+  + 
Sbjct: 392 LQKQSIITAPELFSILSNEQQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSG 451

Query: 359 TPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHL 418
            P+Y+   LE  L  N +F  RD+F+YVVY++D+KTFM +NFDY F FFYL+ T++   L
Sbjct: 452 APMYEITELESKLN-NPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPL 510

Query: 419 TSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYR 453
             VPT LLGGYEKWKK +  Y ++Y++ + DYL R
Sbjct: 511 KCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLVR 545

 Score =  135 bits (341), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 124/231 (53%), Gaps = 39/231 (16%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           FTPE S+EL +RV  +Y +DI    PQ                       +  ++  DAL
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
            +FI GC+YV+L++PQS+QF TRN+++++Y+D++ +YE+++NMTNV+LMVK+E+ VVL E
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL-E 132

Query: 128 SVKHAVGIEHRITKKRAFSVPANDLSGQ-VASLSLEN----------------------- 163
           S   +  +  RI + RA+SVP      Q +  L+L++                       
Sbjct: 133 SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192

Query: 164 -------------AGPHGHGFKASFTEEDAEQSSPVWTAPNLEPNDQLKLA 201
                         G   HG  + +++ D +QSSP+W AP LEPNDQLKLA
Sbjct: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLD-DQSSPLWRAPQLEPNDQLKLA 242

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  528 bits (1360), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 276/490 (56%), Positives = 337/490 (68%), Gaps = 44/490 (8%)

Query: 577  PQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKN 636
            P   +  ++PTIEQSSNVYVSLSITGLRNLG+TCYINSM+QCLFA + FR +F+S  Y +
Sbjct: 589  PISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHD 648

Query: 637  YLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDT 696
            Y+   KG    H +++S S +MLF KMY+NGGCSVVP+GFLK  N +RPD KIP+DQQDT
Sbjct: 649  YIS--KGY--IHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDT 704

Query: 697  QEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPID 756
            QEFL+ LLD+LHDELS+ + VANDYP LLL++ D L+V   EY  WF+ ++  NG+SPID
Sbjct: 705  QEFLLFLLDQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPID 764

Query: 757  DIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMF 816
             IFQGQMEN LQC+RCG++++NYSTFYVLSLAIP  +   S  G++  K+V LEDCIN+F
Sbjct: 765  SIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIP--TPGTSTFGKT--KKVLLEDCINLF 820

Query: 817  TDDEVLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTG-SKRR 875
            T DEVLSGENAWDCPRCG +                 P     KKK +F   H   +  R
Sbjct: 821  TSDEVLSGENAWDCPRCGTS------------MSGSGPGEGKAKKKRKFLLPHDHVNNNR 868

Query: 876  HLDFFGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXX 935
               FF       + S++         S   M GS   +S                     
Sbjct: 869  TSRFFKFRSKSRSRSSSPFNSSNGHNSGSSMPGSEKWKSKK------------------- 909

Query: 936  XXLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGV 995
              LTT+KT NF+T+P ILVIHLSRF+YDLTKKNSTVITYPLILNI+LKNNE  KYRL+G+
Sbjct: 910  --LTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGI 967

Query: 996  VNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDV 1053
            VNH G L+SGHYTSLVNKDL+H +  G+ KWYYFDDEVVK DN HG  D  +  +SSSDV
Sbjct: 968  VNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDV 1027

Query: 1054 YVLFYERVHD 1063
            YVLFYER++D
Sbjct: 1028 YVLFYERIYD 1037

 Score =  330 bits (846), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 203/488 (41%), Positives = 268/488 (54%), Gaps = 54/488 (11%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           +TPEYSNELL+ VQD+Y +DIKHYYP+                       ++     DAL
Sbjct: 5   YTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDAL 64

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           TAFIIG +YV+LIIPQS+QF TRNKSY IY DL+K Y++E +MTNV+LMV K++  +L +
Sbjct: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124

Query: 128 SVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEED-----AEQ 182
           S       + +IT+KRA+SVP+  L+ Q+ SL+L N        + S  E D     A+ 
Sbjct: 125 SRDFD---DTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVS-KESDTLTNYADD 180

Query: 183 SSPVWTAPNLEPNDQLKLALLPEVIPTPIYPES--------------GRKTSSPVRPSVL 228
            + +W+AP LEP+DQLKLAL P    +                    G  +S    P   
Sbjct: 181 YTTIWSAPKLEPDDQLKLALNPPSKSSSATSSLSSFVMDQHSKKFSIGESSSDEFEPIPT 240

Query: 229 LEDVPYN------------------CYDGGASSASLNPSFGEI---TVDRSITHRKDSYH 267
            E +P +                    D G S      S   I    VDR  THRKDSYH
Sbjct: 241 QEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYH 300

Query: 268 SIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLID 327
           S+YM     L ED+D        +F Q+L  LQKQ +I+  EL  IL  S ER  +LL+D
Sbjct: 301 SVYM-----LNEDDD----TNEYDFFQNLSRLQKQYVISCEELMDIL-QSDERNNVLLVD 350

Query: 328 LRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVV 387
           LRI +R   NHIVAPNL+ IDP  LWD     P+  D  LE  +   + F +R KF+Y+V
Sbjct: 351 LRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIV 410

Query: 388 YYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSI 447
           YYTD+KTF+ ++FDY  +FF L+  S  T L S P ALLG YE+WK  +  YA+ +D+  
Sbjct: 411 YYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVT 470

Query: 448 EDYLYRPY 455
            DYL+RPY
Sbjct: 471 GDYLFRPY 478

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  525 bits (1351), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 264/485 (54%), Positives = 327/485 (67%), Gaps = 36/485 (7%)

Query: 581  RAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP 640
            R ++IPTIE++SN YV+ S+TGLRNLGNTCYIN M+Q LFA    + LFIS  Y+ Y   
Sbjct: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMK 687

Query: 641  PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFL 700
            P  ++    S +SN+   LFNKMY+NGGC+VVP+GFLK+ N LRPDL+IPDDQQDTQEFL
Sbjct: 688  PNDNKE---SAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFL 744

Query: 701  MILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760
            + +L+RLHDELSNQ +V NDYPNLLLY+ D + V   +YK WFDK V+ NG+SP+D +FQ
Sbjct: 745  LFILNRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQ 804

Query: 761  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSM-KLSKLGRSTEKRVKLEDCINMFTDD 819
            GQMEN+LQC+RCGY + NYSTFYVLSLA+P+ S     K G     RVKLEDCINMFT D
Sbjct: 805  GQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSG-----RVKLEDCINMFTSD 859

Query: 820  EVLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDF 879
            EVL+GENAWDCP+CG +                 P +    KKS+FF L TG        
Sbjct: 860  EVLTGENAWDCPKCG-SKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKA------ 912

Query: 880  FGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXX-XXXXXXXL 938
                               RS+SPF+ LG   K                          L
Sbjct: 913  -----------------ISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKL 955

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNH 998
             T+KTINF++LPK+L+IHLSRFYYDLTKKN  V++YPL+LNI+LKN E ++Y+L+ +VNH
Sbjct: 956  VTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNH 1015

Query: 999  TGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVL 1056
            TG L+SGHYTSLVNKD  H++     KWYYFDDEVVKA+  HG+ DK + K+SS +VYVL
Sbjct: 1016 TGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVL 1075

Query: 1057 FYERV 1061
            FYERV
Sbjct: 1076 FYERV 1080

 Score =  282 bits (722), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 147/278 (52%), Positives = 190/278 (68%), Gaps = 18/278 (6%)

Query: 180 AEQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDG 239
            E  SP+WTAP+L+PNDQLKLAL  E++  P+    G           L +D+ Y     
Sbjct: 274 VEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDG---------DTLGDDIYYETVSK 324

Query: 240 GASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNV--ETDEFIQSLD 297
           G   +     F ++  +R ITHRKDSYHSIYM+D     +DN++  N    ++ FIQ L+
Sbjct: 325 GDDVSYRGKDFEDLHANRLITHRKDSYHSIYMID-----DDNNNSKNYFDGSNAFIQGLE 379

Query: 298 ILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKT 357
            LQKQSIITAPELFSILSN  ER K+LLIDLR+ +RS  NHIVAPN+V IDP  LWD + 
Sbjct: 380 RLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEA 439

Query: 358 NTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTH 417
           N+P+Y+D ILE  L  N +F  R K++Y+VYY+D+KT+M   +DY FI FYL+ TS K H
Sbjct: 440 NSPIYKDTILEQRL-NNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGK-H 497

Query: 418 LTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPY 455
           L+SVPTALLGGYEKWKK ++TY  +Y + ++DYLYRPY
Sbjct: 498 LSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPY 535

 Score = 98.2 bits (243), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 78/120 (65%), Gaps = 1/120 (0%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           FTPE+S +LL ++Q +Y ++I+  +PQ                       +  +  + A+
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDT-SKAV 62

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
             FI GC+Y++L++P+S+QFQTR+KSYS+YT+L+ +YE+++NMTNV+ MVK+E+  + ++
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  510 bits (1313), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 263/482 (54%), Positives = 325/482 (67%), Gaps = 43/482 (8%)

Query: 583  YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642
            ++IPTIE+S N +VSLSITGLRN+GNTCYINSM+QCLF    FR LF+   Y  YL P +
Sbjct: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629

Query: 643  GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702
             +     + +S   ++LF KMYLNGGCSVVP GFLK  + LRPD  IP DQQDTQEFL+ 
Sbjct: 630  SN-----TIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLF 684

Query: 703  LLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 762
            LLD LHDELS    VANDYPNLLL++ + L V N EY  WFD+ +  NG+SPIDDIFQGQ
Sbjct: 685  LLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQ 744

Query: 763  MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVL 822
            MENSL+C+RCG+T++NYSTFYVLSLAIP  +M   K    ++K ++LEDCIN++T DE+L
Sbjct: 745  MENSLKCQRCGFTSYNYSTFYVLSLAIP--AMPPPKTFSRSKKIIRLEDCINLYTQDELL 802

Query: 823  SGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGD 882
            +GENAWDCP+CG                        KKKK  F +++   K R   FF  
Sbjct: 803  TGENAWDCPKCGTHSNSSDGSMNSDETV-------DKKKKKNFLSVNGDHKSRS-KFF-- 852

Query: 883  NINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVK 942
             ++ S S        +RS SPFK        SNS  P                  +TT+K
Sbjct: 853  KLSSSRSG-------KRSLSPFK--------SNSVKP---------EKLHIKSKKMTTIK 888

Query: 943  TINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTL 1002
            T+NF+T+P ILVIHLSRF+YDLTKKN T+I YPLIL+++LKNNE  +YRL+G++NH G L
Sbjct: 889  TLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNL 948

Query: 1003 VSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVLFYER 1060
            VSGHYTSLVNK L H +  G+ KWYYFDDEVVK +  HG  D+ +  ISS DVYVLFYER
Sbjct: 949  VSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYER 1008

Query: 1061 VH 1062
            +H
Sbjct: 1009 IH 1010

 Score =  255 bits (652), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 170/485 (35%), Positives = 261/485 (53%), Gaps = 60/485 (12%)

Query: 5   TTLFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPN 64
           + L+TPEYS+ELL  VQ++Y +D+KHYY +                     +S+   +  
Sbjct: 2   SRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYE 61

Query: 65  DALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 124
           D L  ++IG +YVFLIIP S+QF  RNKSYSIY+DLKK+Y++E+NM+NV+LMV  ++  V
Sbjct: 62  DCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSV 121

Query: 125 LDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDAEQSS 184
           L+++++         ++KRAFSV    +  Q+ +L L NA       + S  ++    +S
Sbjct: 122 LNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNAD------QKSVDDDYKSFAS 175

Query: 185 PVWTAPNLEPNDQLKLALLPE-----------VIPTPIYPE----------SGRKTSSPV 223
             W AP L+PND+L LA+               +   +Y E          S +   S  
Sbjct: 176 TEWKAPQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDALDSVSDKLLGSIH 235

Query: 224 RPSVL-----LEDVP----------YNCYDGGASSASLNPSFGEITVDRSITHRKDSYHS 268
           +P +L     +  VP          +  Y    SS  L       + DRS THRKDSYHS
Sbjct: 236 KPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLE---NMDSFDRSRTHRKDSYHS 292

Query: 269 IYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDL 328
           +Y+ D      + +DL N+ T      L   Q+++ I    LFS+L ++  RE +LLIDL
Sbjct: 293 VYLGD------ELEDLNNIST-----GLARHQQENTIDCFALFSLLKDAESRENLLLIDL 341

Query: 329 RIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVY 388
           R+P+R E NH+VAPNL+ IDP LL+D +  T +   + L+ ++  N I     +++ +VY
Sbjct: 342 RLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIV-ANPILDKISQYDNIVY 400

Query: 389 YTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIE 448
           YTD K+FM++ F+Y  I F L+    K   T++P +LLGGYE+WK  L+   ++ +    
Sbjct: 401 YTDYKSFMHLTFNYELILFELLF---KKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKS 457

Query: 449 DYLYR 453
            +L+R
Sbjct: 458 LFLFR 462

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  503 bits (1296), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 268/531 (50%), Positives = 334/531 (62%), Gaps = 51/531 (9%)

Query: 534  SFSRKP-PIPAKQHVKKQQLNSNEIIXXXXXXXXXXXXXXXLLQPQPQRAYNIPTIEQSS 592
            S++R P P+PAK+ V +  L+S                   L          IPTIEQSS
Sbjct: 488  SYTRAPFPLPAKEMVIQSSLDSISRTQIPSHLESHYTHEKVLQNKMHHAEGTIPTIEQSS 547

Query: 593  NVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKL 652
            N YV+LSITGLRN+GNTCYINSM+QCLFA + FR LF+S  Y++Y       R ++  +L
Sbjct: 548  NEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYF----SKRYSNPHQL 603

Query: 653  SNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
            S   N+LF KMY+NGGCSVVPTGFLK  N LRPDLKIP +QQDTQEFL+ LL +LHDELS
Sbjct: 604  SKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDELS 663

Query: 713  NQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
               HVANDYPNLLL++ ++L V   EY  WF+ N+  NGISPID IFQGQMEN L C+RC
Sbjct: 664  ESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQMENGLLCQRC 723

Query: 773  GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPR 832
            G++++NYS FYVLSLAIP     +S  G+  +K+++LEDCIN+FT DE L+ ENAWDCP+
Sbjct: 724  GHSSYNYSMFYVLSLAIP---ASMSSFGQ--KKKMRLEDCINLFTSDEKLTNENAWDCPK 778

Query: 833  CGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINESNSSNT 892
            CG                         KKK +F +    S  R    F    ++S S + 
Sbjct: 779  CGSAVSGNG--------------PDGDKKKRKFLSTSDNSNGRSRSRFFKLRSKSRSRSV 824

Query: 893  VTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKTINFVTLPKI 952
              F +  S+SP      S K                         L+T+KT+NFV+LP +
Sbjct: 825  SPFHKPSSQSPASEKWKSKK-------------------------LSTIKTLNFVSLPSV 859

Query: 953  LVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVN 1012
            L IHLSRF YDLT KN+ VITYPL L+I+LKNNE + YRL+ + NH G L+SGHYTSLVN
Sbjct: 860  LTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVNYRLYAIANHFGNLISGHYTSLVN 919

Query: 1013 KDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVLFYERV 1061
            KDL H +  GR KWYYFDDEV K D  HG+ D  +  +SSSDVYVLFYE++
Sbjct: 920  KDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGITSVSSSDVYVLFYEKI 970

 Score =  282 bits (721), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 182/487 (37%), Positives = 257/487 (52%), Gaps = 85/487 (17%)

Query: 7   LFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDA 66
           L++PEYSNELL+ V+++Y +DI HYYP+                      S+   + ++ 
Sbjct: 4   LYSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSEL 63

Query: 67  LTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAF++GC+Y++LIIP S+QF +R+KSY+IY DL+K Y++E NMTNV+LMV    GV+  
Sbjct: 64  LTAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMV---TGVI-- 118

Query: 127 ESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLE-------NAGPHGHGFKASFTEED 179
           ESV        +I +KRA+SVP   LS ++ +L+L        NAGP          E D
Sbjct: 119 ESVSRDELESAKIMRKRAYSVPHKKLSDKMQALTLSPETASSTNAGP----------ETD 168

Query: 180 AEQSSPVWTAPNLEPNDQLKLAL------------------------------LPEVIPT 209
            E  S +WTAP LEPND LK+ L                              +   + +
Sbjct: 169 NENDSTMWTAPELEPNDHLKVNLGGHNSSVSSRSSNEQAFKVGNEGNSSSSDDIEMAVHS 228

Query: 210 PIYPESGRKTSSPVRPSVLLEDVPYNCYDGGASSASLNPSFGEI---TVDRSITHRKDSY 266
               +  R++S P++      + P N         SL  +  +I    VDR  THRK SY
Sbjct: 229 TTQDQRPRRSSVPIKV-----EAPQN---------SLQSTVDDIYCQKVDRYNTHRKGSY 274

Query: 267 HSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLI 326
           HS++M                E D F  +   LQKQSIIT  +L  IL +S E E++LL+
Sbjct: 275 HSVHMTGD-------------EYDSFTFNTARLQKQSIITCDKLLRIL-DSEEAERLLLV 320

Query: 327 DLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYV 386
           DLR  +R E NHIVAPNLV +DP  LWD      +  D  LE +L +N    +  +F+++
Sbjct: 321 DLRFIKRFETNHIVAPNLVNLDPMNLWDFAKGRAIEGDAPLE-VLNKNHALKDLSQFKHI 379

Query: 387 VYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVS 446
           VYYTD+KTFM ++FDY  +FF ++ TS    ++  P  LLGGYE+WKK L    Q     
Sbjct: 380 VYYTDMKTFMRLDFDYQLVFFQMLYTSN-WRISCTPKVLLGGYEQWKKFLAKVPQSRVPI 438

Query: 447 IEDYLYR 453
            E +L+R
Sbjct: 439 KEAFLFR 445

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  477 bits (1228), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 241/451 (53%), Positives = 301/451 (66%), Gaps = 50/451 (11%)

Query: 615  MIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPT 674
            M+QCLF  K+ R LFIS+ Y+ YL      R   SS LS S ++LF KMYLNGGCSVVPT
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYL----SKRIDRSSNLSRSFSILFKKMYLNGGCSVVPT 56

Query: 675  GFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKV 734
             FLK  NQLRPDL+IPDDQQDTQEFLM++LDRLHDELSNQ+ V  DYP+L+LY+   L+V
Sbjct: 57   SFLKTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRV 116

Query: 735  SNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSM 794
            +N EY  WFDK +  NG+SPID IFQGQ+EN+L C+RCG+ ++NYSTFYVLSLAIP+ S 
Sbjct: 117  NNKEYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSS 176

Query: 795  KLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXP 854
                  RS  KRVKLEDCINMFT+DEVLSGENAWDC  CG +                  
Sbjct: 177  --GTFSRS--KRVKLEDCINMFTNDEVLSGENAWDCSNCGSS------------------ 214

Query: 855  IAKSKKKKSRFFTLHTGSKRRHLDFFGDNINESNSSNTVTFERERSRSPFKMLGSSGKRS 914
                        ++H   +R+          +  + N    +R R    F +   +G+ S
Sbjct: 215  ------------SVHNVEQRK----------DKTTGNGEEKKRSRKSRLFLLPNINGRSS 252

Query: 915  NSSTPFAXXXXXXXXXXXXXXXXLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITY 974
             S +PF                 L T+K++NF++LP  LVIHLSRFYYDL+KKN T++TY
Sbjct: 253  RSISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVIHLSRFYYDLSKKNETIVTY 312

Query: 975  PLILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            PLILNI+L NNET KYRL+G+VNHTG L+SGHYT+LVNK+  H +   + KWYYFDDEVV
Sbjct: 313  PLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNHELKKDKQKWYYFDDEVV 372

Query: 1035 KADNKHGS--DKNLKISSSDVYVLFYERVHD 1063
            K +N HG+  +  +K+SSS VYVLFYERV++
Sbjct: 373  KEENNHGNIDEGVIKVSSSQVYVLFYERVYN 403

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  494 bits (1271), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 256/479 (53%), Positives = 315/479 (65%), Gaps = 50/479 (10%)

Query: 585  IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGS 644
            IPTIEQS N YV+LSITGLRN+G TCY+NSM+QCLFA K FR LF+S  Y++Y       
Sbjct: 540  IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF----SR 595

Query: 645  RSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILL 704
            +  + ++LS   N+LF KMY+NGGCSVVPTGFLK  N LRPD +IP DQQDTQEFL+ LL
Sbjct: 596  KYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLL 655

Query: 705  DRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 764
             +LHDELS    VANDYP LLL++   L V   EY  WF+K++  NGISPID+IFQGQME
Sbjct: 656  SQLHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQME 715

Query: 765  NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824
            N L C+RCG+++FNYS FYVLSLAIP  +   S+      K+V+LEDCIN+FT DE L+ 
Sbjct: 716  NGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQ-----RKKVRLEDCINLFTSDEQLTN 770

Query: 825  ENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNI 884
            ENAWDCP+CG +                    + +KKK RF                 N 
Sbjct: 771  ENAWDCPKCGTSASGTG--------------PEEEKKKKRFLL---------------NP 801

Query: 885  NESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKTI 944
            +   S N   F        FK+   S  RS S +PF                 LTT+KT+
Sbjct: 802  DTRASGNRSRF--------FKL--RSKSRSRSVSPFRKQSSQQQNLEKLKSKKLTTIKTL 851

Query: 945  NFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVS 1004
            NF++LP +L IHLSRF+YDLTKKN+ VITYPLIL+I+LKN + MKYRL+ + NH G L+S
Sbjct: 852  NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLIS 911

Query: 1005 GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVLFYERV 1061
            GHYTSLVNKDL+H ++ G+ KWYYFDDE VK D  HG  D  +  ISSSDVYVLFYE++
Sbjct: 912  GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970

 Score =  308 bits (790), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 185/469 (39%), Positives = 261/469 (55%), Gaps = 69/469 (14%)

Query: 7   LFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDA 66
           L++PEYSNELL+ V+D+Y +DI HY+P+                      ++  N+  D 
Sbjct: 4   LYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDL 63

Query: 67  LTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAF+ GC+Y++LIIP S+QFQ+R+KSY+IY DLKK Y++E NMTNV+LMV + I  +  
Sbjct: 64  LTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSK 123

Query: 127 ESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAG---PHGHGFKASFTEEDAEQS 183
           + V+ A     RI +KRA+SVP       + +LS  N+    P         TE + E  
Sbjct: 124 DEVETA-----RIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAP------TETEFENG 172

Query: 184 SPVWTAPNLEPNDQLKLALL-----------------------------PEVIPTPIYPE 214
           + +WTAP LEPND LK++L                              PE+    +   
Sbjct: 173 TTMWTAPELEPNDHLKVSLGSHHSSTSSASSNEQFPKIHNESHSFPFEEPELHALSLGGS 232

Query: 215 SGRKTSSPVRPSVLLEDVPYNCYDGGASSASLNPSFGEITVDRSITHRKDSYHSIYMVDS 274
             R++S P R S  L          G + AS +  F +  ++R  THRKDSYHS++M   
Sbjct: 233 RTRRSSVPARASRKL----------GTTQASNSSDFNDQKINRYATHRKDSYHSVHM--- 279

Query: 275 DTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRS 334
                 NDD      D F  +L  LQKQS++T  +L  IL  S +R+ +LLIDLR  +R 
Sbjct: 280 -----SNDDY-----DAFTFNLARLQKQSVVTCDQLMRILC-SQDRDNLLLIDLRFSKRF 328

Query: 335 EINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKT 394
           + NHI+APNL+ +DP LLW++   +P+  D  LE  L +N++   R +FEY+VYYTD+KT
Sbjct: 329 QTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL-DNKLLNARSQFEYIVYYTDMKT 387

Query: 395 FMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEY 443
           FM ++FDY  +FF L+ TS K +L   P  LLGGYE+WKK L   +Q Y
Sbjct: 388 FMKLDFDYQLVFFQLIYTSNK-NLKCTPKVLLGGYEQWKKFLSKSSQAY 435

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  484 bits (1245), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/480 (52%), Positives = 315/480 (65%), Gaps = 47/480 (9%)

Query: 585  IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGS 644
            +PTIEQ+ N YVSLSITGLRNLGNTCYI+SM+QCLFA    R LFI+  Y++Y+      
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYI----NH 664

Query: 645  RSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILL 704
            +      LS S ++LF KMYLNGGCSVVP  FLK  NQLRPDLKIPDDQQDTQEFLM++L
Sbjct: 665  KVTDKINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVL 724

Query: 705  DRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 764
            DRLHDELS +  V NDY NLLLY+A+ + V  ++YK WF+ + +  G+SPIDDIFQGQ+E
Sbjct: 725  DRLHDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIE 784

Query: 765  NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824
            NS+ C+RCGY++FNYS+FYVLSLAIP    K+S +  S   RVKLEDCINMFT DEVLSG
Sbjct: 785  NSINCQRCGYSSFNYSSFYVLSLAIP----KISVMSFSRTNRVKLEDCINMFTRDEVLSG 840

Query: 825  ENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNI 884
            ENAWDC RCG                           +S  F      K  H     D+ 
Sbjct: 841  ENAWDCSRCG--------------------------SQSDNFV-----KTSH----NDHH 865

Query: 885  NESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKTI 944
             E  S  T   ++ R    F +       S S +PF                 + T+K++
Sbjct: 866  KEHTSETTDDSKQNRKSRLFLLPKKYNPTSRSLSPFG-RHSSHKSSEKWKSKKMETIKSL 924

Query: 945  NFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLV- 1003
            NF+ +PKILVIHLSRF+YD++KKN TV+ YPLILNI+LKN E  KYRL+ +VNH G  V 
Sbjct: 925  NFIKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVCKYRLYAIVNHMGNQVA 984

Query: 1004 SGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVLFYERV 1061
            SGHYT+LVNK+  H +     +WYYFDDEVVK +  HG+ D+ + K+SSS VYVLFYE++
Sbjct: 985  SGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGVNKVSSSHVYVLFYEKI 1044

 Score =  355 bits (911), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/496 (40%), Positives = 298/496 (60%), Gaps = 62/496 (12%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           FTPEYSNELL+RV D Y+ +IK ++PQ                     D +   + ++ L
Sbjct: 7   FTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECL 66

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           +A+I+GC+Y++LIIP S QFQ RNKS+ IY +LK +Y+N+ NMTNV+ +VK E+  +LDE
Sbjct: 67  SAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDE 126

Query: 128 SVKHAVGIEHRITKKRAFSVPA---NDLSGQVASLSLENAGPHG------HGFKASFTE- 177
           S+    GIE  I + RA+S PA   N++S + + LS+ +   +G      +  ++ F + 
Sbjct: 127 SILELEGIEKVIKRDRAYSSPAPKVNNIS-KFSKLSINDNHHNGETISTDNKLQSHFPQT 185

Query: 178 -----------------------EDAEQSSPVWTAPNLEPNDQLKLALL-------PEVI 207
                                  E+AE ++P+W  P+LEPNDQLKLAL         E+ 
Sbjct: 186 PNYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLALEQPVEFSDEEID 245

Query: 208 PTPIYPESGRKTSSPVRP----------SVLLEDVPYNCYDGGASSASLNPSFGEITVDR 257
            + I    GR+ S P+ P          S  L   P+N  D    ++ L     ++ VDR
Sbjct: 246 ASSISEPLGRRYS-PLSPYQKKRNSSISSAFLVPFPHNENDKVHDNSML---IEDLPVDR 301

Query: 258 SITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNS 317
           S+THRKDSYHS+YM + D  +E +       ++ +IQS+D LQKQ++IT  EL+SILS+ 
Sbjct: 302 SVTHRKDSYHSVYMNNQD--EESDSGAHYGLSNSYIQSMDRLQKQNVITCSELYSILSSP 359

Query: 318 IEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEE--NE 375
            ER+K+LL+DLRIP+ S  NHI+AP+++KIDPNLLW+ +T TP+Y     E L++   N 
Sbjct: 360 TERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYS---FEELVKRINNP 416

Query: 376 IFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKT 435
           +    +KF+Y+VYY+D++TFM  ++D+ F FFYL+L+++  +L  VPT LLGG+EKWKK 
Sbjct: 417 LISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSLNLKQVPTNLLGGFEKWKKV 476

Query: 436 LHTYAQEYDVSIEDYL 451
           L TY +EY + I  ++
Sbjct: 477 LKTYNKEYGIDITPFI 492

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1212

 Score =  482 bits (1241), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/507 (50%), Positives = 322/507 (63%), Gaps = 52/507 (10%)

Query: 580  QRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ 639
             R ++IP +E+S N YVSLSITGLRNLGNTCYINSM+QCLFA   FR +F+S  Y+ Y+ 
Sbjct: 732  HRHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMD 791

Query: 640  P--PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQ 697
               P   R      LS S NMLF KMY+NGGCSVVPTGFLK  N LRPDL+IPDDQQDTQ
Sbjct: 792  HDIPTNQR------LSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQ 845

Query: 698  EFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDD 757
            EFLM++LDRLHDELSNQ  V  DYP+L+ Y+ D ++V   +Y  W++++V  NG+SPID 
Sbjct: 846  EFLMLILDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDH 905

Query: 758  IFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFT 817
            +FQGQ E+ L C+RCG ++F YSTFY+LSLAIP+ S   +  G+   KRV LEDCI MFT
Sbjct: 906  VFQGQTEDGLVCQRCGCSSFTYSTFYILSLAIPKAST--NAFGKI--KRVNLEDCIKMFT 961

Query: 818  DDEVLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKK--------------- 862
            +DE+LS ENAWDCPRCG                   PI + ++KK               
Sbjct: 962  NDEILSDENAWDCPRCG------------SAAPKQEPIHRHREKKHIHDISPPPRSPSSP 1009

Query: 863  ----SRFFTLHTGSK--RRHLDFFGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNS 916
                 RFF L+   +  R +           +       +   SRS  + L    +  N 
Sbjct: 1010 EPRSKRFFLLNAPREVVRSYSPLRILPGGRHSFDKPRELKEHYSRSADENLSDDKENQNH 1069

Query: 917  STPFAXXXXXXXXXXXXXXXXLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPL 976
            +TP                  + T+K++NFV  P+ILVIHLSRFYYDLTKKN+TVITYPL
Sbjct: 1070 TTPNG-----RAGRVRHYSGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPL 1124

Query: 977  ILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1036
             LNI LKN E  +Y+L+G+VNHTGTLVSGHYTSLVNKD +H +   + KW+YFDDE+VK 
Sbjct: 1125 HLNISLKNGEVARYKLYGLVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKE 1184

Query: 1037 DNKHGSDKN--LKISSSDVYVLFYERV 1061
            +  HG  +     ISSS VYVLFY+R+
Sbjct: 1185 EKNHGDIEGGVTSISSSHVYVLFYQRI 1211

 Score =  234 bits (597), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 151/199 (75%), Gaps = 3/199 (1%)

Query: 255 VDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSIL 314
           VDRS+THRKDSYHS+YM +     EDN++    ET E+I+SL+ +QKQ +IT PELFS+L
Sbjct: 446 VDRSVTHRKDSYHSVYMFNDSN--EDNNNHGYDETSEYIESLEHIQKQDVITCPELFSLL 503

Query: 315 SNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEEN 374
           SN++EREK+LLIDLR P R   NHIVAPN+++++P LLWD  TNTPVY  + LE ++  N
Sbjct: 504 SNNVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQII-NN 562

Query: 375 EIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKK 434
            +F  RD F+YVVYY+D+KT+M M FDY+F  FYL++T     + S+PT+LLGGYEKW K
Sbjct: 563 PLFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKWYK 622

Query: 435 TLHTYAQEYDVSIEDYLYR 453
            +++Y  +Y +++ DY+YR
Sbjct: 623 VINSYVNQYSITMNDYVYR 641

 Score =  115 bits (287), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 90/148 (60%), Gaps = 7/148 (4%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           +TPEYS+ELL+ VQ++Y+ + K +YPQ                      S+R +  +DAL
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD- 126
           +AFI+G +Y++ IIPQS QF T+N+ Y +Y +LK +YE+E+NMTNV+ MVK EI  +LD 
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

Query: 127 ------ESVKHAVGIEHRITKKRAFSVP 148
                 ES  +       I ++RAFSVP
Sbjct: 130 NYKSQNESSNNLFVDSKFIRRERAFSVP 157

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 22/27 (81%)

Query: 175 FTEEDAEQSSPVWTAPNLEPNDQLKLA 201
           ++ ED ++SSP+WTAP L+  +QLKLA
Sbjct: 257 YSIEDTDESSPLWTAPQLDSKNQLKLA 283

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  485 bits (1248), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 251/489 (51%), Positives = 323/489 (66%), Gaps = 66/489 (13%)

Query: 583  YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642
            ++IPTIE S N YV+LSITGLRN+ NTCYINSM+QCLF+   FR LF+S  Y +YL+ P+
Sbjct: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE 1146

Query: 643  GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702
                     +S S  MLF KMY+NGGCSVVP+GFLK+ N L+PDL+IP  QQDTQEFL+ 
Sbjct: 1147 ------MDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLF 1200

Query: 703  LLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 762
            LLD+LHDELS+ + V+NDY +LLL++   L V + +Y  WFD+N+  NG+SPIDD+FQGQ
Sbjct: 1201 LLDKLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQ 1260

Query: 763  MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVL 822
            MEN L C+RCGY+++ YSTFYVLSLA+P    K    G++  K+++LEDCIN FT DEVL
Sbjct: 1261 MENQLSCQRCGYSSYTYSTFYVLSLALPNPVAK--AFGKT--KKLRLEDCINFFTCDEVL 1316

Query: 823  SGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTL-HTGSKRRHLDFFG 881
            S +NAWDCPRC                             S + +  H G ++    F  
Sbjct: 1317 SDQNAWDCPRCC--------------------------SPSDYMSYDHKGKRKISTSF-- 1348

Query: 882  DNINESNSSNTVTFE-----RERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXX 936
            +++N  NSS +  F+     R RS +P      S K SN                     
Sbjct: 1349 ESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKP------------------ 1390

Query: 937  XLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVV 996
               TVK++NF+T+P+ILVIHLSRF YDLTKKN+ V++YPLILNI+LKN+E  K+RL+ +V
Sbjct: 1391 --ATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIV 1448

Query: 997  NHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKN--LKISSSDVY 1054
            NH GTL+SGHYTSLVNK+L H +  G+ KWYYFDDE+VK D  HG   N    +SSS+VY
Sbjct: 1449 NHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVY 1508

Query: 1055 VLFYERVHD 1063
            VLFYER+ D
Sbjct: 1509 VLFYERIFD 1517

 Score =  209 bits (533), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 162/484 (33%), Positives = 249/484 (51%), Gaps = 57/484 (11%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           + PEYS EL + V+++Y E+++  Y +                     + +   +    +
Sbjct: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           TA+++G +Y++LIIPQS++F TRN SYSIY DLK+ YE++ NM NV+L+V  ++G V+  
Sbjct: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124

Query: 128 SVKHAVGIEH---RIT-KKRAFSVPAND---LSGQVASLSLENAGPHGHGFKASFTE--- 177
            +    G E    R T +KRA+S+ + D   L+  +  LS+E +   G       TE   
Sbjct: 125 YLS-GEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGA 183

Query: 178 -----EDAEQSSPVWTAPNLEPNDQLKLALLPEVIPT------PIYPESGRKTSSPVRPS 226
                +D E    VW+APNLEP+DQLKLA+     P+          +SG + +S    S
Sbjct: 184 FGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAAEFS 243

Query: 227 VLLEDVPYNCYDGGASSASLN------------PSFGE--ITVDRSITHRKDSYHSIYMV 272
           VL E+   +    G  S SL             PS G+    +DR  TH +D  + I   
Sbjct: 244 VLDEEW-VSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPIC-- 300

Query: 273 DSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPR 332
                   ND ++  E      S+  L + S I   +L S L++S ER  +LLIDLR+P+
Sbjct: 301 --------NDGVVPCEN----SSIMWLYESSSIKCLDLLSKLTSS-ERSSMLLIDLRLPK 347

Query: 333 RSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDV 392
           R E +HI+A N++ IDP LLWD +   PV     LE L+ +N +F +R +F  +V YTD 
Sbjct: 348 RYEYSHILAENVINIDPELLWDDEKGAPVSSVKELE-LVIDNHLFRSRRQFATIVCYTDN 406

Query: 393 KTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLY 452
            T+M ++FD+VF+ F L+   +      V   L GGYE+WK  L    +   + + D+L+
Sbjct: 407 YTYMQIDFDFVFLLFRLLYLGRPQL---VLKTLSGGYEQWKSFLKELKRTESIILSDFLW 463

Query: 453 -RPY 455
            RP+
Sbjct: 464 KRPH 467

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  457 bits (1177), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/481 (51%), Positives = 328/481 (68%), Gaps = 42/481 (8%)

Query: 583  YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642
            +++PTIE++ N Y++LSITGLRN+ NTCYINSM+QCLF+   FR LF+S  Y  YL    
Sbjct: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL---- 783

Query: 643  GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702
              +S++   +S S  MLF KMY+NGGCSVVP+GFLK+ + L+PDL+IP  QQDTQEFL+ 
Sbjct: 784  --KSSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLF 841

Query: 703  LLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 762
            LLDRL DELS    V NDYP LLL+ +  LKV++ EY  WFD+N   NG+SPID IFQGQ
Sbjct: 842  LLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQ 901

Query: 763  MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVL 822
            +E+ L C+RC +++++YSTFYVLSLA+P    K    G++  K+++LEDCIN FT DEVL
Sbjct: 902  IEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSK--AFGKA--KKLRLEDCINFFTCDEVL 957

Query: 823  SGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGD 882
            +G+N WDCP+CG                     ++  K+K++FF    GS         +
Sbjct: 958  TGQNPWDCPKCGVNSSGDRQMN-----------SEKSKRKNKFF---MGS---------E 994

Query: 883  NINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVK 942
            N N +NS+      R+     FK +GS  +  +SS   +                L T+K
Sbjct: 995  NANSANSN------RDHLPRLFK-IGSKSRSRSSSPFISGPKSSGKTHEKRYNKKLATIK 1047

Query: 943  TINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTL 1002
            ++NF+TLP+IL+IHLSRF YDLTKKN+TV+TYPLILNI+LKNNE  KYRL+  +NH GTL
Sbjct: 1048 SLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTL 1107

Query: 1003 VSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVLFYER 1060
            +SGHYTSLVNKDL+H +  G+ KWYYFDDE+VK D  HG+ D+ +  +SSSDVY+LFYER
Sbjct: 1108 ISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYER 1167

Query: 1061 V 1061
            +
Sbjct: 1168 I 1168

 Score =  127 bits (320), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 110/196 (56%), Gaps = 4/196 (2%)

Query: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDAL 67
           + PEYS+EL   VQ+ Y + ++  YP+                     D +R  +  + L
Sbjct: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64

Query: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEI-GVVLD 126
            A++IG +Y++LIIPQS++F TRN SYS+YTDL+K YE E NMTNVV MV +++  V+L 
Sbjct: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124

Query: 127 ESVKHAVGIEHRITKKRAFSVPANDL---SGQVASLSLENAGPHGHGFKASFTEEDAEQS 183
           ++ +     + ++ +KRA+SVP   +   S  +  L+++     GH        E A Q+
Sbjct: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA 184

Query: 184 SPVWTAPNLEPNDQLK 199
             +W+AP LE ND L+
Sbjct: 185 DTLWSAPKLEENDLLR 200

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 92/168 (54%), Gaps = 5/168 (2%)

Query: 286 NVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLV 345
           N    E    L  L + S I   +L  IL + I+ +++L IDLR P+R E+NHIVA +L+
Sbjct: 431 NAAGLESCNPLTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLI 489

Query: 346 KIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFI 405
            IDP LLWD + + P+   +  E  L +N +F  R +F Y+V YTD  T M M+F +   
Sbjct: 490 NIDPLLLWDTERSAPITSVNEFERRL-DNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELT 548

Query: 406 FFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYR 453
           FF L+   +   LT     L GGY++W+  L T  +     I D+++R
Sbjct: 549 FFELVYMGKPRLLTK---CLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  437 bits (1124), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 230/496 (46%), Positives = 321/496 (64%), Gaps = 63/496 (12%)

Query: 575  LQPQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANY 634
            ++    +AYN+P IE S+++   LSITGL+N  NTCYINS+IQCLF   +FR LF++  Y
Sbjct: 272  IESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKY 331

Query: 635  KNYLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQ 694
            + +L   K  +     +LS S+ +LF KMYLNGG +++P  FLK+  +LRPDL IPDDQQ
Sbjct: 332  RLFLNTNKYPKEV---QLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQ 388

Query: 695  DTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISP 754
            DTQEFL+I+L R+H+ELSN+ +V   YP+L+ Y+A+AL+V+ ++Y+ W+++NVI +G+SP
Sbjct: 389  DTQEFLLIVLARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSP 447

Query: 755  IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCIN 814
            ID I++GQ+EN L+C+RCG ++++YSTFYVLSLAIP+ S+       S  +++KLEDCIN
Sbjct: 448  IDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFT---SKSRKIKLEDCIN 504

Query: 815  MFTDDEVLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKR 874
            +FT DE LSG+NAWDCP C  T                     S+KKKS  F  H+    
Sbjct: 505  LFTGDEELSGDNAWDCPNCRITDSKSKKEEIT-----------SQKKKSTIFGFHS---- 549

Query: 875  RHLDFFGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXX 934
                                  R RS+SP          S+ ST  A             
Sbjct: 550  ----------------------RSRSKSP-HHHHHHHHSSDDSTKNA---------KKRN 577

Query: 935  XXXLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFG 994
               LTT+K+++F+ LP ILVIHLSRFYYDLTKKNSTVITYPLILNIILKN + ++Y+L+G
Sbjct: 578  SKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYG 637

Query: 995  VVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKN------LKI 1048
             VNH+G L++GHYTS+VNK+  H + + R  W  FDD+ ++   +H  D+N       ++
Sbjct: 638  TVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQ---QHRKDRNNFEAGKTEM 694

Query: 1049 SSSDVYVLFYERVHDQ 1064
            SS +VYVLFYER+ ++
Sbjct: 695  SSDEVYVLFYERMDEE 710

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 91/172 (52%), Gaps = 6/172 (3%)

Query: 14  NELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDALTAFIIG 73
           +++L  V+ +Y  DIK +Y Q                       +  N+  +ALTAFIIG
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHAV 133
           CYY++LIIPQSLQFQTRN  YS Y  LK  Y++E  M  V+ +V+ E  V++D  +  + 
Sbjct: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125

Query: 134 GIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDAEQSSP 185
           GI   I +KRA+S+P   L   +ASLS+ N       F  S  E   E + P
Sbjct: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHNK------FDGSLHEIPNELTKP 171

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  433 bits (1114), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 230/483 (47%), Positives = 311/483 (64%), Gaps = 60/483 (12%)

Query: 585  IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGS 644
            +PTIE S+++   LSITGL+N  NTCYINS+IQCLF   +FR LF++  Y+ +LQ  K  
Sbjct: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346

Query: 645  RSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILL 704
            R     +LS S+ +LF KMYLNGG ++ P GFLK+  +LRPDL IPDDQQDTQEFL+I+L
Sbjct: 347  REV---QLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIIL 403

Query: 705  DRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 764
             RLH+ELSN   V   YP+L+ Y+A+A +V+ ++Y+ W++ +V+ +G+SPID IF+GQME
Sbjct: 404  ARLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQME 462

Query: 765  NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824
            N L+C+RCG ++ +YSTFYVLSLAIP+ S+       S  K++KLEDCIN+FT DE LSG
Sbjct: 463  NILKCQRCGNSSHSYSTFYVLSLAIPKISL---YSFTSKSKKIKLEDCINLFTSDEELSG 519

Query: 825  ENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNI 884
            +N+WDCP CG T                   + S+KKKS FF+ H+              
Sbjct: 520  DNSWDCPNCGTTDLKTKINE-----------STSQKKKSTFFSFHS-------------- 554

Query: 885  NESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKTI 944
                        R RS+SP           +++   +                LTTVK+ 
Sbjct: 555  ------------RSRSKSPHHHHHHHHHSHDNTEKHS---------KKWNSRKLTTVKSS 593

Query: 945  NFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVS 1004
            +F+ LP ILVIHLSRFYYDLT+KN+TVITYPLILN+ILKNN+ ++Y+L+G VNH G LV+
Sbjct: 594  DFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVN 653

Query: 1005 GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDK----NLKISSSDVYVLFYER 1060
            GHYTS VNK+  H + + R  W  FDD+ +K   +H  D       ++SSS+VYVLFYER
Sbjct: 654  GHYTSDVNKEKNHEIGLNRQVWITFDDDYIK---QHHHDDFEAGKTEVSSSEVYVLFYER 710

Query: 1061 VHD 1063
            + +
Sbjct: 711  MDE 713

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 86/150 (57%)

Query: 14  NELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDALTAFIIG 73
           ++++  V+++Y  DIK +Y Q                          N+  +ALTAFIIG
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHAV 133
            YY++L+IPQSLQFQTRN  YS Y  LK  Y++E  M+ V+ +VK+E  +++D  +  + 
Sbjct: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125

Query: 134 GIEHRITKKRAFSVPANDLSGQVASLSLEN 163
            I   IT+KRA+S+P   L   +ASLS+ N
Sbjct: 126 RISRTITRKRAYSLPLRPLPVHMASLSILN 155

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  431 bits (1107), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 229/489 (46%), Positives = 310/489 (63%), Gaps = 64/489 (13%)

Query: 581  RAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP 640
            + + +P IE S N+   LSITGLRN  NTCYINSM+QCLF+  +FR LF++  YK +L+ 
Sbjct: 276  KTFKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLEN 335

Query: 641  PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFL 700
             K  +     +LS+S+ +LF KMYLNGG +++P GFLKV  +LRPDL IPDDQQDTQEFL
Sbjct: 336  EKYPKGL---QLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFL 392

Query: 701  MILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760
            MI+L R+H+ELSN  +V   Y +L+L +A AL+V+ ++Y+ W ++ V+ +G+SPID IFQ
Sbjct: 393  MIILARIHEELSNN-NVTKYYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQ 451

Query: 761  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
            GQMEN L+C+RCG ++++YSTFYVLSLAIP+ S+       S  K++KLEDCIN FT DE
Sbjct: 452  GQMENILKCQRCGNSSYSYSTFYVLSLAIPKASL---YSFTSKSKKIKLEDCINFFTSDE 508

Query: 821  VLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFF 880
             LS +NAWDCP+C                        S+KK+S  F LH+          
Sbjct: 509  ELSDDNAWDCPKCRTAEYKLKKDENL-----------SQKKRSILFNLHS---------- 547

Query: 881  GDNINESNSSNTVTFERERSRSPFKML--------GSSGKRSNSSTPFAXXXXXXXXXXX 932
                            R RS+SP                K+++ +T              
Sbjct: 548  ----------------RPRSKSPRHRHHHHHHRHKNDDAKKNDDAT---------KNSKK 582

Query: 933  XXXXXLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRL 992
                 LTT+K+++F+ LP ILVIHLSRFYYDLTKKN+TVITYPLILNIILKNN+ ++Y+L
Sbjct: 583  WKSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKL 642

Query: 993  FGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSD---KNLKIS 1049
            +  VNH+G L++GHYTS+VNK+  H + + R  W  FDD+V+K  +K   D      +IS
Sbjct: 643  YATVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEIS 702

Query: 1050 SSDVYVLFY 1058
            S++VYVLFY
Sbjct: 703  SNEVYVLFY 711

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 86/150 (57%)

Query: 14  NELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDALTAFIIG 73
           N++L  V+++Y  DIK  Y Q                       +++N+  +ALTAFI+G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHAV 133
            +Y++L+IP SLQFQTRN  YS Y  LK  Y++E  M+ V+ +VK E  +++D+ +  + 
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSK 125

Query: 134 GIEHRITKKRAFSVPANDLSGQVASLSLEN 163
            I   + +KRA+S+P   L   +ASLS+ N
Sbjct: 126 RISRSMKRKRAYSLPLRPLPVHMASLSIHN 155

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  421 bits (1081), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 221/485 (45%), Positives = 309/485 (63%), Gaps = 62/485 (12%)

Query: 586  PTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSR 645
            PTIE S  +   LSITGL+N  NTCYINS+IQCLF +  FR LF++  Y+ +L+  +  +
Sbjct: 277  PTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPK 336

Query: 646  SAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
                 +LS S+  LF KMY NGG ++VP GFLK+  +LRPDL IPDDQQDTQEFL+I+L 
Sbjct: 337  EV---QLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILA 393

Query: 706  RLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
            R+H+ELSN+ +V   Y +L+ Y+ +AL+V+  +Y+ W+++ ++ +G+SPID IF+GQMEN
Sbjct: 394  RIHEELSNE-NVTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMEN 452

Query: 766  SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGE 825
             L+C+RCG ++F+YSTFYVLSLAIP+ S+       S  K++KLEDCIN+FT DE L+G+
Sbjct: 453  ILKCQRCGNSSFSYSTFYVLSLAIPKNSV---HSFTSKSKKIKLEDCINLFTSDEELTGD 509

Query: 826  NAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNIN 885
            NAWDCP C                        S+KK+S  F+ H+               
Sbjct: 510  NAWDCPECRIDDSKLKTGENS-----------SQKKRSPLFSFHS--------------- 543

Query: 886  ESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTTVKTIN 945
                       R RS+SP          S+++T                   LTT+K+++
Sbjct: 544  -----------RSRSKSPHHHHHYHHHGSDNTT---------KNSNKWKSKRLTTIKSLD 583

Query: 946  FVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSG 1005
            F+ LP ILVIHLSRFYYDLTKKN+ VITYPLILNIILKNN+ ++Y+L+G VNH+G L++G
Sbjct: 584  FIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILKNNKVVRYKLYGTVNHSGNLITG 643

Query: 1006 HYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKN------LKISSSDVYVLFYE 1059
            HYTS+VNK+  H + + +  W  FDD+ +    +H  D++       K+SSS+VYVLFYE
Sbjct: 644  HYTSVVNKERSHEIGLNKQVWVTFDDDFII---QHHKDRDGFEAGKTKMSSSEVYVLFYE 700

Query: 1060 RVHDQ 1064
            R+ ++
Sbjct: 701  RMDEE 705

 Score =  103 bits (258), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 86/150 (57%)

Query: 14  NELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPNDALTAFIIG 73
           +++L  V+D+Y  DIK +Y Q                       +  NR  +ALTAFIIG
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHAV 133
            YY++LIIPQSLQFQTR+  YS Y  LK  Y++E  M+ V+ +V+ E   ++D+ +  + 
Sbjct: 66  GYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSN 125

Query: 134 GIEHRITKKRAFSVPANDLSGQVASLSLEN 163
            I   IT+KRA+S+P   L   +ASLS+ N
Sbjct: 126 RITVTITRKRAYSLPLRPLPVHMASLSIHN 155

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
            YIL156W
          Length = 846

 Score =  409 bits (1051), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 226/485 (46%), Positives = 301/485 (62%), Gaps = 74/485 (15%)

Query: 583  YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642
            Y +P +  SSN+YV LSI+GLRNLGNTCYINSM+QCLFA   FR LF+S  YK Y+    
Sbjct: 428  YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI---- 483

Query: 643  GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702
            G++      LSNS ++LF KMYLNGGC+V+P  FLK  N LRPDL+IPD QQDTQEFL++
Sbjct: 484  GTKV--DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLIL 541

Query: 703  LLDRLHDEL-SNQQHVANDYPNLLLYNADALKVSN-NEYKHWFDKNVIGNGISPIDDIFQ 760
            LLD+LH+EL SNQ  + +++P+L+ Y+ D++ V N NEYK WF +++   G+S I +IFQ
Sbjct: 542  LLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601

Query: 761  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
            GQ+ENSL+C+RC YT+ NYS F  LSL+IP +  K  KL       V LEDCI++F ++E
Sbjct: 602  GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL-------VDLEDCISLFIENE 654

Query: 821  VLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSR-FFTLHTGSKRRHLDF 879
            +L+GENAW+CP+C  +                     + K+KSR FF       R H D 
Sbjct: 655  MLTGENAWNCPKCSSSSN-----------------NNTSKRKSRGFFKFSKHKNRSHNDL 697

Query: 880  FGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLT 939
                 N ++SS+ V F +++                                      L 
Sbjct: 698  TFSEYNHNSSSDDVKFSKKK--------------------------------------LV 719

Query: 940  TVKTINFVTLPKILVIHLSRFYYD-LTKKNSTVITYPLILNIILKNNETMKYRLFGVVNH 998
            T K+ +F+ LP +L+IHLSRF    L  KN+T I YP IL I LKN E  +++L+GVVNH
Sbjct: 720  TRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNH 779

Query: 999  TGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD-NKHGSDKNL-KISSSDVYVL 1056
             G L +GHYTSL+NK+  H ++  R KW+YFDDE VK   N    DKN+ +ISSSDVYVL
Sbjct: 780  FGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVL 839

Query: 1057 FYERV 1061
            FYE++
Sbjct: 840  FYEKI 844

 Score =  107 bits (266), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 102/173 (58%), Gaps = 12/173 (6%)

Query: 281 NDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIV 340
           ND  +N E D +++ L    ++  IT  ELFSILSN  +R KIL+IDLR+ R   +  I 
Sbjct: 195 NDKTINDE-DTYLKHL---YEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIR 250

Query: 341 APNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVK-TFMYMN 399
           +PNL+K DP  LW+ +  TPV         L  N +F   D F Y++ Y+D + T  + +
Sbjct: 251 SPNLIKFDPIELWNNRDQTPVLH----RTSLFSNPLFQKIDLFSYIIIYSDNETTTAFES 306

Query: 400 FDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLY 452
           F+Y F FF L+++S    +   P  LLGG+EKW++ + +Y+++Y +   +Y++
Sbjct: 307 FEYNFSFFKLLMSSS---MKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 74/143 (51%), Gaps = 41/143 (28%)

Query: 65  DALTAFIIGCYYVFLIIPQS-LQFQTRNKSY-SIYTDLKKMYENEMNMTNVVLMVKKEIG 122
           D+L +FIIG +Y+ L+IP S    ++ N  Y +IY DLKK YE++ N+++++ +++ E  
Sbjct: 60  DSLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESE 119

Query: 123 VVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEED--A 180
            +L                 ++F V A                P  H    S  EED  A
Sbjct: 120 NIL-----------------QSFDVDA----------------PSSH----SQHEEDNTA 142

Query: 181 EQSSPVWTAPNLEPNDQLKLALL 203
           + S+ +W AP LEPNDQLKLA++
Sbjct: 143 DSSTTIWQAPFLEPNDQLKLAII 165

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  372 bits (956), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 211/486 (43%), Positives = 291/486 (59%), Gaps = 39/486 (8%)

Query: 1   MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRH 60
           M  +TT FTPEYS+ELLR V+D+Y +DIK +Y                       D M++
Sbjct: 1   MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60

Query: 61  NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
               DALTA+IIGCY+++LIIPQS QFQ RNK++ ++  LKK+YEN++NMTNV+LMVK E
Sbjct: 61  RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120

Query: 121 IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAG---PHGHGFKASFTE 177
           +  VLD   +    +E    +KRAFS P N L  +++ L+L   G   P  H  K  F  
Sbjct: 121 VDSVLDRDFRKLKDVE----RKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHK-KWDFIR 175

Query: 178 EDAEQSS------PVWTAPNLEPNDQLKLAL----------------LPEVIPTPI-YPE 214
            D+   S      P+W APNLEPNDQLKLAL                 PE+  +P+ YP+
Sbjct: 176 SDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPK 235

Query: 215 SGRKTSSPVRPSVLLEDVPYNCYDGGASSASLNPS-----FGEITVDRSITHRKDSYHSI 269
              K+   V      +    + +     +  L        F +  VDR++ HRKDSYHS+
Sbjct: 236 HKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSV 295

Query: 270 YMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLR 329
           YM D D    +N      E++  +Q++  LQKQSIIT+PELFSILSN  ER ++LLIDLR
Sbjct: 296 YMDDGDHDFGENKGATFPESE--VQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLR 353

Query: 330 IPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYY 389
           +  R + N+I+APN+V IDP +LWD  T TPV    +L+  L+ N IF  R  F+++VYY
Sbjct: 354 LQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLK-NSIFNKRGSFDFIVYY 412

Query: 390 TDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIED 449
           TD+KT+M M+FDY+F+F+ L++ SQ+  L S+P+ LLGGYEKWK  L  Y  ++ + ++D
Sbjct: 413 TDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDD 472

Query: 450 YLYRPY 455
           YLYRPY
Sbjct: 473 YLYRPY 478

 Score =  324 bits (830), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 156/260 (60%), Positives = 191/260 (73%), Gaps = 6/260 (2%)

Query: 577 PQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKN 636
           P  QR +++PTIE+S+N YV+LSITGLRNLG TCYINSM+QCLFA  +FR LF  +NY+ 
Sbjct: 575 PMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYER 634

Query: 637 YLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDT 696
           +  P        + KLS S ++L  KMY+NGGCSVVPT FLK+ N LRPD  IPDDQQD 
Sbjct: 635 FFNP----ELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDA 690

Query: 697 QEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPID 756
           QEFLM+ +DRLHDELSNQ  V N +P LLLY+A+  KV   EYK WF+ ++I    SPID
Sbjct: 691 QEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPID 750

Query: 757 DIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMF 816
            IFQGQ+EN L CK+CGY++++YSTFY+LSLAIP+ S       +     V LEDCINMF
Sbjct: 751 KIFQGQLENGLHCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGN--WVNLEDCINMF 808

Query: 817 TDDEVLSGENAWDCPRCGPT 836
           T DEV+S ENAWDCP+CG T
Sbjct: 809 TSDEVMSRENAWDCPKCGVT 828

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  317 bits (813), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 196/479 (40%), Positives = 270/479 (56%), Gaps = 54/479 (11%)

Query: 5   TTLFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRHNRPN 64
           ++ FTPEYS EL  RVQD+Y  DIK   PQ                       +   R +
Sbjct: 8   SSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD 67

Query: 65  DALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 124
           DAL+A+I+GCYY++LIIPQS QFQT+NKSYS+Y D K +Y+NE NMTNV  MV+ E+  +
Sbjct: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127

Query: 125 LDESVKHAVGIEHRITKKRAFSV-------------PANDLSGQVASLSLENAGPHGHGF 171
           LD+S +     +  I + RAFSV             P  +         L  A P+    
Sbjct: 128 LDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYD--- 184

Query: 172 KASFTEEDAEQSSPVWTAPNLEPNDQLKLAL-LPEVIPTPIYPESGRKTSSPV------- 223
             S   E  + S+P+WTAP+L PNDQLKLAL  PE+    +  +   KT   +       
Sbjct: 185 --SLPME-LDDSTPLWTAPSLNPNDQLKLALEQPELT---LDEQLSDKTQHNLIDDKYNN 238

Query: 224 ----RPSVLLEDVPYNCYDGGASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKE 279
                P  +   V    ++       + P      VDRS THRKDSYHS+YM        
Sbjct: 239 FTIPLPHQIPLPVKVTDFNHDKKIQKIYP------VDRSETHRKDSYHSVYM-------- 284

Query: 280 DNDDLL-----NVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRS 334
           DND+       N E + +IQ+L+ LQKQ++IT PELFSILS+   ++ ILLI L +P R+
Sbjct: 285 DNDNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERT 344

Query: 335 EINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKT 394
           + N+IVA N + IDPN+LWD + N P+ +D  LE +L + ++F  R  F YVVYYTD+KT
Sbjct: 345 KSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILND-QLFNIRKSFAYVVYYTDLKT 403

Query: 395 FMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYR 453
           +M +NFDY F  FYL+ +S+ + L + PT+LLGG EKWKK + TY  E  ++  +YL++
Sbjct: 404 YMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  313 bits (802), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 175/483 (36%), Positives = 267/483 (55%), Gaps = 46/483 (9%)

Query: 581  RAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP 640
            + Y +P I  +      LS+ G+RN+GNTCY+NSM+QCLF +  FR LF++  ++ +   
Sbjct: 193  KQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMF--- 249

Query: 641  PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFL 700
             K   ++ S  ++N L++LF KMY NGGC+++P  F++   +LRPD KIP  QQDTQEFL
Sbjct: 250  -KAETNSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFL 308

Query: 701  MILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760
            M +L+RL  EL+N      D   +   + +     N  Y  W+++ +  N +SPID +F+
Sbjct: 309  MFVLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFR 368

Query: 761  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
            G +E+ L CK C  +   +S+FY+LSL IP+   K S   +S  K ++LEDCIN+FT  E
Sbjct: 369  GDVESKLICKHCNESASTFSSFYILSLNIPKE--KSSLFFKS--KTIRLEDCINLFTRKE 424

Query: 821  VLSGENAWDCPRCGPTXXXXXXXXXXXXXXXXXPIAKSKKKKSRFFTLHTGSKRRHLDFF 880
            +L+GEN+W CP C                     I K   K  RFF+ H  + +   +  
Sbjct: 425  ILTGENSWACPSCETKARYNVIDNDKTYQQKHTNIGK-HSKFPRFFS-HIEAGKTERNSG 482

Query: 881  GDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFAXXXXXXXXXXXXXXXXLTT 940
             +  ++    N    +R R +          K+S                         T
Sbjct: 483  ANKFSQLKYDNLENEQRHRQQ----------KKSE------------------------T 508

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTG 1000
            + +++FV+LP ILVIHLSRF YD++KKN++ I+YP+ L +   +N ++ YRL+G +NH G
Sbjct: 509  ILSVSFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVETLDNSSVTYRLYGTINHIG 568

Query: 1001 TLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV--KADNKHGSDKNLKISSSDVYVLFY 1058
            +   GHYT+LVNK+  H  D+   KW  FDD++V  + D      +   I+++D YVLFY
Sbjct: 569  SPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLVFNRTDFFKSKTEINSITNNDAYVLFY 628

Query: 1059 ERV 1061
            ER+
Sbjct: 629  ERI 631

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 70  FIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMY 104
           +  GC+Y++L++P + QFQ  +  Y  Y  LK  Y
Sbjct: 67  YAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNY 101

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score =  261 bits (666), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 134/265 (50%), Positives = 173/265 (65%), Gaps = 21/265 (7%)

Query: 574 LLQPQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFIS-A 632
           L +P   + + +P I+ + N+   LS+ GLRN GNTCYINSM+QCLF  K+ R LFIS  
Sbjct: 211 LARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEX 270

Query: 633 NYKNYLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD 692
            YK+++      +    +K+S     L   MY NGG SV+P  FL+  + LRPDL IP D
Sbjct: 271 XYKDFI------KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKD 324

Query: 693 QQDTQEFLMILLDRLHDELS-NQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNG 751
           QQDTQEFL+ILLD LHDEL      ++N+Y       +D + +   EY  W   N+  NG
Sbjct: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYV------SDDINLGK-EYMPWLQNNLKANG 377

Query: 752 ISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLED 811
            SPID IFQGQ+EN LQC+RCG T++NYS FY+LSLAIP+ + + SK       RVKLED
Sbjct: 378 KSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSK------NRVKLED 431

Query: 812 CINMFTDDEVLSGENAWDCPRCGPT 836
           CIN FT DE+L+GENAW+CP+C PT
Sbjct: 432 CINFFTSDEILTGENAWNCPKCCPT 456

 Score =  154 bits (388), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 11/135 (8%)

Query: 938  LTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNN-ETMKYRLFGVV 996
            L T+K +NF+ LP ILVIHLSRFYY+ TKKN+ VITYPLILNII+KNN + +KY+L+G++
Sbjct: 523  LITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLI 582

Query: 997  NHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS---------DKNLK 1047
            NH G L  GHYTS+VNKDL HS+D+   +WY FDDEV+K  N + +         +K+ +
Sbjct: 583  NHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKD-E 641

Query: 1048 ISSSDVYVLFYERVH 1062
              SS VYVLFYER+ 
Sbjct: 642  FDSSKVYVLFYERIE 656

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 84/163 (51%), Gaps = 6/163 (3%)

Query: 7   LFTPEYSNELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXXXXXXXXXXXDSMRH-NRPND 65
           +F+    ++L   V  ++  DIK YY +                         H +R   
Sbjct: 21  IFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQ 80

Query: 66  ALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVL 125
           A  AF+ G +Y+FLIIP  +QFQT+NK ++ Y DLK  YE +++M N++  VK++   +L
Sbjct: 81  ATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSIL 140

Query: 126 DESVKHAVGIEHRITKKRAFSVPA--NDLSGQVASLSLENAGP 166
           ++ +    GI  RI KKRA++ P+  + LS   +S S+ +  P
Sbjct: 141 EQDLS---GINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKP 180

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 119/249 (47%), Gaps = 41/249 (16%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLNML 659
           GL N+GN+CY+N +IQCL ++  F  +F++ +Y+ +  L+   GS+      L+ +   L
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGV----LARNFARL 664

Query: 660 FNKMYLNGG--------CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
            N MY  G           V P  F      +    +  D QQD+QEF   LLD LH++L
Sbjct: 665 INTMYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHEDL 723

Query: 712 SNQQHVANDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQME 764
           +  Q  AN     L  NA+ ++        S+ E++ +     +    S I D FQGQ  
Sbjct: 724 N--QCGANPPLKELSPNAEKMREKLSLRIASSIEWERY-----LTTDFSVIVDQFQGQYA 776

Query: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824
           + L+CK CG T+  Y  F VLS+ +PR        G+S      + DC N FT  E L  
Sbjct: 777 SQLRCKVCGGTSTTYQAFSVLSVPVPR--------GKS----CNIIDCFNEFTKVENLET 824

Query: 825 ENAWDCPRC 833
           +  W CP C
Sbjct: 825 DELWACPHC 833

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 65/144 (45%), Gaps = 35/144 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII----------LKNNET-- 987
            + K +    LP+ L+IHL RF  ++  KN+  + YP +L++           L    T  
Sbjct: 839  STKKLTITRLPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGVTEE 897

Query: 988  ---------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                       Y+L  V  H G+L  GHYTS V+K        G+  W YFDD  ++   
Sbjct: 898  LPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDDTKIRP-- 947

Query: 1039 KHGSDKNLKISSSDVYVLFYERVH 1062
                  + +  +S+ YVLFY RV+
Sbjct: 948  ---LKNSYECITSNAYVLFYHRVY 968

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 278 KEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEIN 337
           K+ N +L+N E        ++    S I+A +L  ++   I  + +L+ID+R     E +
Sbjct: 163 KDINKELINTEL------FNLPLSGSGISAIQLNHLIQ--IYNDTLLVIDVRPRMEFEES 214

Query: 338 HIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDV 392
           HI   N++ I+P    +  T+  + +  ++    +E + F  +D F Y+V  TD 
Sbjct: 215 HIKCKNIICIEPVSFNESFTDLELQKKSMITSPSDEVKTFAKKDTFNYIVICTDT 269

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  112 bits (279), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 123/269 (45%), Gaps = 44/269 (16%)

Query: 587 TIEQSSNVYV-SLSI---TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642
           TI QSSN Y   L +    GL N+GN+CY+N +IQCL        +F++ +Y+ ++    
Sbjct: 717 TISQSSNGYTPDLDLDFKVGLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHIN--I 774

Query: 643 GSRSAHSSKLSNSLNMLFNKMYLNGGCS-----------VVPTGFLKVVNQLRPDLKIPD 691
            S+      L+ S   L + MY NG  S           V P  F      +    K   
Sbjct: 775 NSKLGSKGILAKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFKTACGSINSLFK-GS 833

Query: 692 DQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALK-------VSNNEYKHWFD 744
           +QQD QEF   LLD LH++L+  Q  AN     L   A+ ++        S+ E++ +  
Sbjct: 834 NQQDCQEFCQFLLDGLHEDLN--QCGANPPLKELSTEAERMREKLSLRIASSIEWERF-- 889

Query: 745 KNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTE 804
              +    S I D++QGQ  + L+C+ CG T+  Y TF VLS+ +P+             
Sbjct: 890 ---LTTDFSVIIDLYQGQYASQLKCQVCGTTSTTYQTFSVLSVPVPK------------N 934

Query: 805 KRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           K + L DC N FT  E L  +  W C  C
Sbjct: 935 KSIHLLDCFNEFTKTEFLGKDELWSCTEC 963

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 69/139 (49%), Gaps = 34/139 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII----------LKNNET-- 987
            + KT+    LPK L+IHL RF  ++  KN+  + YPLIL++           L    T  
Sbjct: 969  STKTLTITRLPKNLIIHLKRFD-NMLHKNNVFVKYPLILDLTNYWANDFDGKLPPGVTEE 1027

Query: 988  ---------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                      KY L GV  H G+L  GHYT+ VNK L       ++ WYYFDD V ++  
Sbjct: 1028 LPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGL-------KNGWYYFDDTVYRSI- 1079

Query: 1039 KHGSDKNLKISSSDVYVLF 1057
            K+ S+    + + + YVLF
Sbjct: 1080 KYSSE----MITQNAYVLF 1094

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 294 QSLDILQKQ-SIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLL 352
           +++D+  K  S IT+  L +IL    + +  LLID+R     E+NHI + +++ I+P   
Sbjct: 168 KNIDVFPKTGSHITSSVLATILQ--TDPDSTLLIDVRTRHDFELNHIKSNSIICIEPISF 225

Query: 353 WDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTD 391
            +  ++  + +  ++     E EIF NR+ +++++ YTD
Sbjct: 226 KNNYSDVDIERKSLITSPNSEIEIFKNRENYKFIILYTD 264

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  110 bits (276), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/249 (30%), Positives = 117/249 (46%), Gaps = 35/249 (14%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLN 657
           + GL N+GN+CY+N +IQCL        +F+  +++ Y  L    GS+   +   S  ++
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 658 MLFN--KMYLNGG--CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713
            ++N  +   +GG    V P  F      +    K    QQD QEF   LLD LH++L+ 
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDLN- 736

Query: 714 QQHVANDYPNLLLYNADALK-------VSNNEYKHWF--DKNVIGNGISPIDDIFQGQME 764
            Q   N     L   A+ L+        S+ E++ +   D +VIG       D+FQGQ  
Sbjct: 737 -QCGGNKRLAELTEEAENLREKLSLRIASSIEWERFLTTDFSVIG-------DLFQGQYA 788

Query: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824
           + LQCK CG T+  Y  F VLS+ +P + +           +  + DC + FT  E L  
Sbjct: 789 SRLQCKTCGKTSTTYQPFSVLSIPVPSKHI----------SKCSIIDCFDEFTKVENLEV 838

Query: 825 ENAWDCPRC 833
           +  W CPRC
Sbjct: 839 DEQWSCPRC 847

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 33/143 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIIL----------------- 982
            + K +    LP+ L+IHL RF   L K N+ ++ YP  L++                   
Sbjct: 853  STKKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGKLPLNVSEL 911

Query: 983  ---KNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNK 1039
                      Y+L+GV  H G+L  GHYT+ V+K +++        WYYFDD   +    
Sbjct: 912  PTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIKNG-------WYYFDDTSCRP--- 961

Query: 1040 HGSDKNLKISSSDVYVLFYERVH 1062
                 +++  +S  YVLFY+R++
Sbjct: 962  --IKNSMEPITSSAYVLFYKRIY 982

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 52/119 (43%), Gaps = 3/119 (2%)

Query: 319 EREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFI 378
           +  ++L ID+R        H   PN++ I+P       ++  + +  ++    +E  +F 
Sbjct: 190 DSSQVLFIDVRTRLDFNKGHFKVPNIICIEPVSFKSSYSDHDLEKKSMITSTNDEIVLFH 249

Query: 379 NRDKFEYVVYY---TDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKK 434
            R +F ++V Y   TD K+ +        +   L+  S +  L++    L  G++ W K
Sbjct: 250 RRQEFAFIVLYSNDTDKKSGIVYKERKTLLANLLLNHSFEKPLSNRLYVLENGFDSWTK 308

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  107 bits (268), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 86/262 (32%), Positives = 119/262 (45%), Gaps = 39/262 (14%)

Query: 591 SSNVYVSLSI-TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSA 647
           SS V   L+I  GL NLGN+CY+N +IQCL   +    +F+  +YKN+  L    GS+  
Sbjct: 45  SSLVKRGLNINVGLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGV 104

Query: 648 HSSKLSNSL-NMLFNKMYLNGGCS--------VVPTGFLKVVNQLRPDLKIPDDQQDTQE 698
            +   S  + NM    +  +G  S        V P  F      +    K    QQD QE
Sbjct: 105 LAKYFSQLIHNMQQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKT-TSQQDCQE 163

Query: 699 FLMILLDRLHDELSNQQHVANDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNG 751
           F   LLD LH++L+  Q   N     L   A+A++        S+ E++ +   +     
Sbjct: 164 FCQFLLDGLHEDLN--QCGGNPALKELSEEAEAIREKLCMRIASSIEWERYLTTD----- 216

Query: 752 ISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLED 811
            S I D+FQGQ  + L CK CG T+  Y  F VLS+ +PR +            R  L D
Sbjct: 217 FSVIVDLFQGQYASQLMCKVCGRTSTTYQPFSVLSVPVPRGA------------RCNLLD 264

Query: 812 CINMFTDDEVLSGENAWDCPRC 833
           C   FT  E L  +  W CPRC
Sbjct: 265 CFEEFTKIETLEKDEQWSCPRC 286

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 65/141 (46%), Gaps = 33/141 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI------------------I 981
            + K I    LP+ L+IHL RF  +L  KN+  ++YP  L++                  +
Sbjct: 292  STKKITITRLPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGVAEL 350

Query: 982  LKNNET--MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNK 1039
                +T    Y L+ V  H GTL  GHYT+ VNK+        ++ W YFDD   +   K
Sbjct: 351  PTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCYFDDTCWR---K 400

Query: 1040 HGSDKNLKISSSDVYVLFYER 1060
              S+     +S+  YVLFY R
Sbjct: 401  AKSEDECITTSA--YVLFYHR 419

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 114/250 (45%), Gaps = 41/250 (16%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL N GN+CY++ +IQCL   +   T+F++ +Y+N++     SR      L+   + L +
Sbjct: 489 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHIN--LNSRLGSKGLLARYFSQLIH 546

Query: 662 KMYLNG----------GCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
           +MY  G            +V+PT F      +    K  + QQD QEF   LLD LH++L
Sbjct: 547 QMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDL 605

Query: 712 SNQQHVANDYP-NLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQM 763
           +      N+ P   L   A+ ++        S  E++ +   +      S I D+FQGQ 
Sbjct: 606 N---QCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTD-----FSVIVDLFQGQY 657

Query: 764 ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLS 823
            + LQCK C  T+  Y  F VLS+ +P            + +   L DC   FT  E L 
Sbjct: 658 ASQLQCKVCQRTSTTYQPFSVLSVPVP------------STRTCTLTDCFTEFTKIETLE 705

Query: 824 GENAWDCPRC 833
            E  W CP C
Sbjct: 706 QEEQWSCPSC 715

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 28/112 (25%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI-----------ILKNNETM 988
            + K I    LP+ L+IHL RF  ++  KN+  ++YP +L++           +  NN  +
Sbjct: 721  STKKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVEL 779

Query: 989  ---------KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDD 1031
                      Y+L+G+  H GTL +GHYT+ VNK       +G   W Y+DD
Sbjct: 780  PSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNK----GAVLG---WCYYDD 824

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 305 ITAPELFSILSNSIEREKILLIDLRIPRRSEIN-HIVAPNLVKIDPNLLWDRKTNTPVYQ 363
           I A  L ++L        +LL+D+R PR   +  HI + +++ I+P    +  T+  + +
Sbjct: 158 IPATLLRNLLMGPSASGTVLLVDVR-PRLDFMRCHIKSSSIICIEPVSFKESYTDIDLGK 216

Query: 364 DDILEHLLEENEIFINRDKFEYVVYYT 390
             ++     E  +F +RDKF+Y+V YT
Sbjct: 217 KSMITSPDAEIALFQDRDKFDYIVVYT 243

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 124/272 (45%), Gaps = 37/272 (13%)

Query: 577 PQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKN 636
           PQ   + +  TI  +S V     I GL N+GN CY+N ++QCL        +F+   Y N
Sbjct: 422 PQQNLSSSRQTILNNSQVLDLDLIVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLN 481

Query: 637 YLQ--PPKGSRSAHSSKLSNSLNMLFNKMYLNGGCS--------VVPTGFLKVVNQLRPD 686
           ++     +GS+      L+ +  +L N M+ +G  +        V    F K+   + P 
Sbjct: 482 FINFDSSRGSKGL----LAKNFAILVNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINP- 536

Query: 687 LKIPDDQQDTQEFLMILLDRLHDEL---SNQQHVA--NDYPNLLLYNADALKVSNNEYKH 741
           +     QQD QEF   LLD LH++L    +++H+   +D    +       K S  E++ 
Sbjct: 537 MYSDSMQQDCQEFCQFLLDGLHEDLNQNGSKKHLKQLSDEEERMREKMSIRKASALEWER 596

Query: 742 WFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGR 801
           +     +    S I D+FQGQ  + LQC+ C +T+  Y TF VLS+ +PR          
Sbjct: 597 F-----LLTDFSAIIDLFQGQYASRLQCQVCEHTSTTYQTFSVLSVPVPR---------- 641

Query: 802 STEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
              K   + DC   FT  E L  +  W CP+C
Sbjct: 642 --VKTCNILDCFREFTKCERLGVDEQWSCPKC 671

 Score = 61.6 bits (148), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 66/141 (46%), Gaps = 32/141 (22%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILK-----NNETM------ 988
            + K +    LPK L+I+L RF   + K N+  + YP  L++        N+E +      
Sbjct: 677  STKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWARDFNHEAIVNEDIP 735

Query: 989  --------KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH 1040
                    +YRL+GV  H+G+L  GHYTS V K         +  WY+FDD + +     
Sbjct: 736  TRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSLYRPIT-- 786

Query: 1041 GSDKNLKISSSDVYVLFYERV 1061
                + +  +   YVLFYER+
Sbjct: 787  ---FSTEFITPSAYVLFYERI 804

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 8/124 (6%)

Query: 321 EKILLIDLRIPRRSEIN-HIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFIN 379
           + +LLID+R PR   +  HI   N++ IDP    D  T+  +    ++     +   F N
Sbjct: 161 DALLLIDVR-PRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESVSLITSPHSDITFFSN 219

Query: 380 RDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTA----LLGGYEKWKKT 435
           RDKF++++ YTD +  ++ NF          + SQ + +  +       L  G+  W K 
Sbjct: 220 RDKFKFIILYTDTQ--LHNNFQQRQTRILAKILSQNSVIKPLSGTKILILENGFSNWVKL 277

Query: 436 LHTY 439
              Y
Sbjct: 278 GGAY 281

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  107 bits (267), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 125/253 (49%), Gaps = 39/253 (15%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLN 657
           I GL+N+GN+CY+N +IQCL        +F++ +++ Y  L    GS+   +  LS  ++
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 658 MLFNKMYL--NGGCSVVPTG--FLKVVNQLRPDLKIPDD------QQDTQEFLMILLDRL 707
           +++N   L  NG  +   +G  F+K + Q R      ++      QQD QEF   LLD L
Sbjct: 806 LMYNHSTLKNNGDKTKKKSGNNFIKPI-QFRMACGSINNLFKNCSQQDCQEFCQFLLDAL 864

Query: 708 HDELSNQQHVANDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQ 760
           H++L+  Q  +N     L   A++++        S+ E++ +     +    S I D+FQ
Sbjct: 865 HEDLN--QCGSNPPLKELSTKAESMREKLSLRIASSIEWERY-----LTTDFSVIVDLFQ 917

Query: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
           GQ  + LQCK C +T+  Y  F VLS+ IP++            K + L DC   FT  E
Sbjct: 918 GQYASRLQCKTCIHTSTTYQPFSVLSVPIPKK------------KNLNLLDCFKDFTKIE 965

Query: 821 VLSGENAWDCPRC 833
            L  +  W CP C
Sbjct: 966 NLEVDEQWFCPNC 978

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 68/144 (47%), Gaps = 34/144 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI------------------- 980
            + K +    LP+ L+IHL RF  +L K  + +I YP IL++                   
Sbjct: 984  STKKLTITRLPRNLIIHLKRFDNNLNKN-NNLIDYPFILDLTQFWADDFDGELPPGVTDE 1042

Query: 981  ILKNNET--MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
            + K  +    KYRL+G   H G+L  GHYT+ VNK +       R+ WYYFDD      N
Sbjct: 1043 LPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKGI-------RNGWYYFDDT-----N 1090

Query: 1039 KHGSDKNLKISSSDVYVLFYERVH 1062
                    +  SS+ YVLFY R++
Sbjct: 1091 YRPIKNEREPISSNAYVLFYHRIY 1114

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 114/242 (47%), Gaps = 27/242 (11%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ--PPKGSRSAHSSKLSNSLNML 659
           GL NLGN+CY+N +IQC+        +F+  +Y  ++      GS+   +   +  ++M+
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 622

Query: 660 FNKMY-LNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
           + +    +   S+ P  F      +    K    QQD QEF   LLD LH++L+  Q  +
Sbjct: 623 YKEQVDASKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLN--QCGS 679

Query: 719 NDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 771
           N     L   A+A +        S+ E++ +     +    S I D+FQGQ  + L+CK 
Sbjct: 680 NPPLKELSQEAEARREKLSLRIASSIEWERF-----LTTDFSVIVDLFQGQYASRLKCKI 734

Query: 772 CGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCP 831
           CG+T+  Y  F VLS+ IPR         +  +  + +EDC   FT  E L  +  W CP
Sbjct: 735 CGHTSTTYQPFTVLSIPIPR---------KVPQNEITIEDCFKEFTKCENLEVDEQWLCP 785

Query: 832 RC 833
            C
Sbjct: 786 HC 787

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 71/145 (48%), Gaps = 35/145 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII--------------LKNN 985
            + K +    LP+ L+IHL RF  +L  KN+  + YP +L++               + ++
Sbjct: 793  STKQLTVTRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDD 851

Query: 986  ET--------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1037
            E          KY L+GV  H GTL  GHYT+ V K L       R  W YFDD   K  
Sbjct: 852  ELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------RKGWLYFDDTKFKPV 904

Query: 1038 NKHGSDKNLKISSSDVYVLFYERVH 1062
             K+ +D    +++S+ YVLFY RV+
Sbjct: 905  -KNKTD----VTNSNAYVLFYHRVY 924

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 119/252 (47%), Gaps = 34/252 (13%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNML 659
           I GL N+GN+CY+N +IQC+        +F++ +Y+ ++     SR      L+ +   L
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHIN--LSSRLGSKGVLAKNFARL 661

Query: 660 FNKMYLNGGCSVVPTGFLKVVNQLRP-----------DLKIPDDQQDTQEFLMILLDRLH 708
            + MY++   S +     K +  ++P            L     QQD+QEF   LLD LH
Sbjct: 662 IHTMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFRDSQQQDSQEFCQFLLDGLH 721

Query: 709 DELSNQQHVANDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQG 761
           ++L+  Q   N     L   A+ L+        S+ E++ +   +      S I D+FQG
Sbjct: 722 EDLN--QCGGNPPLKELSLEAERLRENLSLRIASSIEWERYLTTD-----FSVIVDLFQG 774

Query: 762 QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEV 821
           Q  + L+CK C +T+  Y +F VLS+ +P+      K    T K + L DC N FT  E 
Sbjct: 775 QYASRLECKVCHHTSTTYQSFSVLSVPLPK------KFDPQTRK-IDLIDCFNEFTKIEN 827

Query: 822 LSGENAWDCPRC 833
           L  +  W CP C
Sbjct: 828 LEVDEQWSCPTC 839

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 70/144 (48%), Gaps = 34/144 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII--------------LKNN 985
            + K +    LP+ L+IHL RF  ++  KN++ I YP  L++               + N 
Sbjct: 845  STKKLTITRLPRNLIIHLKRFD-NMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPGVSNE 903

Query: 986  -------ETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                   +   YRL+GV  H G+L  GHYT+ V+K + +        WYYFDD   +   
Sbjct: 904  LPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-------WYYFDDTTYRP-- 954

Query: 1039 KHGSDKNLKISSSDVYVLFYERVH 1062
               +DK   ISSS  YVLFY RV+
Sbjct: 955  -LKNDKE-PISSS-AYVLFYTRVY 975

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 57/105 (54%), Gaps = 6/105 (5%)

Query: 290 DEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEI--NHIVAPNLVKI 347
           ++ I++L +    S I+  +L  ++ N    + +L+ID+R   RSE   +HI + N++ I
Sbjct: 171 NDIIKNLHLPSNGSFISTIQLNELMRNF--NDSLLIIDIR--SRSEFIKSHIKSKNIICI 226

Query: 348 DPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDV 392
           +P    D  ++  + +  I+     E  +F NR  F+++V YT++
Sbjct: 227 EPISFKDSYSDYELERKSIITSPNNEIRLFNNRQSFKFIVLYTEI 271

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 110/252 (43%), Gaps = 44/252 (17%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL NLGN+CY+N +IQCL        +F++ +Y+ ++     SR      L+N  + L  
Sbjct: 433 GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNV--NSRLGSKGLLANYFSQLVQ 490

Query: 662 KMYLNG-----------GCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDE 710
           KMY  G             +V PT F      +    K    QQD QEF   LLD LH++
Sbjct: 491 KMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFK-GKQQQDCQEFCQFLLDGLHED 549

Query: 711 LSNQQHVANDYPNLLLYNADALKV---------SNNEYKHWFDKNVIGNGISPIDDIFQG 761
           L+         P L   + +A K+         S  E++ +   +      S I D+FQG
Sbjct: 550 LNQ----CGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTD-----FSVIVDLFQG 600

Query: 762 QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEV 821
           Q  + L+CK C +T+  Y  F VLS+ +PR             +   + DC   FT  E 
Sbjct: 601 QYASQLRCKICAHTSTTYQAFSVLSVPVPR------------ARSCTIYDCFKEFTKLET 648

Query: 822 LSGENAWDCPRC 833
           L  +  W CP C
Sbjct: 649 LEKDELWYCPYC 660

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 66/144 (45%), Gaps = 35/144 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI-----------ILKNNET- 987
            + K I    LP  L+IHL RF  ++  KN+  + YP  L++           + K+N   
Sbjct: 666  STKQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVS 724

Query: 988  ---------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                       YRLF V +H+GTL  GHYTS V+K        GR  W  FDD  V    
Sbjct: 725  LPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDD--VSWRK 774

Query: 1039 KHGSDKNLKISSSDVYVLFYERVH 1062
                D+ +   + + YVLFY RV+
Sbjct: 775  IRRKDEYI---TPNAYVLFYRRVN 795

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%)

Query: 305 ITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQD 364
           ++  +L S++ +  +   ILL+D+R        HI   N++ I+P    +  T++ + + 
Sbjct: 156 VSISQLHSLIRHDNDSSGILLVDIRPRMDFNDGHIKHNNVICIEPISFKESYTDSDILRK 215

Query: 365 DILEHLLEENEIFINRDKFEYVVYYTDV 392
            ++     E ++F NRDKF  +V YTD 
Sbjct: 216 SLITASDREVDLFKNRDKFRLIVLYTDT 243

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/249 (30%), Positives = 114/249 (45%), Gaps = 41/249 (16%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL N+GN+CY+N +IQCL +      +F++ +Y+ ++     S+      L+     L +
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHIN--LNSKLGSKGVLAKYFARLVH 577

Query: 662 KMYLNGGCS--------VVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713
            MY  G           + P  F      +    K  + QQD+QEF   LLD LH++L+ 
Sbjct: 578 TMYREGSFKRPLEKNKPIQPIQFKMACGSINSLFK-DNTQQDSQEFCQFLLDGLHEDLN- 635

Query: 714 QQHVANDYPNLLLYNADALKV---------SNNEYKHWFDKNVIGNGISPIDDIFQGQME 764
            Q  AN  P L   + DA K+         S+ E++ +   +      S I D+FQGQ  
Sbjct: 636 -QCGAN--PPLKELSEDAEKMREKLSMRIASSIEWERFLTTD-----FSVIVDLFQGQYA 687

Query: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824
           + L+CK CG T+  Y TF VLS+ +P  S               + DC N FT  E L  
Sbjct: 688 SQLKCKVCGCTSTTYQTFSVLSVPVPHVS------------SCHILDCFNEFTKVEKLGT 735

Query: 825 ENAWDCPRC 833
           +  W CP C
Sbjct: 736 DELWSCPTC 744

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 64/144 (44%), Gaps = 34/144 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII----------LKNNET-- 987
            + K +    LP+ L+IHL RF  ++  KN+  + YP +L++           L    T  
Sbjct: 750  STKKLTITRLPRNLIIHLKRF-DNMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPGVTDE 808

Query: 988  ---------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                      +Y+L  V +H G+L  GHYT+ VNK +          W+YFDD   +   
Sbjct: 809  LPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINRG-------WHYFDDTSYRPIK 861

Query: 1039 KHGSDKNLKISSSDVYVLFYERVH 1062
                    +  + + YVLFY RV+
Sbjct: 862  NET-----ECITPNAYVLFYHRVY 880

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 323 ILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDK 382
           +LLID+R     +  HI A +++ ++P    +  T+  V +  ++    +E  +F  RDK
Sbjct: 186 LLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEKKSLITSPQKEIALFQARDK 245

Query: 383 FEYVVYYTDV--KTFMYMNFDYVFI 405
           + Y+V YT    KT  YM+   V +
Sbjct: 246 YNYIVIYTQQSEKTQFYMHQQLVLL 270

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  105 bits (262), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 116/242 (47%), Gaps = 27/242 (11%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ--PPKGSRSAHSSKLSNSLNML 659
           GL NLGN+CY+N +IQC+        +F+  +Y  ++      GS+   +   +  ++M+
Sbjct: 566 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 625

Query: 660 FNKMYLNGG-CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
           + +   +    S+ P  F      +    K    QQD QEF   LLD LH++L+  Q  +
Sbjct: 626 YKEQVDSSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLN--QCGS 682

Query: 719 NDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 771
           N     L   A+A +        S+ E++ +     +    S I D+FQGQ  + L+CK 
Sbjct: 683 NPPLKELSQEAEARREKLSLRIASSIEWERF-----LTTDFSVIVDLFQGQYASRLRCKV 737

Query: 772 CGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCP 831
           C +T+  Y  F VLS+ IP+         ++++ ++ +EDC   FT  E L  E  W CP
Sbjct: 738 CNHTSTTYQPFTVLSIPIPK---------KNSQNKITIEDCFKEFTKCENLEVEEQWLCP 788

Query: 832 RC 833
            C
Sbjct: 789 HC 790

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 64/145 (44%), Gaps = 35/145 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII--------------LKNN 985
            + K +    LP+ L++HL RF  +   KN+  + YP +L++               + ++
Sbjct: 796  STKQLTVTRLPRNLIVHLKRFD-NFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDD 854

Query: 986  ET--------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1037
            E          KY L+GV  H GTL  GHYT+ V K L       +  W YFDD   K  
Sbjct: 855  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPV 907

Query: 1038 NKHGSDKNLKISSSDVYVLFYERVH 1062
                   N     S+ YVLFY RV+
Sbjct: 908  KNQTDAIN-----SNAYVLFYHRVY 927

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 294 QSLDILQKQSIITAPEL----FSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDP 349
           +   ++   SIIT   L    FS  +++  + + LLID+R       +HI + N++ ++P
Sbjct: 176 EECSMMGTGSIITPSHLNSLIFSSTNSTSSQMETLLIDIRSRLEFNKSHIDSKNIICLEP 235

Query: 350 NLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTD 391
                  ++  + +  ++    +E ++F +R+ F+++V YTD
Sbjct: 236 ISFKMSYSDHDLERKSLITSPNDEIKLFQSRNLFKFIVLYTD 277

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 112/257 (43%), Gaps = 36/257 (14%)

Query: 591 SSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSS 650
           S+N Y      GL N+GN+CYIN ++QCL        +F++ +Y+ ++     SR     
Sbjct: 453 SANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHIN--MNSRLGSKG 510

Query: 651 KLSNSLNMLFNKMYLNG-------GCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
            L+     L + MY N        G  V P  F      +   L     QQD QEF   L
Sbjct: 511 VLAKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTIN-SLFRESGQQDCQEFCQFL 569

Query: 704 LDRLHDELSNQQHVANDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPID 756
           LD LH++L+  Q   N     L   A+ ++        S+ E++ +   +      S I 
Sbjct: 570 LDGLHEDLN--QCGGNPPLKELSDEAEKMREKLSLRIASSIEWERFLTTD-----FSVIV 622

Query: 757 DIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMF 816
           D+FQGQ  + L+C+ CG T+  Y  F VLS+ +P              K   + DC   F
Sbjct: 623 DLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVPH------------AKSCNIIDCFKEF 670

Query: 817 TDDEVLSGENAWDCPRC 833
           T  E L  +  W CPRC
Sbjct: 671 TKVEKLETDEQWSCPRC 687

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 62/144 (43%), Gaps = 34/144 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII------------------ 981
            + K +    LP+ L+IHL RF  ++  KN+  + YP  L++                   
Sbjct: 693  STKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPGVTEE 751

Query: 982  ---LKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                  +    Y+L+G+ +H G+L  GHYTS V+K         +  W YFDD   +   
Sbjct: 752  LPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKG-------PKRGWCYFDDTSFRP-- 802

Query: 1039 KHGSDKNLKISSSDVYVLFYERVH 1062
                    +  + + YVLFY RV+
Sbjct: 803  ---VRNATECITPNAYVLFYHRVY 823

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 298 ILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEIN--HIVAPNLVKIDPNLLWDR 355
           +L   S I++  L  ++ +    +  LLIDLR  +R E +  HI A N++ I+P     +
Sbjct: 155 VLNTGSTISSSHLQQLIDS--HNDSTLLIDLR--QRGEFSKLHINAKNVICIEPISFKAQ 210

Query: 356 KTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYT 390
            T+  + +  ++    EE  +F  RD F+++V YT
Sbjct: 211 YTDLEIEKKSLITSPKEEIGLFRARDTFKFIVLYT 245

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 117/253 (46%), Gaps = 47/253 (18%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL N GN+CY++ +IQCL   +   T+F++ +Y+N++     SR      L+   + L +
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHIN--LNSRLGSKGVLARYFSQLIH 544

Query: 662 KMYLNGG----------CSVVPTGF---LKVVNQLRPDLKIPDDQQDTQEFLMILLDRLH 708
           +MY  G            +V+P  F      +N L  D      QQD QEF   LLD LH
Sbjct: 545 QMYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFRD----RSQQDCQEFCQFLLDGLH 600

Query: 709 DELSNQQHVANDYP-NLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQ 760
           ++L+      N+ P   L   A+ ++        S+ E++ +   +      S I D+FQ
Sbjct: 601 EDLN---QCGNNPPLKELSEKAEKMREMMPMRIASSIEWERYLTTD-----FSVIVDLFQ 652

Query: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
           GQ  + L+CK CG T+  Y  F VLS+ +P            + ++  + DC   FT  E
Sbjct: 653 GQYASQLRCKVCGRTSTTYQPFSVLSVPVP------------SSRQCTIIDCFTEFTKVE 700

Query: 821 VLSGENAWDCPRC 833
            L  +  W CP C
Sbjct: 701 TLDLDEQWSCPDC 713

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 71/147 (48%), Gaps = 40/147 (27%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI-----------ILKNNET- 987
            + K I    LP+ L+IHL RF  ++  KN+  ++Y  +LN+           ++ NN   
Sbjct: 719  STKKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVE 777

Query: 988  ---------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDD---EVVK 1035
                       Y+L+GV  HTGTL  GHYT+ VNK       +G   W Y+DD     ++
Sbjct: 778  LPSRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNK----GATLG---WCYYDDTNWRQIR 830

Query: 1036 ADNKHGSDKNLKISSSDVYVLFYERVH 1062
            + N++         S + YVLFY R+H
Sbjct: 831  SSNEY--------ISQNAYVLFYHRIH 849

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 4/137 (2%)

Query: 299 LQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEIN-HIVAPNLVKIDPNLLWDRKT 357
           ++  S I++  L ++++       +LLID+R PR   +N HI   +L+ I+P    D  +
Sbjct: 153 VENGSSISSLMLHNLITTPATATSVLLIDIR-PRVDFVNFHIKFESLICIEPVSFKDSHS 211

Query: 358 NTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDV--KTFMYMNFDYVFIFFYLMLTSQK 415
           +  + +  ++     E  +F  RDKFEY++ YT    K    ++   V +   +  + QK
Sbjct: 212 DIDIAKKSMITSPDNEIALFQERDKFEYIILYTQGSEKNDYNIHQQEVLVDLLINRSFQK 271

Query: 416 THLTSVPTALLGGYEKW 432
           +   +    L GG+  W
Sbjct: 272 SLYNTKILTLDGGFSSW 288

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  103 bits (258), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 117/241 (48%), Gaps = 25/241 (10%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ--PPKGSRSAHSSKLSNSLNML 659
           GL NLGN+CY+N +IQC+        +F+  +Y  ++      GS+   +   +  ++M+
Sbjct: 564 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 623

Query: 660 FNKMYLNGGC-SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
           + K   +    S+ P  F      +    K    QQD QEF   LLD LH++L+  Q  +
Sbjct: 624 YKKQVDSSKKDSISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLN--QCGS 680

Query: 719 NDYPNLLLYNAD------ALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
           N     L   A+      +L+++++    W  +  +    S I D+FQGQ  + L+CK C
Sbjct: 681 NPPLKELSQEAETRRERLSLRIASS--IEW--ERFLTTDFSVIVDLFQGQYASRLKCKTC 736

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPR 832
            +T+  Y  F VLS+ IP+         ++++ ++ +EDC   FT  E L  +  W CP 
Sbjct: 737 NHTSTTYQPFTVLSIPIPK---------KNSQNKITIEDCFKEFTKCENLEIDEQWLCPH 787

Query: 833 C 833
           C
Sbjct: 788 C 788

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 64/145 (44%), Gaps = 35/145 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII--------------LKNN 985
            + K +    LP+ L+IHL RF  +L  KN+  + YP +L++               + ++
Sbjct: 794  STKQLTITRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDD 852

Query: 986  ET--------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1037
            E          KY L+GV  H GTL  GHYTS V K L          W YFDD   +  
Sbjct: 853  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGLSRG-------WLYFDDTKYRPA 905

Query: 1038 NKHGSDKNLKISSSDVYVLFYERVH 1062
                   N     S+ YVLFY RV+
Sbjct: 906  KNQTDAIN-----SNAYVLFYHRVY 925

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  103 bits (258), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 116/243 (47%), Gaps = 29/243 (11%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ--PPKGSRSAHSSKLSNSLNML 659
           GL NLGN+CY+N +IQC+        +F+  +Y  ++      GS+   +   +  ++M+
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 622

Query: 660 FNKMYLNGG--CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 717
           + K  ++G    S+ P  F      +    K    QQD QEF   LLD LH++L+  Q  
Sbjct: 623 Y-KEQVDGSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLN--QCG 678

Query: 718 ANDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCK 770
           +N     L   A+A +        S+ E++ +     +    S I D+FQGQ  + L+CK
Sbjct: 679 SNPPLKELSQEAEARREKLSLRIASSIEWERF-----LTTDFSVIVDLFQGQYASRLKCK 733

Query: 771 RCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDC 830
            C +T+  Y  F VLS+ IP+         +++   + +EDC   FT  E L  +  W C
Sbjct: 734 VCSHTSTTYQPFTVLSIPIPK---------KNSRNNITIEDCFREFTKCENLEVDEQWLC 784

Query: 831 PRC 833
           P C
Sbjct: 785 PHC 787

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 65/145 (44%), Gaps = 35/145 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII--------------LKNN 985
            + K +    LP+ L++HL RF  +L  KN+  + YP +L++               + ++
Sbjct: 793  STKQLTITRLPRNLIVHLKRFD-NLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPGVNDD 851

Query: 986  ET--------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1037
            E          KY L+GV  H GTL  GHYT+ V K L       +  W YFDD   K  
Sbjct: 852  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPV 904

Query: 1038 NKHGSDKNLKISSSDVYVLFYERVH 1062
                   N     S+ YVLFY RV+
Sbjct: 905  KNKADAIN-----SNAYVLFYHRVY 924

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  103 bits (257), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 111/248 (44%), Gaps = 36/248 (14%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLNML 659
           GL NLGN+CY+N +IQCL        +F+  +YKN+  L    GS+   +   S  ++ +
Sbjct: 496 GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHTM 555

Query: 660 FNKMY-----LNGG--CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
             +        N G   +V P  F KV       L     QQD QEF   LLD LH++L+
Sbjct: 556 QQQAASASTKQNSGDKTAVQPLHF-KVACGSINSLFRSSSQQDCQEFCQFLLDGLHEDLN 614

Query: 713 NQQHVANDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
             Q   N     L   A+ ++        S+ E++ +   +      S I D+FQGQ  +
Sbjct: 615 --QCGGNPALKELSEEAEGIREKLCMRIASSIEWERYLTTD-----FSVIVDLFQGQYAS 667

Query: 766 SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGE 825
            L CK CG T+  Y  F VLS+ +P  S            +  + DC   FT  E L  +
Sbjct: 668 QLTCKVCGRTSTTYQPFSVLSVPVPSGS------------KCDIIDCFKEFTKVETLEKD 715

Query: 826 NAWDCPRC 833
             W CPRC
Sbjct: 716 EQWSCPRC 723

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 61/144 (42%), Gaps = 33/144 (22%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI--ILKNN------------ 985
            + K I    LP+ LVIHL RF  +L  KN+  ++YP  L++     N+            
Sbjct: 729  STKKITITRLPRNLVIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGVAEL 787

Query: 986  ------ETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNK 1039
                      Y L+ V  H GTL  GHYTS V+K         ++ W YFDD   +    
Sbjct: 788  PTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDTSWRKAKS 840

Query: 1040 HGSDKNLKISSSDVYVLFYERVHD 1063
             G    L       YVLFY R ++
Sbjct: 841  QGECITL-----SAYVLFYHRKYN 859

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 62/130 (47%), Gaps = 6/130 (4%)

Query: 305 ITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQD 364
           I+  EL S+L      +  LLIDLR   +   +HI    ++ I+P    D  ++T + + 
Sbjct: 164 ISPSELQSLLG----AQNALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITRR 219

Query: 365 DILEHLLEENEIFINRDKFEYVVYYTDV--KTFMYMNFDYVFIFFYLMLTSQKTHLTSVP 422
            ++    EE ++F  RDKF+Y+V YTD   +T          +   +  + +K    ++ 
Sbjct: 220 SLITSPNEEVQLFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRTII 279

Query: 423 TALLGGYEKW 432
             L GG+E W
Sbjct: 280 LTLQGGFENW 289

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 116/268 (43%), Gaps = 42/268 (15%)

Query: 584 NIPTIEQSSNVYVSLSIT-GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642
           N P    S N  +  S T GL N+GN+CYIN +IQC+FA      +F++  Y  ++   K
Sbjct: 507 NSPEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHIN--K 564

Query: 643 GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPT--GFLKV---------VNQLRPDLKIPD 691
            S+      LS++   L   MY       +    G +K          VN L  D     
Sbjct: 565 QSKLGSKGVLSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDA---- 620

Query: 692 DQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNN------EYKHWFDK 745
            QQD  EF   LLD LH++L+  Q  AN  P L   + +A K+  N          W  +
Sbjct: 621 SQQDCLEFCQFLLDGLHEDLN--QCGAN--PPLKELSPEAEKMRENLSLRVASSIEW--E 674

Query: 746 NVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEK 805
             +    S I D+FQGQ  + L+CK C  T+  Y  F VLS+ +P            + K
Sbjct: 675 RYLTTDFSIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVP------------SGK 722

Query: 806 RVKLEDCINMFTDDEVLSGENAWDCPRC 833
              L DC   FT  E L  +  W CP C
Sbjct: 723 SCGLLDCFIEFTKTENLEVDEQWFCPSC 750

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 62/143 (43%), Gaps = 34/143 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI--ILKNNETMK-------- 989
            + K +    LP+ L+IHL RF  ++  KN+  + YP IL++     N+   K        
Sbjct: 756  STKKLTITRLPRNLIIHLKRFD-NMMNKNNIFVRYPQILDLTPFWANDSDGKLPPGITDE 814

Query: 990  -----------YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                       YRL+G   H GTL  GHYTS V+K  E         W YFDD V +   
Sbjct: 815  IPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGPEKG-------WIYFDDTVYRPVR 867

Query: 1039 KHGSDKNLKISSSDVYVLFYERV 1061
                    +  S   YVLFY R+
Sbjct: 868  FQN-----EFISPSAYVLFYHRI 885

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 62/116 (53%), Gaps = 5/116 (4%)

Query: 281 NDDLLNVETDEFIQSLDILQKQ---SIITAPELFSILSNSIEREKILLIDLRIPRRSEIN 337
           N D + ++ D  +Q +  +  +   S I+  EL S++   ++ + +LLID+R     + +
Sbjct: 163 NRDAIEIDKDSILQDIRYINGKRSGSGISCSELLSLMK--MKEDSLLLIDVRPKLEYDAH 220

Query: 338 HIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVK 393
           HI   N++ I+P    +  ++  + +  ++     E ++F  R +F+Y++ YTD++
Sbjct: 221 HIKTKNIICIEPISFKESYSDQQIEKTSMIPSPKHEIQLFQRRSEFQYIILYTDLE 276

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  100 bits (249), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 115/267 (43%), Gaps = 27/267 (10%)

Query: 577 PQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKN 636
           PQ   + +  TI  +S V     I GL N GN CY+N ++QCL        +F+   Y N
Sbjct: 422 PQQNSSSSRQTILNNSQVIDLDFIVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLN 481

Query: 637 YLQ--PPKGSRSAHSSKLSNSL-NMLFNKMYLNGGCSVVPTG---FLKVVNQLRPDLKIP 690
           ++     KGS+   +   +  + NM  N  ++       P     F K+   +   +   
Sbjct: 482 FINFDSSKGSKGLLAKNFATLVRNMHRNSAFMPVNSRTTPVQTIQFKKICGHIN-SIYSD 540

Query: 691 DDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLL----YNADALKVSNNEYKHWFDKN 746
             QQD QEF   LLD LH++L+  Q+   ++   L        + + +       W  + 
Sbjct: 541 SMQQDCQEFCQFLLDGLHEDLN--QNGGKEHLKQLTEEEEQKREKMTIRKASALEW--ER 596

Query: 747 VIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKR 806
            +    S I D+FQGQ  + LQC+ C  T+  Y TF VLS+ +PR +             
Sbjct: 597 FLLTDFSAIIDLFQGQYASRLQCQACDRTSTTYQTFSVLSVPVPRITT------------ 644

Query: 807 VKLEDCINMFTDDEVLSGENAWDCPRC 833
             + DC   FT  E L  +  W CPRC
Sbjct: 645 CNILDCFREFTKCEKLGIDELWSCPRC 671

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 67/141 (47%), Gaps = 32/141 (22%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILK-----NNETM------ 988
            + K +    LPK L+I+L RF   + K N+  + YP  L++        N+E +      
Sbjct: 677  STKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLDLTPYWARDFNHEAIVNEDIP 735

Query: 989  --------KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH 1040
                    +YRL+GV  H+G+L  GHYTS V K         +  WY+FDD + +     
Sbjct: 736  TRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSIYRPIR-- 786

Query: 1041 GSDKNLKISSSDVYVLFYERV 1061
                N +  + + YVLFYER+
Sbjct: 787  ---FNDEFITPNAYVLFYERI 804

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 305 ITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQD 364
           I A +L S+L      + +LLID+R        HI   N++ I+P    D  T+  +   
Sbjct: 147 IDAGKLSSMLH--FHGDTLLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQLENV 204

Query: 365 DILEHLLEENEIFINRDKFEYVVYYTDVK 393
            ++     + ++F NR+ F+Y+V YTD +
Sbjct: 205 SLITSSQSDIDLFSNRNMFKYIVLYTDAQ 233

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 99.0 bits (245), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 114/244 (46%), Gaps = 27/244 (11%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLN 657
           I GL+N+GN+CY+N +IQCL        +F++  Y+ +  L    GS+   +   +  ++
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 658 MLFN----KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713
           ++ N    K+  N    V P  F   V  +    K    QQD QEF   LLD LH++L+ 
Sbjct: 618 LMHNHANPKLKNN---YVRPAQFKMAVGSVNTLFK-NCSQQDCQEFCQFLLDGLHEDLN- 672

Query: 714 QQHVAN----DYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
            Q  +N    +  +    N + L +       W  +  +    S I D+FQGQ  + LQC
Sbjct: 673 -QCGSNPPLKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLQC 729

Query: 770 KRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWD 829
           + C +T+  Y  F VLS+ IPR    +         +V + DC   FT  E+L  +  W 
Sbjct: 730 EVCKHTSTTYQPFSVLSVPIPRVPKGV---------KVNILDCFKDFTKLELLDTDEQWL 780

Query: 830 CPRC 833
           CP C
Sbjct: 781 CPTC 784

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 72/145 (49%), Gaps = 34/145 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI------------------- 980
            + K +    LP+ L+IHL RF      KN+  I YP IL++                   
Sbjct: 790  STKKLTITRLPRNLIIHLKRFDN-NLNKNNNFIDYPFILDLTQFWVDDFDGKLPPGVRDE 848

Query: 981  ILKNNET--MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
            + K  +    KY+L+GV +H G+L  GHYT+ V+K  +H        WYYFDD     + 
Sbjct: 849  LPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFDD----TNY 897

Query: 1039 KHGSDKNLKISSSDVYVLFYERVHD 1063
            +   +KN  I+SS  Y+LFY R++D
Sbjct: 898  RSIKNKNEPITSS-AYLLFYHRIYD 921

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 58/112 (51%)

Query: 294 QSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLW 353
           Q L  ++  S+I++ +L  +L    +   +LLID+R       +HI    ++ ++P    
Sbjct: 154 QELFSMKNGSLISSYQLKQLLYGKNDNTSVLLIDIRPRLEFSKSHIKHEEIICVEPISFK 213

Query: 354 DRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFI 405
           D  ++  V +  ++    EE ++F  R++FE+++ YT+ K   Y N   VF+
Sbjct: 214 DSYSDEEVAKKSLITSPNEEIDLFNKRNEFEFIILYTNDKEKAYYNQQMVFL 265

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 98.6 bits (244), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 112/245 (45%), Gaps = 33/245 (13%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLNML 659
           GL N+GN+CY+N ++QC+        +F++ +Y+ +  +    GS+   +   +   +++
Sbjct: 584 GLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLAHIM 643

Query: 660 FNKMY--LNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 717
               Y        V PT F   +  +    +   +QQD QEF   LLD LH++L NQ   
Sbjct: 644 HQTSYDQEKKAAIVRPTQFRMAIASINSMFR-NTNQQDCQEFCQFLLDGLHEDL-NQ--- 698

Query: 718 ANDYPNLLLYNADALK---------VSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 768
             + P L   + +A K          S+ E++ +   N      S I D+FQGQ  + L+
Sbjct: 699 CGNNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTN-----FSVIIDLFQGQYASRLK 753

Query: 769 CKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAW 828
           C  C  T+  Y  F VLS+ +P            T+  V L DC N FT  E L  +  W
Sbjct: 754 CSVCSNTSTTYQPFSVLSVPLP----------TGTKSSVNLMDCFNEFTKCEKLEHDEYW 803

Query: 829 DCPRC 833
           +CP C
Sbjct: 804 NCPTC 808

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 68/145 (46%), Gaps = 35/145 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI--ILKNNET---------- 987
            + K +    LP+ L+IHL RF   + K N+ +I YP  L++     N++           
Sbjct: 814  STKQLTITRLPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKDDRLPPGVSID 872

Query: 988  ----------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1037
                       KY L+ V NH G+L  GHYTS VNK L          WYYFDD+     
Sbjct: 873  ELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLSRG-------WYYFDDQ----- 920

Query: 1038 NKHGSDKNLKISSSDVYVLFYERVH 1062
            N     K  ++ +S+ YVLFY RVH
Sbjct: 921  NYRLVKKTSEVVNSNAYVLFYRRVH 945

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 120/276 (43%), Gaps = 45/276 (16%)

Query: 577 PQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKN 636
           PQ     + P I+ S+ ++    I GL N+GN CY+N ++QCL        +F+   Y N
Sbjct: 405 PQQNLLVSKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLN 464

Query: 637 YLQ--PPKGSRSAHSSKLSNSLNMLFNKMYLNGG-----CSVVPTGFLKVVNQLRPDLKI 689
           ++     +GS+   +   +N    L + M+ +G        + P   ++          I
Sbjct: 465 FINFDNMRGSKGLLAKNFAN----LVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHINSI 520

Query: 690 PDD--QQDTQEFLMILLDRLHDEL---SNQQHVAN-------DYPNLLLYNADALKVSNN 737
             D  QQD QEF   LLD LH++L     ++H+            N+ +  A AL+    
Sbjct: 521 YSDSMQQDCQEFCQFLLDGLHEDLNQNGGKKHLKQLSEEEERTRENMSIRKASALE---- 576

Query: 738 EYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLS 797
               W  +  +    S + D+FQGQ  + LQC+ C +T+  Y TF VLS+ +P R M  +
Sbjct: 577 ----W--ERFLLTDFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVP-RIMTCN 629

Query: 798 KLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
            L           DC   FT  E L     W C RC
Sbjct: 630 VL-----------DCFREFTKCEKLGIGEQWSCSRC 654

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 67/141 (47%), Gaps = 32/141 (22%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILK-----NNETM------ 988
            + K +    LPK L+I+L RF   +  KN+  + YP  L++        N+E +      
Sbjct: 660  STKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWARDFNHEAIIDEDIP 718

Query: 989  --------KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH 1040
                    +YRL+GV  H+G+L  GHYTS V K  +         WY+FDD + +     
Sbjct: 719  TRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGPQKG-------WYFFDDTIYRLIR-- 769

Query: 1041 GSDKNLKISSSDVYVLFYERV 1061
                N +  + + YVLFYER+
Sbjct: 770  ---FNNEFITPNAYVLFYERI 787

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 321 EKILLIDLRIPRRSEIN-HIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFIN 379
           +  LL+D+R PR   I  HI   +++ IDP    D  T+T V +  +      E E+F  
Sbjct: 163 DAFLLVDVR-PRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVSLAASPQLEIELFSK 221

Query: 380 RDKFEYVVYYTDVK 393
           R+ F+ +V YTD +
Sbjct: 222 RNTFKNIVLYTDTQ 235

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 111/260 (42%), Gaps = 55/260 (21%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL NLGN+CY+N +IQCL        +F++ +YKN++     S+      L+   + L +
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHIN--FNSKLGSKGVLAKYFSQLVH 581

Query: 662 KMYLNGGC----------------SVVPTGF---LKVVNQLRPDLKIPDDQQDTQEFLMI 702
            MY                     +V P  F      +N L  D      QQD QEF   
Sbjct: 582 NMYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFRDC----SQQDCQEFCQF 637

Query: 703 LLDRLHDELSNQQHVANDYPNLLLYNADALKV---------SNNEYKHWFDKNVIGNGIS 753
           LLD LH++L+         P L   + +A K+         S+ E++ +   +      S
Sbjct: 638 LLDGLHEDLNQ----CGGNPRLKELSEEAEKIREKLSMRIASSIEWERYLTTD-----FS 688

Query: 754 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCI 813
            I D+FQGQ  + L+C+ CG T+  Y  F VLS+ +P            + K   + DC 
Sbjct: 689 VIVDLFQGQYASQLKCQVCGRTSTTYQPFSVLSVPLP------------SLKSCNILDCF 736

Query: 814 NMFTDDEVLSGENAWDCPRC 833
             FT  E L  +  W CP C
Sbjct: 737 QEFTKVETLEKDEQWSCPDC 756

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 67/143 (46%), Gaps = 33/143 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI--ILKNN------------ 985
            + K I    LP+ L+IHL RF  ++  KN+  ++YP  L++     N+            
Sbjct: 762  STKKITITRLPRNLIIHLKRFD-NMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPGVTEL 820

Query: 986  ------ETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNK 1039
                      Y+L+ V +HTGTL  GHYT+ V+K  +         W YFDD      N 
Sbjct: 821  PTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKGSQRG-------WCYFDDT-----NW 868

Query: 1040 HGSDKNLKISSSDVYVLFYERVH 1062
              S  + +  +S+ YVLFY RV+
Sbjct: 869  RRSRSDNECITSNAYVLFYHRVY 891

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 6/127 (4%)

Query: 314 LSNSIEREKILLIDLRIPRRSEI-NHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLE 372
           L N +    +LLIDLR PR   I +HI +P+++ I+P    D  ++  + +  ++     
Sbjct: 167 LQNLMAASSVLLIDLR-PRMEFIKSHIKSPSVICIEPISFKDTYSDLDLAKKSMITSPNC 225

Query: 373 ENEIFINRDKFEYVVYYT--DVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALL-GGY 429
           E E+F  RD F+++V YT  D +T  Y       +   L  +  K  L  V   +L GG+
Sbjct: 226 EIELFSKRDTFQFIVLYTHEDGRTQYYKQQQLKLLDLLLSRSFDKP-LDKVKVLILEGGF 284

Query: 430 EKWKKTL 436
           E+W + +
Sbjct: 285 EEWLREI 291

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 98.2 bits (243), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 119/273 (43%), Gaps = 33/273 (12%)

Query: 575 LQPQPQRAYNIP--TIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISA 632
           + P PQ+  + P   I  +S  +    I GL N+GN CY+N ++QCL        +F+  
Sbjct: 436 IPPLPQQNLSPPKHAIFNNSQAFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDN 495

Query: 633 NYKNYLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGG--------CSVVPTGFLKVVNQLR 684
            Y N++    G+       L+ +   L + M+ +G           V    F KV   + 
Sbjct: 496 TYLNFIN--FGNTRGSKGLLAKNYATLVHNMHRHGAFKPPHSRTTPVQTLQFKKVCGHIN 553

Query: 685 PDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYK---- 740
             +     QQD QEF   LLD LH++L+  Q+    +   L    + ++ S +  K    
Sbjct: 554 -SIYSDSMQQDCQEFCQFLLDGLHEDLN--QNGGKKHLKQLSEQEERMRESMSIRKASAL 610

Query: 741 HWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLG 800
            W  +  +    S I D+FQGQ  + LQC+ C +T+  Y TF VLS+ +PR         
Sbjct: 611 EW--ERFLLTDFSAIIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRI-------- 660

Query: 801 RSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
               +   + DC   FT  E L  +  W C +C
Sbjct: 661 ----RTCNILDCFREFTKCEKLGVDEQWSCSKC 689

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 67/141 (47%), Gaps = 32/141 (22%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILK-----NNETM------ 988
            + K +    LPK L+I+L RF   + K N+  + YP  L++        N+E++      
Sbjct: 695  STKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWARDFNHESIVNEDIP 753

Query: 989  --------KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH 1040
                    +YRL+GV  H+G+L  GHYTS V K  +         WY+FDD V       
Sbjct: 754  TRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGPQKG-------WYFFDDSVYCPIR-- 804

Query: 1041 GSDKNLKISSSDVYVLFYERV 1061
                N +  + + YVLFYER+
Sbjct: 805  ---FNDEFITPNAYVLFYERI 822

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 323 ILLIDLRIPRRSEIN-HIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRD 381
           IL+ID+R PR   I  HI   N++ I+P    D  T+  V +  +      E ++F NRD
Sbjct: 179 ILVIDIR-PRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATSPQSEIDLFSNRD 237

Query: 382 KFEYVVYYTDVKTF 395
            F+Y+V YTD + +
Sbjct: 238 TFKYIVLYTDTQLY 251

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 113/251 (45%), Gaps = 37/251 (14%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFIS------ANYKNYLQPPKGSRSAHSSKLSN 654
           TGL N+ N+CY+N +IQCL +      L+++       N +N L    GS+   S   +N
Sbjct: 458 TGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQINVENKL----GSKGFLSKNFAN 513

Query: 655 SLNMLFNKMYL-----NGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHD 709
            +  ++ K        N    V P  F      +   +     +QD QEF   LLD LH+
Sbjct: 514 LIQTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMN-SIYAESTEQDCQEFCEFLLDGLHE 572

Query: 710 ELSNQQHVANDYPNLLLYNADALK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQ 762
           +L+  Q   N  P  L  N   L+        S  E++ +   N      SPI ++FQGQ
Sbjct: 573 DLN--QCSGNPRPKELSANEAELRESLSMRIASEIEWESFLTTN-----FSPIINLFQGQ 625

Query: 763 MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVL 822
             + LQC  C +T+  Y  F +LS+ +P  SM  S  G++      + DC   FT  E L
Sbjct: 626 YASRLQCLICQHTSTTYQPFSLLSIPVP--SMVFSN-GQT----CNILDCFKEFTKCERL 678

Query: 823 SGENAWDCPRC 833
             +  W CP+C
Sbjct: 679 DNDEKWFCPKC 689

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%), Gaps = 34/145 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNII------------------ 981
            + K +    LPK L+IH  RF  +   KN+  + YP  L++                   
Sbjct: 695  STKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPNFNEP 753

Query: 982  ---LKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                      KY+L  V  H+G L SGHYT+ V+K L          W+ FDD   +   
Sbjct: 754  PPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLYRG-------WFRFDDASYRPV- 805

Query: 1039 KHGSDKNLKISSSDVYVLFYERVHD 1063
            K G++      + D Y+LFY+R+++
Sbjct: 806  KFGTE----FLTPDAYLLFYQRIYE 826

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 8/141 (5%)

Query: 303 SIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVY 362
           S I   +L  +LS+   +  +LLID+R  +  +  HI AP ++ I P       T+  + 
Sbjct: 167 SFILPEKLHDLLSS--HKRNLLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIE 224

Query: 363 QDDILEHLLEENEIFINRDKFEYVVYYT-DVKTFMYMNFDYVFIFFYLMLTSQKTHLTSV 421
           Q  +L    +E   F  R++F Y+V YT D     Y     + +F  L + + K ++  +
Sbjct: 225 QTSLLTSTFQERNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKRNIDQI 284

Query: 422 PTALL---GGYEKWKKTLHTY 439
             ++    GG   W +  H+Y
Sbjct: 285 CPSIFILKGGITSWVQ--HSY 303

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 120/267 (44%), Gaps = 45/267 (16%)

Query: 590 QSSNVYVSLSIT---------GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ- 639
           +SSN   SL+ T         GL N+GN+CYIN +IQCL        +F++ +Y+ ++  
Sbjct: 495 RSSNSQSSLTQTKQYDLDFTVGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINL 554

Query: 640 ----PPKGSRSAHSSKLSNSL--NMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQ 693
                 KG  + H ++L + +  +  F K   N   +V P  F      +   L     Q
Sbjct: 555 NSKLGSKGVLAKHFARLIHQMHQSAAFKKSDKNK--AVRPYEFKMACGSIN-SLFRESGQ 611

Query: 694 QDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALK-------VSNNEYKHWFDKN 746
           QD+QEF   LLD LH++L+  Q   N     L   A+ ++        S+ E++ +  ++
Sbjct: 612 QDSQEFCQFLLDGLHEDLN--QCGGNPPLKELSEEAEKMRERLSMRIASSIEWERYLTRD 669

Query: 747 VIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKR 806
                 S I D+FQGQ  + L+CK C +T+  Y  F +L+  +P              K 
Sbjct: 670 -----FSVIVDLFQGQYASQLRCKVCNHTSTTYQPFSILAAPVPH------------AKS 712

Query: 807 VKLEDCINMFTDDEVLSGENAWDCPRC 833
             L DC   FT  E L  +  W CP C
Sbjct: 713 CYLLDCFKEFTKLEQLEKDEEWLCPYC 739

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 67/144 (46%), Gaps = 34/144 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI--ILKNN------------ 985
            + K +    LP+ L+IHL RF  +L  KN+ ++ YP  L++     N+            
Sbjct: 745  STKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGVTDE 803

Query: 986  -------ETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADN 1038
                      KY+L+ V +H+G+L  GHYT+ V+K L          WYYFDD   +   
Sbjct: 804  LPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLNKG-------WYYFDDTGYRP-- 854

Query: 1039 KHGSDKNLKISSSDVYVLFYERVH 1062
                    +  +S+ YVLFY RV+
Sbjct: 855  ---MRTPTECITSNAYVLFYHRVY 875

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 8/115 (6%)

Query: 277 LKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEI 336
           +KE + D+  + +D+       L+    I+A EL  +L +  +   ILL+D+R     E 
Sbjct: 132 IKEHSSDIDEISSDK------ELKTGGFISAKELEFLLKS--DDRNILLVDVRQRSEFEE 183

Query: 337 NHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTD 391
            HI A N++ I+P       T+  + +  ++     E +IF  R++F +V+ YTD
Sbjct: 184 THIKASNVICIEPISFKSSYTDLELEKKSMITSPNVEIDIFKRRNEFTFVILYTD 238

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 110/246 (44%), Gaps = 28/246 (11%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ-----PPKGSRSAHSSKLSN 654
           I GL N+ N+CY+N +IQCL +      + ++ ++  ++        KG    H +KL  
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 655 SLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 714
            ++    K   +     V T   K        +     QQD QEF   LLD LH++L+  
Sbjct: 488 DMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIYSGSQQQDCQEFCEFLLDGLHEDLN-- 545

Query: 715 QHVANDYPNLLLYNAD-------ALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
                + P   L + +        ++V+++    W  +N + N  S I D+F GQ  + L
Sbjct: 546 -QCGGNPPARELTDQEERLREGLCMRVASS--MAW--ENFLHNNFSLIIDLFAGQYGSQL 600

Query: 768 QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENA 827
           +C  C YT+  Y  F +LS+ +P  S ++S        R  + DC   FT  E L  +  
Sbjct: 601 RCCVCQYTSTTYQPFTLLSVPVPLSS-RVS--------RCSIIDCFQEFTKCERLDKDEE 651

Query: 828 WDCPRC 833
           W CP+C
Sbjct: 652 WFCPQC 657

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 70/150 (46%), Gaps = 43/150 (28%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNI------------------- 980
            + K +    LPK L+IH  RF  ++  KN+  I YP  L++                   
Sbjct: 663  STKQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFWVNDFNGELPLGMTNS 721

Query: 981  -ILKNNET--MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1037
             + K  +    KY+L  V  H GTL SGHYT+ VNK      D+G   WYYFDD      
Sbjct: 722  LLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNK----GPDVG---WYYFDD------ 768

Query: 1038 NKHGSDKNLKISSS----DVYVLFYERVHD 1063
                S + +KI++     D Y+LFY RV++
Sbjct: 769  ---SSHRIVKIATEYMNPDAYLLFYHRVYN 795

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 69/136 (50%), Gaps = 18/136 (13%)

Query: 272 VDSDTLKEDNDD-LLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRI 330
           V++  +K  N+D  + + + + ++    L     +T P+L +ILS+  ++  +LLID+R 
Sbjct: 126 VETFLIKYSNEDPSMKIISTQKVEGGHNLPSGPFLTVPQLQTILSD--QKISVLLIDVRK 183

Query: 331 PRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHL------LEENEIFINRDKFE 384
               E +HI +  ++ +DP       +  P Y  D LE +      + E ++F  R++++
Sbjct: 184 RYEFEFSHINSVAVLPLDP------ISFKPTYTIDQLEKISFINSPMHELQLFQKRNEYD 237

Query: 385 YVVYYT---DVKTFMY 397
            +V YT   D+  + Y
Sbjct: 238 VIVLYTKDNDITAYYY 253

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 96/206 (46%), Gaps = 15/206 (7%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP--PKGSRSAHSSKLSN 654
           SL ITGL NLGNTCY+NS +QC+    +FR  F+ + Y+  L    P G +   +   S 
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAEAFSE 376

Query: 655 SLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 714
            +  LF    +    +  P  F   +      +     QQD+QEFL  LLD LH++L+  
Sbjct: 377 LIRCLFGDKLVQFS-AYAPNHFKATIGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDLNRI 434

Query: 715 QHVANDYPNLLLYNAD------ALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 768
                     L   AD        K++++ +K    +N      S I D+F G  +++L+
Sbjct: 435 DKKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRND-----SVITDLFVGLYKSTLE 489

Query: 769 CKRCGYTTFNYSTFYVLSLAIPRRSM 794
           C  C   +  +  +  L+L +P +SM
Sbjct: 490 CPECQNISITFDPYNDLTLPLPVKSM 515

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 56/129 (43%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYPLI-----LNIILKNNETMK-YR 991
              K I     P +L+IHL RF      + K   V+ +P+       +++ K++     Y 
Sbjct: 928  ATKQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYD 987

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G L  GHYT+      ++S D    KWYYFDD  V       S       + 
Sbjct: 988  LIAVDNHYGGLGGGHYTAYA----KNSTD---GKWYYFDDSRVTETVAENS------ITG 1034

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1035 AAYLLFYLR 1043

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 805 KRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           K + L DC+N+F+  E+LS  ++W CP C
Sbjct: 894 KEITLNDCLNLFSKPEILSLNDSWYCPTC 922

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 104/220 (47%), Gaps = 17/220 (7%)

Query: 592 SNVYV------SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKG 643
           SN YV      S    GL NLGNTCY+NS +QCL     F+  F+   Y+    ++ P G
Sbjct: 331 SNFYVYNQLLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLG 390

Query: 644 SRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
            +   +   ++ +  LF K + +   S  P  F   +  L   +     QQD+QEFL  L
Sbjct: 391 HKGHIAWAFASMVQALFGKRH-SAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFL 448

Query: 704 LDRLHDELS---NQQHVANDYPNLLLYNADA-LKVSNNEYKHWFDKNVIGNGISPIDDIF 759
           LD LH++L+    + +V  + P L   +  A  KV        + K+ + N  S I D+F
Sbjct: 449 LDGLHEDLNRIIEKPYV--EKPELTSTDDTAEFKVIKKLADDTWGKHKLRND-SVITDLF 505

Query: 760 QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
            G  +++L C  C  T+  +  +  L+L +P  S   +K+
Sbjct: 506 VGLYKSTLICPVCKKTSVTFDPYNDLTLPLPVNSTWSNKV 545

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 57/129 (44%), Gaps = 22/129 (17%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKNNETMK-YR 991
              K I     P IL+IHL RF      + K +  + +P     +   ++ KN +    Y 
Sbjct: 994  ATKQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYD 1053

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G L  GHYT+ V      ++D    KWYYFDD  V       S     I+ S
Sbjct: 1054 LIAVDNHYGGLGGGHYTAYVK-----NID---GKWYYFDDSRVSETLPERS-----IAGS 1100

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1101 -AYLLFYRR 1108

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 802 STEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           S EK++ L DC+ +F+  EVL   ++W CP C
Sbjct: 957 SGEKKITLHDCLTLFSTPEVLGATDSWFCPNC 988

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 100/213 (46%), Gaps = 32/213 (15%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP--PKGSRSAHSSKLSN 654
           S  ITGL NLGNTCY+NS +QCL      R  F+   +++ +    P G +   +   S 
Sbjct: 289 SSGITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARAFSG 348

Query: 655 SLNMLFNKMYLNGGCSVV----PTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDE 710
            +  LF    L+ G ++     PTGF   +      +     QQD+QEF+  LLD LH++
Sbjct: 349 LVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFN-SMFSGYMQQDSQEFITFLLDGLHED 407

Query: 711 LS-------------NQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDD 757
           L+             + +  +ND+ N++       +++ + +K    +N      S I D
Sbjct: 408 LNRIVDKPYIEKPSLSPEDDSNDF-NVI------KRLAEDTWKLHLQRN-----DSVITD 455

Query: 758 IFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIP 790
           +F G  E++LQC  C   +  +  +  L+L +P
Sbjct: 456 LFVGLYESTLQCPECNNVSITFDPYNDLTLPLP 488

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 61/130 (46%), Gaps = 23/130 (17%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP---LILNIILKNNETMK---YR 991
              K I     P +L+IHL RF      + K   V+ +P   L ++  L N    +   Y 
Sbjct: 912  ATKQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYD 971

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDD-EVVKADNKHGSDKNLKISS 1050
            L  V NH G L  GHYT+       ++ ++  SKWYYFDD  V +   + G      I+S
Sbjct: 972  LVAVDNHYGGLGGGHYTA-------YAKNVDDSKWYYFDDSRVTETTPERG------IAS 1018

Query: 1051 SDVYVLFYER 1060
            S  Y+LFY R
Sbjct: 1019 S-AYLLFYVR 1027

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 798 KLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           K  +  EK++ L DC+ +F+  EVL   ++W CP C
Sbjct: 871 KRQQEEEKKITLHDCLKLFSKREVLGMNDSWYCPSC 906

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 104/238 (43%), Gaps = 31/238 (13%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNML 659
           I G++N GN CY+N +IQCL     F   F+   Y   +     SR  H   +  +   +
Sbjct: 343 IKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINV--NSRLGHQGLVVKNWAKI 400

Query: 660 FNKMYLNGGCSVVP----TGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 715
               +     ++ P    T F +    L P+      Q D  EF + LL+ +H++ SN  
Sbjct: 401 IQAFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEIHED-SNWG 458

Query: 716 HVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYT 775
              N        +  A++V  ++Y+  ++    GN  S I D F+GQ+++ L C+ C   
Sbjct: 459 RPQN--------SDAAMQV--DDYREAWNLYRKGNS-SYIVDTFKGQIKSQLTCQVCQTQ 507

Query: 776 TFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           + NY  F +L+L IP  SM              + DC+       VL+G++ W C  C
Sbjct: 508 SNNYEPFSILNLPIPLVSM------------CHIYDCMKELFKVHVLTGDDRWYCSTC 553

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 60/116 (51%), Gaps = 18/116 (15%)

Query: 949  LPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMK----YRLFGVVNHTGTLVS 1004
            +P++L+IH +RF  +L  K    + YP +L++   N    K    Y+L  V  HTGTL S
Sbjct: 568  VPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACHTGTLFS 626

Query: 1005 GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYER 1060
            GHYT+   K+ E+        WY+FDD   K  +      N +  S   Y+LFY++
Sbjct: 627  GHYTAYCFKNSENG-------WYHFDDTQCKPVS------NGECISQSAYLLFYQK 669

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 96/214 (44%), Gaps = 41/214 (19%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLNML 659
           GL NLGNTCY+NS +QCL      R  F    YKN   L  P G +      ++N+ + L
Sbjct: 399 GLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQ----GNIANAFSAL 454

Query: 660 FNKMYLNG---GCSVVPTGFLKVV---NQLRPDLKIPDDQQDTQEFLMILLDRLHDELS- 712
              +Y N      S  P+ F   +   NQ+         QQD+QEFL  LLD LH++L+ 
Sbjct: 455 VQNLYKNQFIPSASYAPSQFKLTIGHYNQMFSGYF----QQDSQEFLAFLLDGLHEDLNR 510

Query: 713 --NQQHV----------ANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760
             ++ +V           NDY  +    AD L+              +    S I D+F 
Sbjct: 511 IKDKPYVEKPSLADGSDVNDYNIIARLAADTLEAH------------LKRNDSIIIDLFV 558

Query: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSM 794
           G  +++L+C  C + +  +  +  L+L IP  S+
Sbjct: 559 GLYKSTLKCPVCNHVSITFDPYCDLTLPIPVESV 592

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 56/127 (44%), Gaps = 21/127 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYD--LTKKNSTVITYP-----LILNIILKNNETMK-YRLF 993
            K I   + P IL IHL RF      + K   V+ +P     L  +I+ K+   +  Y L 
Sbjct: 996  KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLI 1055

Query: 994  GVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDV 1053
             V NH G L  GHYT+ +   +++       KWYYFDD  V       S       +   
Sbjct: 1056 AVDNHYGGLGGGHYTAYIKNLIDN-------KWYYFDDSRVSETVPERS------VAGSA 1102

Query: 1054 YVLFYER 1060
            Y+LFY R
Sbjct: 1103 YLLFYMR 1109

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 795 KLSKLGRSTE-KRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           K  +LG+  E K + LED +N+F   EVL   ++W CP+C
Sbjct: 949 KTRELGQDKEEKNITLEDSLNLFERAEVLGINDSWYCPKC 988

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 102/207 (49%), Gaps = 15/207 (7%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL--QPPKGSRSAHSSKLSNSLNM 658
           TGL NLGN+CY+NS +QCL      +  F+   Y+  +  Q P G +   +   +  +  
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALIKS 393

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN-QQHV 717
           LF++   +   +  P  F  ++ Q +  +     QQD+QEFL  LLD LH++L+   +  
Sbjct: 394 LFDERS-SSAFAFSPREFKSIIGQ-QNSMFAGFLQQDSQEFLAFLLDGLHEDLNRIIEKP 451

Query: 718 ANDYPNLLLYNADALKVSNNEYKH-----WFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
             + P L    +    V+N E  H      +DK+ + N  S I D+F G  +++L C  C
Sbjct: 452 FVEKPEL----SPDEDVNNREVIHRLASKTWDKHKLRND-SVILDLFVGLYKSTLTCPVC 506

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKL 799
             T+  +  +  L+L +P  S+  SK+
Sbjct: 507 DKTSVTFDPYSDLTLPLPVESIWTSKV 533

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 59/129 (45%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYPLI-LN----IILKNNETMK-YR 991
              K I     P IL IHL RF   +  + K S V+ +P+  LN    ++ ++ E    Y 
Sbjct: 935  ATKQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYD 994

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G L  GHYT+     ++        KWYYFDD  V       +D    +S +
Sbjct: 995  LVAVDNHYGGLGGGHYTAFAKNPVD-------GKWYYFDDSRVSE-----TDPETSVSGA 1042

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1043 -AYLLFYRR 1050

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 804 EKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           E+R+ L DC+ +F+  EVLS  ++W CP C
Sbjct: 900 ERRISLFDCLKLFSKPEVLSAADSWYCPTC 929

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 101/212 (47%), Gaps = 7/212 (3%)

Query: 592 SNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP--PKGSRSAHS 649
           +N+  S    GL NLGNTCY+NS +QC+    IFR  F+   ++  +    P G +   +
Sbjct: 321 NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMA 380

Query: 650 SKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHD 709
              S+ +  LF    +    +  P+ F   +      +     QQD+QEFL  LLD LH+
Sbjct: 381 RAFSDLIQSLFGDN-ITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLHE 438

Query: 710 ELSN-QQHVANDYPNL-LLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
           +L+   +    + P+L L  N +   V        +  +++ N  S I D+F    +++L
Sbjct: 439 DLNRIDKKPYVEKPSLPLTANLNDFDVVKRLADDTWKAHLLRND-SVITDLFVAMYKSTL 497

Query: 768 QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
           +C  C  T+  +  +  L+L +P  S+  +K+
Sbjct: 498 KCPECQNTSVTFDPYNDLTLPLPVASIWHTKV 529

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTVIT--YPLI-----LNIILKNNETMK-YR 991
              K I     P IL+IHL RF    +  +  V T  +P+       +++ K +     Y 
Sbjct: 971  ATKQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYD 1030

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G L  GHYT+       ++ +   +KWYYFDD  V       S     I+ S
Sbjct: 1031 LIAVDNHYGGLGGGHYTA-------YAKNANDNKWYYFDDSRVSVTAPEKS-----IAGS 1078

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1079 -AYLLFYVR 1086

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query: 790 PRRSMKLSKL----GRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           P  + +L KL     +  E+ + L+DC+ +F+  E+LS  ++W CP C
Sbjct: 918 PLPNPQLEKLKEQRDKQEERHITLDDCLKLFSKPEILSSNDSWYCPHC 965

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 101/227 (44%), Gaps = 45/227 (19%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP--PKGSRSAHSSKLSN 654
           S  ITGL NLGNTCY+NS +QCL      R  F+   + + +    P G +   +   S 
Sbjct: 298 SQGITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKAFSL 357

Query: 655 SLNMLFNKMY---------------LNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEF 699
            +  LF   Y               + G C+ + +G++               QQD+QEF
Sbjct: 358 LVKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM---------------QQDSQEF 402

Query: 700 LMILLDRLHDELSNQQH------VANDYPNLLLYNADAL-KVSNNEYKHWFDKNVIGNGI 752
           L  LLD LH++L N+ H        +  PN  + + D + K++ + +K    +N      
Sbjct: 403 LAFLLDGLHEDL-NRVHDKPYIEKPSLSPNSDVTDRDTIKKLAEDTWKMHLLRN-----D 456

Query: 753 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
           S + D+F    E++L+C  C   +  +  +  L+L +P  +   SK+
Sbjct: 457 SIVTDLFVALYESTLECPECRNVSITFDPYNDLTLPLPVNTTWHSKV 503

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 55/128 (42%), Gaps = 22/128 (17%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKNNETMKYRL 992
              K I   + P +L+IHL RF      + K    + +P     +  +++ ++     Y L
Sbjct: 902  ATKQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDL 961

Query: 993  FGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSD 1052
              V NH G L  GHYT+ V  +          KW+YFDD  V       S     I+ S 
Sbjct: 962  IAVDNHFGGLGGGHYTAYVKTN---------DKWFYFDDSRVTETKPESS-----IAGS- 1006

Query: 1053 VYVLFYER 1060
             Y+LFY R
Sbjct: 1007 AYLLFYLR 1014

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 798 KLGRSTEKR-VKLEDCINMFTDDEVLSGENAWDCPRC 833
           K     EKR + L DC+ +F+  EVLS  ++W CP C
Sbjct: 860 KEAEGQEKRAISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 92/209 (44%), Gaps = 22/209 (10%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL--QPPKGSRSAHSSKLSN 654
           S    GL NLGNTCY+NS +QCL      R  F+   ++  +    P G +   +     
Sbjct: 317 STGTIGLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFHG 376

Query: 655 SLNMLFNKMYLNGGCSVVPTGFLKVV---NQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
            +  LF          V PT F   +   N +    +    QQD+QEFL  LLD LH++L
Sbjct: 377 LIQSLFGDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQ----QQDSQEFLAFLLDSLHEDL 432

Query: 712 SNQQHVANDY-------PNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 764
           +  + V   Y       P   + + D +K   NE   W  K+ +    S I DIF G  +
Sbjct: 433 N--RIVEKPYVEKPSLKPGDDINDFDTIKKLANE--TW--KSHLMRNDSIITDIFVGMYK 486

Query: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRS 793
           ++L+C  C   +  +  +  L+L +P  S
Sbjct: 487 STLECPECSNVSITFDPYNDLTLPLPINS 515

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 789 IPRRSMKLSKLGRST--EKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           I  + ++  KL  S   E+   L+DC+N+F+  EVL   ++W CP C
Sbjct: 873 ISNKELESIKLAESAHVEQETTLKDCLNLFSKKEVLGMSDSWYCPNC 919

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKNNETMK-YR 991
              K I     P + +IHL RF      + K    I +P     +   ++ K++     Y 
Sbjct: 925  ATKKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFPIEDLDMSEYLVYKDDPRGSVYD 984

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G +  GHYT+ V        ++    WYYFDD  V   +K   +K++  S+ 
Sbjct: 985  LIAVDNHYGGMGGGHYTAYVK-------NLTDQNWYYFDDSRV---SKTSPEKSIAGSA- 1033

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1034 --YLLFYLR 1040

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 91/199 (45%), Gaps = 11/199 (5%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSL 656
            I GL NLGNTCY+NS +QCL      R  F    Y+    L  P G     ++   N +
Sbjct: 287 GIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVATAFGNLI 346

Query: 657 NMLFNKMYLNGGC-SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 715
             L++  +      S  P  F   + Q    +     QQD+QEFL  LLD LH++L N+ 
Sbjct: 347 QNLYSYHWNQQQYQSYSPNRFKMTLGQAN-SMFAGYMQQDSQEFLAFLLDSLHEDL-NRI 404

Query: 716 HVAN--DYPNLLLYN--ADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 771
           H     + P L      AD   V     K W D ++  N  S I+D+F G  +++L+C  
Sbjct: 405 HDKPYIEKPTLETSEELADENAVKQLAKKTW-DAHLARND-SVINDLFVGMYKSTLKCPT 462

Query: 772 CGYTTFNYSTFYVLSLAIP 790
           C   +  +  +  L+L +P
Sbjct: 463 CKNISITFDPYNDLTLPLP 481

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 25/129 (19%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYPL--------ILNIILKNNETMK 989
              K +     P+IL+IHL RF      + K   V+ +P+        +++ ++++     
Sbjct: 877  ATKQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDG--CI 934

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKIS 1049
            Y LF V NH G L  GHYTS V  ++++       +WYYFDD  V +     +D    ++
Sbjct: 935  YDLFAVDNHYGGLGGGHYTSYVKNNIDN-------RWYYFDDSRVSS-----TDPKKSVA 982

Query: 1050 SSDVYVLFY 1058
             S  Y+LFY
Sbjct: 983  GS-AYLLFY 990

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 807 VKLEDCINMFTDDEVLSGENAWDCPRC 833
           + L+ C+ +F+  EVL   ++W CP+C
Sbjct: 845 ITLDSCLKLFSKPEVLGINDSWYCPKC 871

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 95/208 (45%), Gaps = 16/208 (7%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK--GSRSAHSSKLSNSLNML 659
           GL NLGNTCY+NS +QCL      R  F+ + Y+  L      G +   +   S+ +  L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKAFSSLVQNL 383

Query: 660 FNKMYLNGGC--SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN-QQH 716
           F       G   S  P  F   V      +     QQD+QEFL  LLD LH++L+     
Sbjct: 384 FGDTITKQGTNSSFGPNHFKSTVGHFNS-MFSGYLQQDSQEFLAFLLDSLHEDLNRIINK 442

Query: 717 VANDYPNLLL---YNADAL--KVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 771
            + + P+L     YN  A+   +++  +K    +N      S I D+F G  +++L+C  
Sbjct: 443 PSTEKPSLKEGDDYNDPAVIKSLADETWKMHLLRN-----DSVITDLFVGMYKSTLECPE 497

Query: 772 CGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
           C   +  +  +  L+L +P  S   SK+
Sbjct: 498 CTNVSITFDPYSDLTLPLPVDSTWSSKV 525

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 21/127 (16%)

Query: 942  KTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP---LILNIILKNNETMK---YRLF 993
            K I     P +L+IHL RF      + K    + +P   L ++  L + +  +   Y L+
Sbjct: 906  KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFPIENLDMSPYLVHKDDPRGTVYDLY 965

Query: 994  GVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDV 1053
             V NH G L  GHYT+ V   +++       KWYYFDD  V     + +D    +S S  
Sbjct: 966  AVDNHYGGLGGGHYTAYVKNFIDN-------KWYYFDDSRV-----YETDPEKSVSGS-A 1012

Query: 1054 YVLFYER 1060
            Y+LFY R
Sbjct: 1013 YLLFYLR 1019

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 764 ENSLQCKRCGYT---TFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
           E SL+  R  ++     N+    VL   +    +K  +    ++K + L DC+N+F+  E
Sbjct: 827 EWSLESSRLAFSEEKVINWENPGVLQ-NVELEELKTQREVDGSDKEITLNDCLNLFSKRE 885

Query: 821 VLSGENAWDCPRC 833
           VL   ++W CP C
Sbjct: 886 VLGLNDSWYCPHC 898

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 96/201 (47%), Gaps = 18/201 (8%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL--QPPKGSRSAHSSKLSNSLNM 658
           TGL NLGNTCY+NS +QCL      R  F+   Y++ +  + P G     +   S+ +  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSDLVQK 423

Query: 659 LF-NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 717
           LF N+M +    +  P    K        +     QQD+QEFL  LLD LH++L+  + +
Sbjct: 424 LFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLN--RII 481

Query: 718 ANDY-------PNLLLYNADAL-KVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
             +Y       P   + + + + K++++ ++    +N      S I D+F G  +++L C
Sbjct: 482 KKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRNC-----SVITDLFVGMYKSTLYC 536

Query: 770 KRCGYTTFNYSTFYVLSLAIP 790
             C   +  +  +  ++L +P
Sbjct: 537 PECQNVSITFDPYNDVTLPLP 557

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 58/131 (44%), Gaps = 21/131 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKNN-ETMKYR 991
              K I     P IL+IHL RF      + K    + +P     L   ++ K++   + Y 
Sbjct: 994  ATKQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYD 1053

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L+ V NH G L  GHYT+ V        +   +KWYYFDD  V       S     I+ S
Sbjct: 1054 LYAVDNHYGGLGGGHYTAYVK-------NFADNKWYYFDDSRVTETAPENS-----IAGS 1101

Query: 1052 DVYVLFYERVH 1062
              Y+LFY R H
Sbjct: 1102 -AYLLFYIRRH 1111

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 788 AIPRRSMKLSKLGRST--EKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
            +P + ++ +KL RS   E+ + L+DC+ +F+  E+L   ++W CP C
Sbjct: 941 TLPNKELENAKLERSNAKERTITLDDCLQLFSKPEILGLTDSWYCPTC 988

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 97/205 (47%), Gaps = 26/205 (12%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL--QPPKGSRSAHSSKLSNSLNM 658
           TGL NLGNTCY+NS +QCL      R  F+   Y+N +  + P G     +   S+ +  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHGYVARAFSDLIQK 423

Query: 659 LFNK----MYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 714
           +F      M  NG  +  P+ F   V      +     QQD+QEFL  LLD LH++L+  
Sbjct: 424 IFQNRLSVMQRNG--AFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLN-- 478

Query: 715 QHVANDY---PNLLL------YNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
           + +  +Y   P+L        +N    K++++ ++    +N      S I D+F G  ++
Sbjct: 479 RIIKKEYIEKPSLSPGDDVDDWNV-VKKLADDTWEMHLKRNC-----SVITDLFVGMYKS 532

Query: 766 SLQCKRCGYTTFNYSTFYVLSLAIP 790
           +L C  C   +  +  +  ++L +P
Sbjct: 533 TLYCPECKNVSITFDPYNDVTLPLP 557

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKNNETMK-YR 991
              K I     P IL+IHL RF      + K    + +P     L  N++ K++     Y 
Sbjct: 990  ATKQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSKNVVYKDDPRGSIYD 1049

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L+ V NH G L  GHYT+ V        +   +KWYYFDD  V       S     I+ S
Sbjct: 1050 LYAVDNHYGGLGGGHYTAYVK-------NFANNKWYYFDDSRVTETVPENS-----IAGS 1097

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1098 -AYLLFYIR 1105

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 797 SKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           S+   + E+ + L+DC+ +F+  E+L   ++W CP C
Sbjct: 948 SERSNAKERTITLDDCLQLFSKPEILGLSDSWYCPTC 984

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 92/202 (45%), Gaps = 20/202 (9%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL--QPPKGSRSAHSSKLSNSLNM 658
           TGL NLGNTCY+NS +QCL      R  F+   Y+  +  + P G     +   S+ +  
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHGYVARAFSDLIQK 420

Query: 659 LF----NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 714
           LF    N M  NG  +  PT F   +      +     QQD+QEFL  LLD LH++L+  
Sbjct: 421 LFQNKLNIMQRNG--AFPPTMFKSTIGHFNS-MFSGYMQQDSQEFLAFLLDSLHEDLNRI 477

Query: 715 QHVANDYPNLLLYNADA------LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 768
              A      L  + D        K++++ ++    +N      S I D+F G  +++L 
Sbjct: 478 IKKAYIEKPSLSPDDDVNDWNVIKKLADDTWELHLKRNR-----SVITDLFVGMYKSTLY 532

Query: 769 CKRCGYTTFNYSTFYVLSLAIP 790
           C  C   +  +  +  ++L +P
Sbjct: 533 CPECKDVSTTFDPYNDVTLPLP 554

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 59/133 (44%), Gaps = 29/133 (21%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKNNETMK-YR 991
              K I     P IL+IHL RF      + K    + +P     L  +++ K++     Y 
Sbjct: 993  ATKQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFPITDLDLSEHVVYKDDPRGSIYD 1052

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDD----EVVKADNKHGSDKNLK 1047
            L+ V NH G L  GHYT+ V   +++       KWYYFDD    E V  ++  GS     
Sbjct: 1053 LYAVDNHYGGLGGGHYTAYVKNFMDN-------KWYYFDDSRVTETVPENSVAGS----- 1100

Query: 1048 ISSSDVYVLFYER 1060
                  Y+LFY R
Sbjct: 1101 -----AYLLFYIR 1108

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 789 IPRRSMKLSKLGR--STEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           +P   ++  KL R  + E+ + L DC+ +F+  E+L   ++W CP C
Sbjct: 941 LPNTELEKVKLERCNAKERTITLNDCLQLFSKPEILGLNDSWYCPTC 987

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 93/200 (46%), Gaps = 16/200 (8%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL--QPPKGSRSAHSSKLSNSLNM 658
           TGL NLGNTCY+NS +QCL      R  F+   Y++ +  + P G     +   S+ +  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 659 LF-NKM-YLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 716
           LF NK+  +    +  P+ F   V      +     QQD+QEFL  LLD LH++L+    
Sbjct: 424 LFHNKLSSMQRNAAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLNRIIK 482

Query: 717 VANDYPNLLLYNAD------ALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCK 770
            A      L  + D        K++++ ++    +N      S I D+F G  +++L C 
Sbjct: 483 KAYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRNC-----SVITDLFVGLYKSTLYCP 537

Query: 771 RCGYTTFNYSTFYVLSLAIP 790
            C   +  +  +  ++L +P
Sbjct: 538 ECKNVSITFDPYNDVTLPLP 557

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYPLIL-----NIILKNNETMK-YR 991
              K I     P IL++HL RF      + K    + +P+       +++ K++     Y 
Sbjct: 996  ATKQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYD 1055

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L+ V NH G L  GHYT+ V        +   SKWYYFDD  V       S     IS S
Sbjct: 1056 LYAVDNHYGGLGGGHYTAYVK-------NFADSKWYYFDDSRVTETVPENS-----ISGS 1103

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1104 -AYLLFYIR 1111

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 748 IGNGISPIDDIFQGQMENSLQCKR-CGYTTFNYSTFYVLSLAIPRRSMKLSKLGRST--E 804
           I + I  IDDI   + E S   +       FN+         +P   ++ +KL RS   E
Sbjct: 906 ISHEILSIDDILVCEWEESGSNEAFSNDKIFNWEN----PAPLPNIELENAKLERSNAKE 961

Query: 805 KRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           + + L+DC+ +F+  E+L   ++W CP C
Sbjct: 962 RIITLDDCLQLFSKPEILGLNDSWYCPTC 990

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 89/200 (44%), Gaps = 21/200 (10%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLNML 659
           GL NLGNTCY+NS +QCL      R  F+   ++    L  P G +   +   +  +  L
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDNPLGYQGHVARSFAILIQNL 402

Query: 660 FNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 719
           F    L    S  PT F   V      +     QQD+QEF+  LLD LH++L       N
Sbjct: 403 FKDELL-PSLSYSPTTFKSTVGHFNS-MFSGYLQQDSQEFIAFLLDGLHEDL-------N 453

Query: 720 DYPNLLLYNADALK----VSNNEY-----KHWFDKNVIGNGISPIDDIFQGQMENSLQCK 770
              N  +    +LK    VSN E         ++ +++ N  S I DIF G  +++L C 
Sbjct: 454 RITNKPVVEKPSLKPEDDVSNQEVIKKLADDTWNSHLLRND-SIITDIFVGLYKSTLHCP 512

Query: 771 RCGYTTFNYSTFYVLSLAIP 790
            C   +  +  +  L+L +P
Sbjct: 513 ECDNLSVTFDPYNDLTLPLP 532

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 61/132 (46%), Gaps = 21/132 (15%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP---LILNIILKNNETMK---YR 991
              K +   + P IL+IHL RF      + K    + +P   L L+  + NN+  K   Y 
Sbjct: 941  ATKQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYD 1000

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G L  GHYT+ V    ++ VD    KWYYFDD  V       S     I+ S
Sbjct: 1001 LVSVDNHYGGLGGGHYTAYV----KNFVD---KKWYYFDDSRVTETVPERS-----IAGS 1048

Query: 1052 DVYVLFYERVHD 1063
              Y+LFY R  D
Sbjct: 1049 -AYLLFYMRRSD 1059

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 804 EKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           EK++ L+DC+N+F   EVL   ++W CP C
Sbjct: 906 EKKITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 94/205 (45%), Gaps = 7/205 (3%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP--PKGSRSAHSSKLSNSL 656
            I GL NLGN+CY+NS +QCL      R  F+   ++  +    P G +   +   +  +
Sbjct: 296 GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALV 355

Query: 657 NMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN-QQ 715
             LF+    +   +  P  F  ++      +     QQD+QE L  LLD LH++L+   +
Sbjct: 356 KSLFDDK-ASALQAFSPRAFKSIIGH-HNGMFAGFLQQDSQELLAFLLDGLHEDLNRIMK 413

Query: 716 HVANDYPNLLLY-NADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGY 774
               + P L    + + + V  N     ++K+ + N  S I D+F G  +++L C  C  
Sbjct: 414 KPFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNE-SVIVDLFVGLYKSTLTCPACDR 472

Query: 775 TTFNYSTFYVLSLAIPRRSMKLSKL 799
            +  +  F  L+L +P  S   +K+
Sbjct: 473 VSVTFDPFSDLTLPLPVESFWSAKV 497

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 56/129 (43%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYPLI-----LNIILKN-NETMKYR 991
              K I     P IL IHL RF   +  + K S V+ +P+       +++  + N+   Y 
Sbjct: 904  ATKQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSMYD 963

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G L  GHYT+ V   ++        KWYYFDD  V            +  S 
Sbjct: 964  LIAVDNHYGGLGGGHYTAYVKNFMD-------GKWYYFDDSRVSETEAE------RAISG 1010

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1011 AAYLLFYRR 1019

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 792 RSMKLSKLG--RSTEKR--VKLEDCINMFTDDEVLSGENAWDCPRC 833
           R+M L +    RS +++  + L DC+ +F+  EVL   ++W CP C
Sbjct: 853 RNMALEEAQKHRSEQEKGHISLTDCLELFSKSEVLGAADSWYCPNC 898

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 87/201 (43%), Gaps = 19/201 (9%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSNSLN 657
           I GL NLGNTCY+NS +QCL         F+   Y+    +  P G +   +    + L 
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLLY 397

Query: 658 MLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 717
            LF   Y        P  F   +      L     QQD+QEFL  LLD LH++L+  + +
Sbjct: 398 SLFAPSY-GQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDGLHEDLN--RVI 453

Query: 718 ANDYPNLLLYNADA--------LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
              Y N   +  D         + ++ N + +   +N      S I D+F G  +++L C
Sbjct: 454 EKPYVNKPEFPNDGQIDDTDQIVLLAANMWDYIKKRND-----SVIMDLFVGLYKSTLVC 508

Query: 770 KRCGYTTFNYSTFYVLSLAIP 790
             C + +  +  +  L+L +P
Sbjct: 509 PNCNHVSITFDPYNDLTLPLP 529

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 55/127 (43%), Gaps = 21/127 (16%)

Query: 942  KTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP---LILNIIL---KNNETMKYRLF 993
            K I     P IL+IHL RF      + K    + +P   L ++  L   K  E   Y L 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLI 995

Query: 994  GVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDV 1053
             V NH G L  GHYT+     ++        KWYYFDD  V   +   S     I+ S  
Sbjct: 996  AVDNHYGGLGGGHYTAYCRNFID-------GKWYYFDDSRVNEVSPENS-----IAGS-A 1042

Query: 1054 YVLFYER 1060
            Y+LFY R
Sbjct: 1043 YLLFYRR 1049

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 795 KLSKLGRSTEKR-VKLEDCINMFTDDEVLSGENAWDCPRC 833
           ++ K    TEK  + L+ C+ +F+  E+L   ++W CP C
Sbjct: 889 EVRKTRAQTEKSSITLDSCLRLFSQPEILGSADSWYCPNC 928

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 63.2 bits (152), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 91/220 (41%), Gaps = 34/220 (15%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY--LQPPKGSRSAHSSKLSN 654
           S    GL NLGNTCY+NS +QCL     F   F+   Y+    L  P G +   ++    
Sbjct: 410 STGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGK 469

Query: 655 SLNMLFNKMYLNGGC--------SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDR 706
            ++ LF +  ++           S  PT F   V      +     QQD+QEFL  +LD 
Sbjct: 470 LIHKLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNS-MFSGYLQQDSQEFLAFILDG 528

Query: 707 LHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGN------------GISP 754
           LH++L           N +L      K S  E  ++ D  VI                S 
Sbjct: 529 LHEDL-----------NRILKKPFVEKPSLPENSNYKDYKVIKKLADDTWEAHLKRNDSI 577

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSM 794
           + D+F G  +++LQC  C   +  +  +  L+L +P  ++
Sbjct: 578 VTDLFVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLPVETI 617

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYP-----LILNIILKNNETMK-YR 991
              K I     P IL+IHL RF      + K   V+ +P     L  +I+  + E    Y 
Sbjct: 1102 ATKQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYD 1161

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G L  GHYT+ V   ++        KWYYFDD  V       +D    IS S
Sbjct: 1162 LIAVDNHYGGLGGGHYTAYVKNFVDQ-------KWYYFDDSRVSL-----ADPQRSISGS 1209

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1210 -AYLLFYVR 1217

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 804  EKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
            EK + L+DC+ +F+  E+L  +++W CP C
Sbjct: 1067 EKTILLDDCLRLFSKPEILGLQDSWYCPTC 1096

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 62.0 bits (149), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 96/220 (43%), Gaps = 15/220 (6%)

Query: 591 SSNVYVSLSIT------GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL--QPPK 642
           +SN Y+   +T      GL NLGNTCY+NS +QCL     F+  F+   Y+  +    P 
Sbjct: 333 ASNYYIYNQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPL 392

Query: 643 GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702
           G +   +      +  LF K   N   S  P  F   +  L   +     QQD+QEFL  
Sbjct: 393 GHKGHIAWAFGTLIQSLFGKRN-NLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAF 450

Query: 703 LLDRLHDELS---NQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIF 759
           LLD LH++L+   ++ +V     N      +   +       W    +  + +  I D+F
Sbjct: 451 LLDGLHEDLNRIVDKPYVEKPELNPTDDVTEFETIKKLADDTWLKHKLRNDSV--ILDLF 508

Query: 760 QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
            G  +++L C  C   +  +  +  L+L +P  S   +K+
Sbjct: 509 VGLYKSTLICPTCKKVSTTFDPYNDLTLPLPVDSTWSNKV 548

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 64/129 (49%), Gaps = 21/129 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYPLI-LN----IILKNNETMK-YR 991
              K I     P IL+IHL RF      + K   ++ +P+  L+    ++ K+++    Y 
Sbjct: 969  ATKQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYD 1028

Query: 992  LFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
            L  V NH G L  GHYT+ V   L++       KWYYFDD  V   N+   ++++  S+ 
Sbjct: 1029 LIAVDNHYGGLGGGHYTAYVKNFLDN-------KWYYFDDSRV---NETVPERSIAGSA- 1077

Query: 1052 DVYVLFYER 1060
              Y+LFY R
Sbjct: 1078 --YLLFYRR 1084

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 789 IPRRSMKLSKLGRST--EKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           +P   ++ SK  R+   EK++ L DC+ +F+  EVL   ++W CP C
Sbjct: 917 VPNTELEASKRERNAQEEKKITLHDCLTLFSTPEVLGATDSWYCPSC 963

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 79/193 (40%), Gaps = 44/193 (22%)

Query: 601 TGLRNLGNTCYINSMIQCLF--AAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
            GL NLGN+CY+NS++QCLF    K +    +  ++   +  P  +      KL+N++  
Sbjct: 323 CGLINLGNSCYLNSVLQCLFNGGVKGWSLKGLGQDFPQDVLYPTNNFKCQLIKLNNAMK- 381

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
           +  + Y  G   + P  F K V Q   +      QQD+ EFL  L+D L           
Sbjct: 382 VEPQNYPEG---IRPKSFKKCVGQSHEEFS-SGRQQDSMEFLGYLVDVL----------- 426

Query: 719 NDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
                                    DK +  NG +P +D+ +  ME+ LQC  CG   ++
Sbjct: 427 -------------------------DKKIFKNGSNP-NDLMKFTMEDRLQCTNCGKVKYS 460

Query: 779 YSTFYVLSLAIPR 791
                 L L +P 
Sbjct: 461 SEAAESLQLPMPE 473

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 66/134 (49%), Gaps = 27/134 (20%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNNETMKYRLFG 994
            + +   +LPK L +HL RF Y   +KN+ V     I YPLILN      ++ +  YRL G
Sbjct: 557  RLVGLKSLPKTLSLHLKRFKYS-EEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQG 615

Query: 995  VVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLK 1047
            VV H G     GHY SL + +L      G   W  FDDE V++ ++       GS +   
Sbjct: 616  VVVHMGNGPHHGHYVSLCHTEL-----FG---WLLFDDETVESVDESYVLDFVGSHE--- 664

Query: 1048 ISSSDVYVLFYERV 1061
             S +  YVLFY  +
Sbjct: 665  -SPTTAYVLFYSEI 677

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query: 578 QPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFR 626
           +P+ +  +P  + S+ V+      G  N GNTCY NS++QCL+    FR
Sbjct: 144 EPRVSKGLPFGDGSNKVF------GYENFGNTCYCNSVLQCLYHLPEFR 186

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 62/122 (50%), Gaps = 22/122 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKN-NETMK 989
            K + F + PK+L + L RF YD     L K N       ++   P +   +LKN NET  
Sbjct: 386  KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 990  --YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNL 1046
              Y+L GV+ HTG + +GHY +++  DL         +WY FDDE V K D K   D+N 
Sbjct: 446  HIYKLHGVLVHTGDISTGHYYTMIKPDL-------GDQWYRFDDERVWKVDRKQVFDENF 498

Query: 1047 KI 1048
             +
Sbjct: 499  GL 500

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 85/234 (36%), Gaps = 62/234 (26%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L        Y  P          K ++S+ +  
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIP------TDEEKPNDSVPLAL 255

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S +P   L++      D      Q D QE   IL+DRL   +         
Sbjct: 256 QRAFYQLQVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMK-------- 307

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
                       KV                    + ++F G+M++ ++CK   Y +    
Sbjct: 308 ----------GTKVE-----------------GKLSELFVGKMKSYIKCKNVDYESSRVE 340

Query: 781 TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
            F+ + L +      L  L +S E  +++          E++ GEN +  P  G
Sbjct: 341 EFWDIQLNVK----DLKNLQQSFENYIEV----------ELMDGENQYAAPDFG 380

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 61/135 (45%), Gaps = 27/135 (20%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY+L G
Sbjct: 551  RLVGLKQLPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAG 609

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLK 1047
            +V H G     GHY SL   +        +  W  FDDE V+A  +       G   N+ 
Sbjct: 610  IVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNM- 660

Query: 1048 ISSSDVYVLFYERVH 1062
               +  YVLFY+ +H
Sbjct: 661  ---ATAYVLFYKAMH 672

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           + G  N GNTCY NS++QCL+     R
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLR 166

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 122/279 (43%), Gaps = 61/279 (21%)

Query: 574 LLQPQPQRAYN-------IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFR 626
           LL P+ Q+ +N       IPT+ Q+        + GL N+G+TCY++S++QCL    +F 
Sbjct: 109 LLTPKIQKYWNRISNETSIPTLTQAH------GLKGLVNMGSTCYMSSILQCLMHNPLFV 162

Query: 627 TLFISANYKNY--LQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPT-GFLKVVN-Q 682
            L +   + NY  +Q P    S        +++ + ++ Y  G     P  G + ++N  
Sbjct: 163 DLSMKGVHYNYCKIQDPMKCMSC-------AIDNIISETY--GNKKTTPNEGLVDILNCS 213

Query: 683 LRPDLKIPD-DQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKH 741
            R +  +    QQD  EFL  +L+++H          NDY    +++ +  +++  ++K 
Sbjct: 214 WRVNKNLAGYTQQDAHEFLQFILNQMH----------NDYKLNEIHDTNKQEMNGTDFKT 263

Query: 742 WFDKNVIGNGISPID----DIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPRRSM 794
             + N     +   +     IFQG +++ + C  C     TT +           P   +
Sbjct: 264 MVNGNSSKEHLHLCNCLPHTIFQGFLKSIISCSECKAQSQTTID-----------PYMDL 312

Query: 795 KLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
            L   G+ST     L +C+  F   E L  +  ++C +C
Sbjct: 313 SLDVKGKST-----LYECLESFHRTERLH-DFTYNCKKC 345

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 47/115 (40%), Gaps = 30/115 (26%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI------------------ 980
            + ++ + L  I+VI L RF + +T  +  +   + +PL LN+                  
Sbjct: 353  RQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNE 412

Query: 981  -ILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
               K+   M Y L G+V H GT+  GHY +                WY F+D VV
Sbjct: 413  KTNKSTPDMIYELTGIVTHRGTVNEGHYITY--------TKTADGVWYQFNDSVV 459

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 67/136 (49%), Gaps = 25/136 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTK----KNSTVITYPLIL--NIILKNNETMKYRLFGV 995
            + +    LP  L++HL RF Y   +    K  + + YPLIL  N   K  +T+KY L G+
Sbjct: 511  RAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGI 570

Query: 996  VNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLKI 1048
            V H G     GHY +L   +        +  W ++DDE V++ ++       G +K    
Sbjct: 571  VIHVGDGPQMGHYVALCKTE--------KYGWLFYDDETVESVSEETVLKFIGDEK---- 618

Query: 1049 SSSDVYVLFYERVHDQ 1064
            + S  YVLFY+++ D+
Sbjct: 619  TQSTAYVLFYKKLGDK 634

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           + G  N GNTCY NS++QCL+    FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

 Score = 35.8 bits (81), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 12/79 (15%)

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCIN 814
           I++IFQG + N ++C  C   T     F  L + +          G +  +RV     + 
Sbjct: 437 INEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEVKEN-------GDTDIQRV-----LK 484

Query: 815 MFTDDEVLSGENAWDCPRC 833
            ++  E+L+G N ++C +C
Sbjct: 485 YYSQREMLNGSNKFNCSQC 503

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 80/191 (41%), Gaps = 40/191 (20%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKI--FRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
            GL NLGN+CY+NS++Q L    +  +   F+ + +   +  P  +      KL N++  
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYPANNLKCQWIKLLNAMKH 382

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
              K+Y NG   + PT F K + +   +    + QQD  EFL  LLD L           
Sbjct: 383 E-PKLYANG---IKPTTFKKCIGKNHEEFS-SNRQQDAMEFLTFLLDSLD---------- 427

Query: 719 NDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
                                +++F  N  G   S  +D+ +  ME+ LQC +CG   ++
Sbjct: 428 ---------------------RNFFSDNSAG--ASNPNDLMRFMMEDRLQCNKCGKVKYS 464

Query: 779 YSTFYVLSLAI 789
           Y     + L +
Sbjct: 465 YEPAEAIQLPL 475

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 97/249 (38%), Gaps = 70/249 (28%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
            + GL N+G+TC+++S+IQ +     F    +S  + N      G++      +S +L+ 
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKC-----VSCALDE 185

Query: 659 LFNKMYLNG----GCSVVPTGFLKVVNQLRPDLKI-----PDDQQDTQEFLMILLDRLHD 709
           +    Y NG      S V  GF   VN L     I        QQD  E+   LL++LH 
Sbjct: 186 IACDFYGNGPGTGKSSSVSKGF---VNLLSASWHINHHLVGSSQQDAHEYWQFLLNQLHT 242

Query: 710 ELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISP-----IDDIFQGQME 764
           + +                                  V G+  +P        IFQG ++
Sbjct: 243 DHAR---------------------------------VFGSSKAPDCQCITHRIFQGYLK 269

Query: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824
           N+LQC +CG++         LSL I                  KLEDC++ F  +E L+ 
Sbjct: 270 NTLQCSQCGFSKTTIDPIMDLSLEIKNNP--------------KLEDCLDHFQREETLT- 314

Query: 825 ENAWDCPRC 833
           +  ++C  C
Sbjct: 315 DFHYECQSC 323

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 61/128 (47%), Gaps = 24/128 (18%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI---ILKNNE----TMKY 990
            VK +     P +LVI L RF + L  +++ +   + +PL LN+   + +  +     + Y
Sbjct: 330  VKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIAY 389

Query: 991  RLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISS 1050
             L  VV+H GT+  GHYT++   +          +W+ F+D VV +  +       ++  
Sbjct: 390  DLLNVVSHQGTVDQGHYTTVSKTE--------DGQWFKFNDSVVTSVTEE------QVLE 435

Query: 1051 SDVYVLFY 1058
               Y+LFY
Sbjct: 436  QQAYLLFY 443

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 60/136 (44%), Gaps = 25/136 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYD----LTKKNSTVITYPLILNIILKNNETM--KYRLFGV 995
            +T+    LP  L +HL RF Y        K    I YPL LN+      ++  KY+L G+
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 996  VNHTGTL-VSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLKI 1048
            V H G+    GHY ++   D        +  W  FDDE     N+       G +K    
Sbjct: 678  VVHMGSSPQQGHYVAICKTD--------KYGWLLFDDETASWINEEEVLSFIGDEK---- 725

Query: 1049 SSSDVYVLFYERVHDQ 1064
            S +  YVLFYE V D+
Sbjct: 726  SQNTAYVLFYEEVKDE 741

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           I G  N GNTCY NS++QCL+    F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 52/105 (49%), Gaps = 19/105 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTVIT----YPLILNI--------ILKNNETMK 989
            K + F + P IL + L RF YD        I     +P  +++        + +N E+ K
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            Y L GV+ HTG + +GHY +++  DL+        +WY FDDE V
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQ-------DQWYRFDDEKV 481

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 88/235 (37%), Gaps = 64/235 (27%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L          Q P  + S      ++S+ +  
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV--------YQIPTENESP-----NDSVPLAL 253

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S +P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 254 QRAFYQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMK-------- 305

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 779
                                       G  +   ++++F G+M++ ++C    Y +   
Sbjct: 306 ----------------------------GTPVEGKLNELFVGKMKSYIKCINVDYESSRV 337

Query: 780 STFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
             F+ L L +  +++K             LE+    + + E+++GEN +     G
Sbjct: 338 EDFWDLQLNV--KNLK------------GLEESFKNYIEIELMNGENQYAAQDFG 378

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 63/134 (47%), Gaps = 22/134 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYD--LTKKNSTVITYPLILNI--ILKNNETMKYRLFGVVN 997
            KT+ F  LPK L +HL RF  D  +  K    I YPL L +     N+    Y L GVV 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 998  HTG-TLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV-----KADNKHGSDKNLKISSS 1051
            H G +   GHY S+   +        +  W  +DDE +     +A   H  + N  I++ 
Sbjct: 591  HVGASPTHGHYVSICKHE--------KYGWLMYDDETIESIPEEAVTSHVGEPNNPITA- 641

Query: 1052 DVYVLFY-ERVHDQ 1064
              YVLFY E++ ++
Sbjct: 642  --YVLFYSEKIQNK 653

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 70/185 (37%), Gaps = 42/185 (22%)

Query: 652 LSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
           L + +  +    YL+G   V P  F+K++ +  P L     QQD  EFL  LL+ + D  
Sbjct: 378 LKDIMECITENRYLSG--VVSPAEFVKLLKRQNP-LFNSTMQQDAHEFLNFLLNNISDFA 434

Query: 712 SNQQHVANDYPNLLLYNADALKVSNNE---YKHWFDKNVIGNGISPIDDIFQGQMENSLQ 768
                          Y ++ LK SN E     H F           + D F+G + N ++
Sbjct: 435 GK-------------YKSNYLKSSNEEECEISHDF-----------VKDQFEGVLLNRIK 470

Query: 769 CKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAW 828
           C  C   + N   F    + I              ++ + ++D    F   E+L G N +
Sbjct: 471 CLTCDCVSANEEPFLDFPIEI------------QNDEAINIQDTFRSFYQREILCGPNKF 518

Query: 829 DCPRC 833
            C  C
Sbjct: 519 YCNEC 523

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           + G  N G+TCY NS++QC++    FR
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFR 146

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 90/234 (38%), Gaps = 62/234 (26%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L        Y  P  G         ++S+ +  
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YGIPTNGENP------NDSVPLAL 250

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S  P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 251 QRAFYQLQVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRM--------- 301

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
                       K +N E K              +++IF G+M++ ++CK   Y +    
Sbjct: 302 ------------KGTNVEGK--------------LNEIFVGKMKSYIRCKNVDYESSRVE 335

Query: 781 TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
            F+ + L +  ++ K             L++    + + E+++GEN +  P  G
Sbjct: 336 DFWDIQLNV--KNFK------------SLQESFENYIEVELMNGENQYAAPDFG 375

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 57/120 (47%), Gaps = 20/120 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKNNETMK- 989
            K + F + P +L + L RF YD     L K N        +   P +   +LK     K 
Sbjct: 381  KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNLKI 1048
            Y+L GV+ HTG + +GHY +++   LE        +WY FDDE V K D K   D+N  +
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLE-------DQWYRFDDEKVWKVDKKQVFDENFGL 493

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 58/134 (43%), Gaps = 27/134 (20%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 548  RLVGLKQLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAG 606

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLK 1047
            +V H G     GHY SL            +  W  FDDE V+A  +       G   N+ 
Sbjct: 607  IVVHMGGGPQHGHYVSLCKHQ--------KFGWLLFDDETVEAVKEETVLEFTGESANM- 657

Query: 1048 ISSSDVYVLFYERV 1061
               +  YVLFY+ V
Sbjct: 658  ---ATAYVLFYKAV 668

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 9/53 (16%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ-PPKGSRSAHSSK 651
           + G  N GNTCY NS++QCL+     R        +N LQ P K   S H  K
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLR--------ENILQFPEKPIESGHPRK 183

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 17/102 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP+IL +HL RF Y    +N+ +     ITYPL L +  K + ++  KY L G
Sbjct: 541  RVVGLKKLPRILALHLKRFKYS-EAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTG 599

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVK 1035
            VV H G     GHY S+   D     + G   W +FDDE V+
Sbjct: 600  VVLHMGGGPQHGHYVSVCKTD-----NFG---WLFFDDETVE 633

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 579 PQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFR 626
           P+ A  +P  + S+ ++      G  N GNTCY NS++QCLF    FR
Sbjct: 98  PKVAVGMPFGDGSNKIF------GYENFGNTCYCNSILQCLFNLTEFR 139

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 62/130 (47%), Gaps = 19/130 (14%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNII--LKNNETMKYRLFG 994
            +++    LP  L +HL RF Y  T KNS +     + YPL L++     N+   KY L G
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSET-KNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSG 662

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISS--S 1051
            +V H G     GHY SL   D     + G   W  FDDE V++ ++      +  SS  +
Sbjct: 663  IVVHMGGGPQHGHYVSLCKND-----NFG---WLLFDDETVESVSEKTVLDFVGDSSTLT 714

Query: 1052 DVYVLFYERV 1061
              YVLFY  +
Sbjct: 715  TAYVLFYREL 724

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 584 NIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFR 626
           N+P  + S+ V+      G  N GNTCY NS++QCL+    FR
Sbjct: 120 NMPYGDGSNKVF------GFENFGNTCYCNSVLQCLYNMTEFR 156

 Score = 38.5 bits (88), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 49/141 (34%), Gaps = 38/141 (26%)

Query: 693 QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGI 752
            QD  EFL  LL+ L D L+N      D               + E+   F         
Sbjct: 494 HQDAHEFLNFLLNELSDYLNNGAKSGKD---------------DEEHSLNF--------- 529

Query: 753 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDC 812
             I DIFQG + N ++C  C   T     F    + +P  S               ++  
Sbjct: 530 --IKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPDDS------------ETDIQAL 575

Query: 813 INMFTDDEVLSGENAWDCPRC 833
           +  F   E+LSG N + C  C
Sbjct: 576 LQNFDQREMLSGPNKFYCNVC 596

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 23/134 (17%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNS----TVITYPLILNIILKNNETMK--YRLFGV 995
            + +    LP IL +HL RF Y   K  +      + YPL LN+    + +++  Y L GV
Sbjct: 638  RIVGLKQLPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGV 697

Query: 996  VNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH-----GSDKNLKIS 1049
            V H G+    GHY SL   D        +  W  FDDE V++ ++        D N   +
Sbjct: 698  VIHMGSSPQHGHYVSLCKND--------KFGWLLFDDETVESVSESTVLEFTGDPN---N 746

Query: 1050 SSDVYVLFYERVHD 1063
             +  YVLFY+ + D
Sbjct: 747  QATAYVLFYKEIKD 760

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           + G  N GNTCY NS++QCL+    FR
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFR 197

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 60/135 (44%), Gaps = 27/135 (20%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 548  RLVGLKQLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAG 606

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLK 1047
            +V H G     GHY SL   +        +  W  FDDE V+A  +       G   N+ 
Sbjct: 607  IVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNM- 657

Query: 1048 ISSSDVYVLFYERVH 1062
               +  YVLFY+ ++
Sbjct: 658  ---ATAYVLFYKAMY 669

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 8/48 (16%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSA 647
           + G  N GNTCY NS++QCL+     R        +N LQ PK SR +
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLR--------ENILQFPKKSRES 178

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 54/142 (38%), Gaps = 35/142 (24%)

Query: 694 QDTQEFLMILLDRLHD--ELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNG 751
           QD  EF   LL+ L +  E  N++  A+D       N+D+    +  +            
Sbjct: 432 QDAHEFFNFLLNELSEYIERENKKIAASDI------NSDSEPSKSKNF------------ 473

Query: 752 ISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLED 811
              I D+FQG + N ++C  C   T     F    + +              ++   +++
Sbjct: 474 ---ISDLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEV------------QGDEETDIQE 518

Query: 812 CINMFTDDEVLSGENAWDCPRC 833
            +  +   E+L+G N + C  C
Sbjct: 519 ILKSYHQREMLNGSNKFYCDEC 540

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 59/132 (44%), Gaps = 27/132 (20%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 550  RLVGLKQLPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSG 608

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLK 1047
            +V H G     GHY SL   ++      G   W  FDDE V+A  +       G   N+ 
Sbjct: 609  IVVHMGGGPQHGHYVSLCKHEI-----FG---WLLFDDETVEAVKEEAVLEFTGESPNM- 659

Query: 1048 ISSSDVYVLFYE 1059
               +  YVLFY+
Sbjct: 660  ---ATAYVLFYK 668

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 9/53 (16%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ-PPKGSRSAHSSK 651
           + G  N GNTCY NS++QCL+         +S+  +N LQ P K + S H  K
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYN--------LSSVRENILQFPEKPNESTHPRK 184

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (48%), Gaps = 27/134 (20%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            +T+    LPKIL +HL RF Y   K  S +     I YPL L +  K++  +   Y L G
Sbjct: 583  RTVGLKQLPKILSLHLKRFKYS-EKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNG 641

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLK 1047
            +V H G     GHY ++   D+      G   W  +DDE V++ ++       G +K++ 
Sbjct: 642  IVIHMGGGPQHGHYVAICKHDM-----FG---WLLYDDETVESIDEETVFKFVGDEKDM- 692

Query: 1048 ISSSDVYVLFYERV 1061
               +  YVLF++ V
Sbjct: 693  ---TTAYVLFFKEV 703

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRT 627
           S  + GL N GNTCY NS++QCLF     RT
Sbjct: 129 STKVFGLENFGNTCYCNSVLQCLFNLSELRT 159

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 12/79 (15%)

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCIN 814
           +  +FQG M NS++C  C   T +   F  L  AIP           + ++ V ++D ++
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIP----------VNEDEEVNIQDMLS 556

Query: 815 MFTDDEVLSGENAWDCPRC 833
            F   E+L+G N + C  C
Sbjct: 557 NFNQREMLNGANKFYCDSC 575

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 59/139 (42%), Gaps = 32/139 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRF--YYDLTKKNSTVITYPLI---------------LNIIL 982
              + I   + P+IL++HL RF  +Y  T K +  + +PL                     
Sbjct: 965  ATRQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGDGDGD 1024

Query: 983  KNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDD-EVVKADNKHG 1041
                   Y L  V NH G L SGHYT+ V   ++        KWY FDD EV + D +  
Sbjct: 1025 DGGRENVYDLIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDSEVREVDAE-- 1075

Query: 1042 SDKNLKISSSDVYVLFYER 1060
                  ++SS  Y+LFY R
Sbjct: 1076 -----SVASSFGYLLFYRR 1089

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 83/210 (39%), Gaps = 23/210 (10%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK----GSRSAHSSKL 652
           S    GL NLG+TC+INS++QCL      R  F+   +   L        G R A     
Sbjct: 347 SSGTMGLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVA--GAF 404

Query: 653 SNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
           +  +  LF    +    +   + F   +   RP L  P  QQD+ E +  LL  LH++L+
Sbjct: 405 AEVVQALFGDK-IAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLN 462

Query: 713 --------NQQHVANDYPNLLLYNADALKVSNNE---YKHWFDKNVIGNGISPIDDIFQG 761
                    Q   +      +  +A        E      W    +  + +  I D+F G
Sbjct: 463 RAPEGPRVGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQNDSV--ITDLFAG 520

Query: 762 QMENSLQCKRC--GYTTFNYSTFYVLSLAI 789
            ++++L C  C     TF+  T   + LA+
Sbjct: 521 MLKSTLTCLTCRRSSVTFDPCTELAVPLAV 550

 Score = 38.9 bits (89), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 794 MKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
           ++  + GR  ++   LEDC+++FT  EVL+  ++W CP C
Sbjct: 921 VRHERAGRQKQE-TTLEDCLDLFTAPEVLNTADSWYCPAC 959

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 105/273 (38%), Gaps = 69/273 (25%)

Query: 575 LQPQPQRAYNIPTIEQSSNVYVSLSIT-----GLRNLGNTCYINSMIQCLFAAKIFRTLF 629
           LQ +    +N   ++   N  + L  +     G  NLGN+CY+NS++QCLF   +     
Sbjct: 302 LQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWAT 361

Query: 630 ISANYKNYLQP-----PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLR 684
           + AN      P     P  +      K+ N+   L  + Y  G   + P  F   V Q  
Sbjct: 362 LLANLIGNEFPLDCVYPTTNLKCQLIKILNAFK-LNPENYPEG---IKPQSFKNYVGQSN 417

Query: 685 PDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFD 744
            + K  ++QQD  EFL  LL++L   L                     K  NN       
Sbjct: 418 KEFK-SNNQQDATEFLTFLLEQLEKTL--------------------FKKDNNP------ 450

Query: 745 KNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTE 804
                      ++I +  ME+ +QC+ CG   ++Y          P   ++L   G +  
Sbjct: 451 -----------NNIMKFIMEDKIQCQSCGNVKYSYE---------PTEYIQLPLDGTNNP 490

Query: 805 KRVKLEDCINMFTDDEVLSGENA-WDCPRCGPT 836
           + + +E   N F      +GEN  +DCP C  T
Sbjct: 491 QNL-VETLTNFF------NGENIDFDCPTCKKT 516

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 96/236 (40%), Gaps = 57/236 (24%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY---LQPPKGSRSAHSSKLSNSLN 657
            GL NLGN+CYINS++QCL    + +T  +SA  +++   +  P  +      KL+N++ 
Sbjct: 322 CGLINLGNSCYINSVLQCLLNGGV-KTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAIK 380

Query: 658 MLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 717
            L  ++Y +G   + P  F K + Q   +    + QQD  EFL    D L          
Sbjct: 381 -LEPELYPSG---IRPRSFKKCIGQAHEEFS-SERQQDALEFLSFFNDTL---------- 425

Query: 718 ANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF 777
                                     DK +     +   D+ +  +EN LQC +CG    
Sbjct: 426 --------------------------DKKIFSRSENNPSDLMRYIIENRLQCTKCG--KV 457

Query: 778 NYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
            Y+T    S+ +P      S+  +S   R+     +  F  +E+      + CP+C
Sbjct: 458 KYTTDINESMLVPLEENSDSQHSQSLLDRL-----VEYFHGEEL-----DFKCPQC 503

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 61/130 (46%), Gaps = 19/130 (14%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNNETMKYRLFG 994
            + I    LPK LV+HL RF Y   +KN  +     + YP  LNI  +  ++ + KY L  
Sbjct: 533  RLIGIKELPKHLVVHLKRFKY-CEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNS 591

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA--DNKHGSDKNLKISSS 1051
            +V H G     GHY +L     +H        W  +DDE V+A  D       N +  S+
Sbjct: 592  IVVHIGESPQLGHYVTLC----KHK----SYGWLIYDDETVQAVSDELVSRILNNEQRSA 643

Query: 1052 DVYVLFYERV 1061
              Y+LFYE V
Sbjct: 644  TAYLLFYEEV 653

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%)

Query: 592 SNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFIS 631
           SN  V   + G +N G TCY NS++Q LF    FR   I 
Sbjct: 97  SNYDVGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIG 136

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 60/139 (43%), Gaps = 11/139 (7%)

Query: 576 QPQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYK 635
           +PQ +R +     E +   ++S +  GL+NLGNTCY+NS +Q L+  K  R   +     
Sbjct: 35  KPQKERRFIEDLDEGAQMQHLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVL----- 89

Query: 636 NYLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD--- 692
           NY  P +        +L + L   F ++      SV P   L ++ +  P     D    
Sbjct: 90  NYKVPREKPSEEQHHQLVSELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESG 149

Query: 693 ---QQDTQEFLMILLDRLH 708
              QQD +E    + + L 
Sbjct: 150 FYKQQDAEELFTQIFNSLR 168

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 979  NIILKNNETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            N+    N +  Y L GV+ H G    SGHY S +  +++ +      KWY F+D+ V
Sbjct: 369  NLAQGENPSCVYNLIGVITHQGANSESGHYQSFIRDEVDEN------KWYRFNDDKV 419

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 62/131 (47%), Gaps = 25/131 (19%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LPK L +HL RF Y   ++NS +     ++YPL L +    N ++   Y L G
Sbjct: 559  RVVGLKQLPKTLALHLKRFKYS-EQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSG 617

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHG-----SDKNLKI 1048
            +V H G     GHY SL   +        +  W  FDDE V+A ++        DK+   
Sbjct: 618  IVVHMGGGPQHGHYISLCKNE--------KFGWLLFDDETVEAISEQAVLQYTGDKDTMT 669

Query: 1049 SSSDVYVLFYE 1059
            ++   YVLFY+
Sbjct: 670  TA---YVLFYQ 677

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 40/195 (20%)

Query: 646 SAHSSKLSNSLNMLFNKM----YLNGGCSVVPTGFLKVV---NQLRPDLKIPDDQQDTQE 698
           S+  S L N L  +F  +    YL G   V P+ F++++   N L   +      QD  E
Sbjct: 390 SSAESNLYNGLKDIFECITEHSYLTG--VVTPSAFIEMLKRENVLFSSMM----HQDAHE 443

Query: 699 FLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDI 758
           FL+ LL+ + D L  Q   A    N  +Y++   + ++   K++            + DI
Sbjct: 444 FLIFLLNEISDFLDKQNKNA---LNSKIYDSSQGRRNSGTVKNF------------VSDI 488

Query: 759 FQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTD 818
           FQG + N ++C  C  TT     F    + +                 + +++ +  F  
Sbjct: 489 FQGTLTNRIKCLTCDNTTARDEPFLDFPIEVQENV------------DIDIQEILESFHQ 536

Query: 819 DEVLSGENAWDCPRC 833
            E+L G N + C  C
Sbjct: 537 KEMLHGPNKFYCDEC 551

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           I G  N GNTCY NS++QCL+    FR
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFR 175

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 61/121 (50%), Gaps = 7/121 (5%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKI--FRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNML 659
           GL NLGN+CY+NS++QC +   I  +    +   +   +  P  +      KL+N++  +
Sbjct: 327 GLINLGNSCYLNSILQCFYNGGIPNWSVEELGTEFPLSVVYPSNNLKCQLLKLTNAMK-I 385

Query: 660 FNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 719
            + +Y NG   + PT F K +     +    + QQD  EFL  ++D L +++ N  +  N
Sbjct: 386 ESDLYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKIFNTANNPN 441

Query: 720 D 720
           D
Sbjct: 442 D 442

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 107/261 (40%), Gaps = 49/261 (18%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLN-- 657
           I GL N GNTC++NS++Q L ++K      ++A   N ++   GS +    K + +L   
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSK-----ELAAFLDNVIE--NGSENNGDIKFTETLREL 109

Query: 658 -MLFNKMYLNGGCSVVPTGFLKVV-NQLRPDLKIPDDQQDTQEFLMILLDRLHDEL---- 711
            ++ NK Y            LK + N    ++ +  DQ+D QEF   +L  L   +    
Sbjct: 110 LLILNKKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPS 169

Query: 712 SNQQHVAN-----DYPNLLLYNADALKVSNNEY---KHWFDKNVIGNG----------IS 753
           + ++   N     D P+  L   D L      Y   +     +V+ N           I+
Sbjct: 170 TEKKEERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPDQKLYSPFKLIT 229

Query: 754 PIDDIFQGQMENSLQCKRCGYT-TFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDC 812
           P+D    G     + C  CG      YS F  LSL +P  S+  S L        KL + 
Sbjct: 230 PLD----GITAERIGCLTCGENGGIRYSVFSGLSLNLPSESLNQSTL--------KLSEL 277

Query: 813 INMFTDDEVLSGENAWDCPRC 833
           +N +   E++ G    +C RC
Sbjct: 278 LNEWVKPEIIEG---VECNRC 295

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 20/118 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIILKNNETMK- 989
            K + F + P +L + L RF YD     L K N        +   P +   +L+ N   + 
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNL 1046
            Y L GV+ HTG + +GHY +L+   LE        +WY FDDE V K   K   D+N 
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLE-------DQWYRFDDERVWKVSKKQAFDENF 490

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 83/234 (35%), Gaps = 62/234 (26%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L          Q P    +       +S+ +  
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV--------YQIPTSQENP-----KDSVVLAL 249

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S  P   +++      D      Q D QE   IL+DRL   +         
Sbjct: 250 QRAFYQLQVSQYPLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMK-------- 301

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
                        V N                  +++IF G+M++ ++C    Y +    
Sbjct: 302 ----------GTTVENK-----------------LNEIFVGKMKSFIKCINVDYESARTE 334

Query: 781 TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
            F+ + + +  +++K             L+D    + + E++ GEN +     G
Sbjct: 335 DFWDIQMNV--KNLK------------GLKDSFENYIEVELMDGENQYAAQDYG 374

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 89/236 (37%), Gaps = 62/236 (26%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
              GL+N G TCY+NS++Q  +  K FR L        Y  P  G         SNS+ +
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YHIPTDGETP------SNSVPL 243

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
              + +     S  P    ++      D      Q D QE   IL+DRL ++        
Sbjct: 244 ALQRAFYKLQRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENK-------- 295

Query: 719 NDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
                        +K +  E K              +++IF G+M++ ++C    Y +  
Sbjct: 296 -------------MKATEVEGK--------------LNEIFVGKMKSYIKCVNVEYESSR 328

Query: 779 YSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
              F+ + L +      L+ L ++ E  +++          E++ GEN +   R G
Sbjct: 329 VEDFWDIQLNVK----GLNGLNQAFENYIEV----------EMMDGENQYAAQRYG 370

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIILK-NNETMK 989
            K + F + P +L + L RF YD     L K N       ++   P +   + K   E+M 
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            Y L GV+ HTG + +GHY +++   L+        KWY FDD+ V
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKV 473

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 90/235 (38%), Gaps = 64/235 (27%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L        Y  P     + H S  +NS+ +  
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIP-----TEHESP-NNSVPLAL 251

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S +P   L++      D      Q D QE   IL+DRL +           
Sbjct: 252 QRAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLEN----------- 300

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 779
                                    N+ G  +   +++IF G+M++ ++C    Y +   
Sbjct: 301 -------------------------NMKGTPVEGKLNEIFVGKMKSYIKCINVDYESARV 335

Query: 780 STFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
             F+ L L +  ++ K             L++  + + + E+++GEN +     G
Sbjct: 336 EDFWDLQLNV--KNFK------------NLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 26/112 (23%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIILK------- 983
            K + F + P +L + L RF YD     + K N       T+   P +   +LK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 984  -NNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
             +     Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 60/138 (43%), Gaps = 23/138 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTVIT----YPLILNII--------LKNNETMK 989
            K + F + P IL + L RF YD        I     +P   +            NNE   
Sbjct: 378  KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNLKI 1048
            Y L GV+ HTG + +GHY +++  DLE        +WY FDDE V K   K   ++N  +
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLE-------DQWYRFDDEKVWKVTKKQVFEENFGL 490

Query: 1049 ---SSSDVYVLFYERVHD 1063
               S  D+  +  E+  D
Sbjct: 491  DRRSEDDLKCMTREQYED 508

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 87/235 (37%), Gaps = 64/235 (27%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L            P  S + +S     S+ +  
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYKI--------PTESETPNS-----SVPLAL 247

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S +P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 248 QRAFYQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM--------- 298

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 779
                                      +G  +   + ++F G+M++ ++C    Y +   
Sbjct: 299 ---------------------------LGTPVEGKLSELFVGKMKSYIKCVNVEYESSRV 331

Query: 780 STFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
             F+ L L +  +++K             L+D    + + E+++GEN +     G
Sbjct: 332 EDFWDLQLNV--KNLKC------------LKDSFENYIEIELMNGENQYAAQDFG 372

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 86/204 (42%), Gaps = 51/204 (25%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSL-NML 659
           TGL N GN C+INS IQ L       T ++SA  ++        ++A +  L N L  ML
Sbjct: 76  TGLVNPGNDCFINSSIQALVPLDKLTT-YLSATLED-------EKTASTLPLHNGLATML 127

Query: 660 FNKMYLNGGCSVVPTGFLKVVNQLRPDL--KIPDDQQDTQEFLMILLDRLHDELSNQQHV 717
                L      V +   + + QL      KI   Q D  EF  ++L+RL++E       
Sbjct: 128 LELQQLRSDPKSVSSK--RFIQQLETIFGGKISRQQNDAHEFTQLILERLNEE------- 178

Query: 718 ANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTT- 776
                NL L +AD                        +   F+G + N L C +CG T+ 
Sbjct: 179 -----NLTLDHAD------------------------LTVPFKGIVGNHLVCLQCGRTSH 209

Query: 777 FNYSTFYVLSLAIPRR-SMKLSKL 799
            N   FY+  L +P++ S+KLS L
Sbjct: 210 VNEQPFYIYELTLPQQGSVKLSDL 233

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 10/77 (12%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLT--KKNSTVITYP---LILNIILKNN-----ETMKY 990
            V+   F   P+I +IHLSR  ++     +N   + +    L+   ILK++     ET+KY
Sbjct: 318  VRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLPRQILKDHQCVGFETVKY 377

Query: 991  RLFGVVNHTGTLVSGHY 1007
            +L  +V HTG+   GHY
Sbjct: 378  KLKSIVKHTGSHYQGHY 394

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 35/134 (26%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI--ILKNNE------TMK 989
            +K      LP +LV+ L RF + ++  N  +   I +P IL++   LK+N+      ++ 
Sbjct: 341  IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKIS 1049
            Y L G+++HTG++  GHY +           I   +W+ F+D +V            KI 
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCK--------IENGEWFKFNDSMVT-----------KIL 441

Query: 1050 SSDV-----YVLFY 1058
              DV     Y+LFY
Sbjct: 442  EKDVLKEQAYLLFY 455

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 98/241 (40%), Gaps = 53/241 (21%)

Query: 584 NIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKG 643
           N+PT++Q         + GL N+G+TCY++S++QC+         F+   + N       
Sbjct: 126 NVPTVDQID------GMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHSNNCTLKMA 179

Query: 644 SRSAHSSKLSNSL-----NMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----Q 693
           S    S  +S+ +     N + N        +    GF   +N L    K+ ++     Q
Sbjct: 180 SNCT-SCAISSIIADFYGNSVQNDYKSKKNNNNKHEGF---INLLTCSWKVNENLAGYSQ 235

Query: 694 QDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGIS 753
           QD  E+   +L+ +H +  +  H  +D                       DK  + N + 
Sbjct: 236 QDAHEYWQFILNHIHQDYKSSMHSHSD-----------------------DK--LCNCV- 269

Query: 754 PIDDIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLE 810
            +   FQG +++S+ C  C     TTF+   F  LSL I  +   L++   +  K+ +L 
Sbjct: 270 -VHSSFQGSLKSSIVCPECNNDSKTTFD--PFIDLSLGIKDKH-TLTECLDNFHKKEQLH 325

Query: 811 D 811
           D
Sbjct: 326 D 326

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 63/137 (45%), Gaps = 27/137 (19%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP  L +HL RF Y   ++N+ +     + YPL L++    + ++  KY L G
Sbjct: 534  RIVGLKQLPHTLALHLKRFKYS-EEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTG 592

Query: 995  VVNHT-GTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLK 1047
            VV H  G+   GHY SL   D        +  W  FDDE V++  +       G   N  
Sbjct: 593  VVIHMGGSPQHGHYVSLCKND--------KFGWLLFDDETVESVTEKTVLEFTGDSSN-- 642

Query: 1048 ISSSDVYVLFYERVHDQ 1064
               +  YVLFY+ + ++
Sbjct: 643  --QATAYVLFYKELDEK 657

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 58/141 (41%), Gaps = 36/141 (25%)

Query: 693 QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGI 752
           QQD  EFL  LL+ L + L N  H++  +P            SN      F   VI    
Sbjct: 422 QQDAHEFLNFLLNELSEYLQN--HIS--HP------------SNKPTDIPFKNYVI---- 461

Query: 753 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDC 812
               D+FQG + N ++C  C   T     F    L  P        +G   ++ + ++D 
Sbjct: 462 ----DLFQGVLTNRIKCLTCDNITSRDEPF----LDFP--------IGVKGDENIDIQDV 505

Query: 813 INMFTDDEVLSGENAWDCPRC 833
           +  +   E+L+G N + C +C
Sbjct: 506 LRCYHTREMLNGSNKFYCSQC 526

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFR 626
           S  + G  N GNTCY NS++QCL+     R
Sbjct: 133 SNKVFGYENFGNTCYCNSVLQCLYNLTELR 162

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query: 578 QPQRAYN-IPTIEQSSNV-YVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYK 635
           +PQ+ +  I  +++S+ + ++S    GL+NLGNTCY+NS +Q L+  +  R   ++    
Sbjct: 81  KPQKEHRFIEDLDESAQMQHLSQLPVGLKNLGNTCYMNSTLQALYQIRPLREEILN---- 136

Query: 636 NYLQPPKGSRSAHSS-KLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-- 692
              QPPK +RS     +L   L   F ++      S  P   L  + +  P     D   
Sbjct: 137 --FQPPKENRSGEQHIQLVAELKRCFQQLRDRPQESTTPILLLATLRKCYPQFAERDQES 194

Query: 693 ----QQDTQEFL 700
               QQD +E  
Sbjct: 195 GFYKQQDAEELF 206

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 985  NETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            N +  Y L GV+ H G    SGHY S +  + + +      KWY F+D+ V
Sbjct: 421  NPSCVYNLIGVITHQGANSESGHYQSFIRDEADEN------KWYRFNDDKV 465

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 77/191 (40%), Gaps = 40/191 (20%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKI--FRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
            GL NLGN+CY+NS++Q L    +  +   F+ + +   +  P  +      KL N++  
Sbjct: 323 CGLINLGNSCYLNSVLQSLLNGGVPNWSLDFLGSEFPLDVVYPASNLKCQWIKLLNAMKC 382

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
              ++Y NG   + PT F K V +   +    + QQD  EFL  L D L  +  +    A
Sbjct: 383 E-PEIYPNG---IKPTTFKKCVGKSHEEFS-SNRQQDAMEFLTFLSDLLDRKFFSDSSSA 437

Query: 719 NDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
           +  PN                                 D+ +  ME+ LQC +CG   ++
Sbjct: 438 DSNPN---------------------------------DLVRFMMEDRLQCNKCGKVKYS 464

Query: 779 YSTFYVLSLAI 789
           Y     + L +
Sbjct: 465 YEPAEAIQLPL 475

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 10/112 (8%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL+NLGNTCY+N+ +QCLF  +  R + ++    + + P          +L N  + L  
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSPADEVHQKIVLELRNCFDSLDK 169

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILLDRL 707
           K +     +V+P   L V+ +  P     D       QQD +E    L   L
Sbjct: 170 KKF----QAVMPLMLLNVLRKAYPQFAERDPQGGFYKQQDAEELFTQLFHSL 217

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 89/234 (38%), Gaps = 62/234 (26%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L          Q P  + S      +NS+ +  
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV--------YQIPTENESP-----NNSVPLAL 249

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S  P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 250 QRSFYQLQVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM--------- 300

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
                                   K     G+  +++IF G+M++ ++C    Y +    
Sbjct: 301 ------------------------KGTSVEGM--LNEIFVGKMKSYIKCIDVDYESSRVE 334

Query: 781 TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
            F+ L L +  ++MK             L++  + + + E+L+GEN +     G
Sbjct: 335 DFWDLQLNV--KNMK------------GLKESFDNYIEIELLNGENQYQAQDYG 374

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 47/104 (45%), Gaps = 18/104 (17%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIILKNNETMKY 990
            K + F + P +L + L RF YD     + K N       T+   P + +   +      Y
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 991  RLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
             L GV+ H G + +GHY +L+   LE        +WY FDDE V
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKPGLE-------DQWYRFDDERV 476

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 89/235 (37%), Gaps = 64/235 (27%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L        Y  P     + H S  +NS+ +  
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIP-----TEHESP-NNSVPLAL 251

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S +P   +++      D      Q D QE   IL+DRL +           
Sbjct: 252 QRAFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLEN----------- 300

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 779
                                    N+ G  +   + +IF G+M++ ++C    Y +   
Sbjct: 301 -------------------------NMKGTPVEGKLSEIFVGKMKSYIKCVNVDYESARV 335

Query: 780 STFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
             F+ L L +  ++ K             L++  + + + E+++GEN +     G
Sbjct: 336 EDFWDLQLNV--KNFK------------NLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 26/112 (23%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIILKNN----- 985
            K + F + P +L + L RF YD     + K N       T+   P +   +LK +     
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 986  ---ETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
                   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 69/144 (47%), Gaps = 42/144 (29%)

Query: 949  LPKILVIHLSRFYY--DLTKKNSTV---------------ITY------PL--ILNIILK 983
            LP++L+I L RF +  ++ K N                  I Y      P+  + + ILK
Sbjct: 945  LPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKKINYNHELLVPVESVSSAILK 1004

Query: 984  NNET-MKYRLFGVVNHTGTLV-SGHYTS-LVNKDLEHSVDIGRSKWYYFDD----EVVKA 1036
            NNE+  KY+L  VV H G+    GHYT+ + NKDL+        KW+  DD    E+  A
Sbjct: 1005 NNESSRKYKLRAVVYHHGSSPDGGHYTADIYNKDLK--------KWFMIDDVNITELEDA 1056

Query: 1037 DNKHGSDKNLKISSSDVYVLFYER 1060
            D  +G D  L   ++  Y+L YE+
Sbjct: 1057 DVVNGGDNGLDTRTA--YILMYEK 1078

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 90/235 (38%), Gaps = 64/235 (27%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L        Y  P     + H S  +NS+ +  
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIP-----TEHESP-NNSVPLAL 251

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S +P   L++      D      Q D QE   IL+DRL +           
Sbjct: 252 QRAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLEN----------- 300

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 779
                                    N+ G  +   +++IF G+M++ ++C    Y +   
Sbjct: 301 -------------------------NMKGTPVEGKLNEIFVGRMKSYIKCINVDYESSRV 335

Query: 780 STFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
             F+ L + +  ++ K             L++  + + + E+++GEN +     G
Sbjct: 336 EDFWDLQMNV--KNFK------------NLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 50/111 (45%), Gaps = 25/111 (22%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIILK------- 983
            K + F + P +L + L RF YD     + K N       T+   P +   +LK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 984  NNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            N     Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 485

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 26/129 (20%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTV----ITYPLILNI--ILKNNET-----MK 989
            +K +    LP +LV+ L RF + L   NS      I YP  LN+      +E+     M 
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEH-LMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMM 393

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKIS 1049
            Y L  V++H G++  GHYTS+          I   +W+ F+D ++ + ++  + +     
Sbjct: 394  YELVAVISHEGSVNQGHYTSM--------CKIPGGQWFRFNDSMIVSISEEEALRQ---- 441

Query: 1050 SSDVYVLFY 1058
                Y+LFY
Sbjct: 442  --QAYLLFY 448

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 92/242 (38%), Gaps = 52/242 (21%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
            + GL N+G+TC+++S+IQ      +    ++     N +   +      +S  S +L+ 
Sbjct: 134 GLCGLVNMGSTCFMSSIIQ-----TLVHNPYVLKTCMNQVHFSRCDIQDSASCFSCALDR 188

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHDELSN 713
           + +  Y     +   +     V+ L    KI  +     QQD  EF    L++LH     
Sbjct: 189 IVSNFYGPAADASFTSQQKGFVDLLLCSWKINRNLAGYSQQDAHEFWQFFLNQLH----- 243

Query: 714 QQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC- 772
                          AD ++V+  +     + N I +        FQG + +S+ C  C 
Sbjct: 244 ---------------ADHVRVTGKKSSKPEECNCISH------SAFQGSLRSSILCTDCH 282

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPR 832
             +   +     LSL I  ++              KL DC+  F + E L+  N   CP 
Sbjct: 283 DGSNITFDPMMDLSLEIKNKN--------------KLVDCLKSFHEGETLTDFNH-RCPN 327

Query: 833 CG 834
           CG
Sbjct: 328 CG 329

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 13/115 (11%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            GL+N G TCY+NS++Q  +  K FR L        Y  P +G   A      NS+++  
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YQIPTEGETPA------NSVSLAL 236

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 715
            + +     S  P    ++      D      Q D QE   IL+DRL +++   +
Sbjct: 237 QRAFFQLQRSSEPLDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGTE 291

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIILKNN-ETMK 989
            K + F + P +L + L RF YD     L K N       ++   P +   + +++    K
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            Y L GV+ HTG + +GHY +++   LE +       WY FDD+ V
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLEDA-------WYRFDDDKV 464

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 61/126 (48%), Gaps = 22/126 (17%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKN---STVITYPLILNI-----ILKNNETMKYRL 992
            +K +    LP +LV+ L RF +    +N   +  I +P  LN+       +NN ++ Y L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 993  FGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSD 1052
             GV++H GT+  GHY + +  D         + W+ F+D +V + ++       ++    
Sbjct: 383  NGVISHIGTVNEGHYIATLKLD--------SNNWFKFNDSMVTSISEE------EVLKDQ 428

Query: 1053 VYVLFY 1058
             Y+LFY
Sbjct: 429  AYLLFY 434

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 95/246 (38%), Gaps = 65/246 (26%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G  N+G+TC+++S++Q L         FI  N  +            ++ +S +L+ +  
Sbjct: 122 GFVNMGSTCFMSSILQVLI-----HNPFIVQNSMSQSHYSSCKIRNPNNCISCALDEIIA 176

Query: 662 KMYLNGGCSVVPTGFLKVVNQ--------LRPDLKIPDD-----QQDTQEFLMILLDRLH 708
           + Y N     V     K +NQ        L    KI D+     QQD  EFL  +L+RLH
Sbjct: 177 ESYGN----FVKYNNGKPINQYHDGFISMLNCSWKINDNFAGYSQQDAHEFLQFILNRLH 232

Query: 709 DELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 768
            +      + + Y N    N D+                       I  IFQG++++S+ 
Sbjct: 233 RDYK----LTSTYTN----NTDSCSC-------------------LIHSIFQGKLKSSIV 265

Query: 769 CKRCGYTTFNYSTFYV-LSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENA 827
           C  C   +   +  Y+ LSL I              + +  L  C++ F   E L   N 
Sbjct: 266 CPECHDNSKTVTDPYIDLSLDI--------------KDKATLYQCLDSFHKKETLHDYN- 310

Query: 828 WDCPRC 833
           + CP C
Sbjct: 311 YHCPNC 316

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 34/137 (24%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNIILKNNETMK------- 989
             +K +    LP +LV+ L RF + L   N  +   I +P  LN  +KN  + K       
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLN--MKNYCSTKEKDKHSE 402

Query: 990  --------YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHG 1041
                    Y L G+V+H GT+  GHY +           I   +W+ F+D +V + ++  
Sbjct: 403  NGKVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVSSISQE- 453

Query: 1042 SDKNLKISSSDVYVLFY 1058
                 ++     Y+LFY
Sbjct: 454  -----EVLKEQAYLLFY 465

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 106/264 (40%), Gaps = 60/264 (22%)

Query: 585 IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKN--YLQPPK 642
           +P++E+         ++GL N+G+TC+++S++QCL     F    +S  + N   ++ P 
Sbjct: 127 VPSMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPD 180

Query: 643 GSRSAHSSKLSNSLNMLFNKMYLNGGCSVV--PTGFLKVVNQLRPDLKIPDD-----QQD 695
              S    K+ + L    N    +   +     TGF+ +   L    KI  +     QQD
Sbjct: 181 KCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYL---LTCAWKINQNLAGYSQQD 237

Query: 696 TQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPI 755
             EF   +++++H      Q    D P     NA  +  +NN+                +
Sbjct: 238 AHEFWQFIINQIH------QSYVLDLP-----NAKEVSRANNKQCECI-----------V 275

Query: 756 DDIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDC 812
             +F+G +E+S+ C  C     TT +   F  LSL I  +               KL +C
Sbjct: 276 HTVFEGSLESSIVCPGCQNNSKTTID--PFLDLSLDIKDKK--------------KLYEC 319

Query: 813 INMFTDDEVLSGENAWDCPRCGPT 836
           ++ F   E L   N + C  C  T
Sbjct: 320 LDSFHKKEQLKDFN-YHCGECNST 342

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 56/135 (41%), Gaps = 30/135 (22%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI--ILKNNETMK----- 989
             +K +    LP +LV+ L RF + L   N  +   I +P  LN+       E+ K     
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 990  ------YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSD 1043
                  Y L G+V+H GT+  GHY +           I   +W+ F+D VV       S 
Sbjct: 405  KVPDIIYELIGIVSHRGTVNEGHYIAFCK--------ISGGQWFKFNDSVVT------SI 450

Query: 1044 KNLKISSSDVYVLFY 1058
               ++     Y+LFY
Sbjct: 451  AQGEVLKEQAYLLFY 465

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 100/250 (40%), Gaps = 54/250 (21%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ--PPKGSRSAHSSKLSNSL 656
            ++GL N+G+TC+++S++QCL     F    +S  + N  +   P    S    K+   L
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVGSPDKCFSCALDKIIQEL 194

Query: 657 NMLFNKMYLNGGCSVV--PTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHD 709
             + N    +   S     TGF+ +   L    KI  +     QQD  EF   +++++H 
Sbjct: 195 YGVLNTDQPSPSSSATNRQTGFIYL---LTCAWKINQNLAGYSQQDAHEFWQFIINQIH- 250

Query: 710 ELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
                Q   +D P     NA  +   NN+                +  +F+G +E+S+ C
Sbjct: 251 -----QSYTHDSP-----NAKEIDRVNNKRCECI-----------VHSVFEGSLESSIVC 289

Query: 770 KRC---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGEN 826
             C     TT +   F  LSL I              + + KL +C++ F   E L   N
Sbjct: 290 PGCQKNSKTTID--PFMDLSLDI--------------KDKKKLYECLDSFHKKEQLKDFN 333

Query: 827 AWDCPRCGPT 836
            + C  C  T
Sbjct: 334 -YHCGECNST 342

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 86/235 (36%), Gaps = 64/235 (27%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L        Y  P     + H S  +NS+ +  
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIP-----TEHESP-NNSVPLAL 251

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S +P   +++      D      Q D QE   IL+DRL +           
Sbjct: 252 QRAFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLEN----------- 300

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 779
                                    N+ G  +   +++IF G+M++ ++C    Y +   
Sbjct: 301 -------------------------NMKGTPVEGKLNEIFVGKMKSYIKCINVDYESARV 335

Query: 780 STFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
             F+ L L +                   L+   + + + E+++GEN +     G
Sbjct: 336 EDFWDLQLNVKNFE--------------NLQGSFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 26/112 (23%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIIL-------- 982
            K + F + P +L + L RF YD     + K N       T+   P +   +L        
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 983  KNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            K+     Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 17/101 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP+ L++HL RF Y   ++NS +     I YPL+L +   +N  +   Y L G
Sbjct: 513  RIVGLKKLPETLILHLKRFKYS-EEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTG 571

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            +V H G     GHY S+   +        +  W  FDDEVV
Sbjct: 572  IVLHLGGGPQHGHYVSICKNE--------KYGWLLFDDEVV 604

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 580 QRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLF 620
           Q+   I  +  SSN      + G  N GNTCY NS++QCL+
Sbjct: 96  QKLLEITKLSDSSN-----KVFGYENFGNTCYCNSVLQCLY 131

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (47%), Gaps = 19/130 (14%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILN--IILKNNETMKYRLFG 994
            + +    LP  L +HL RF Y   ++N  +     I YPL L+      ++ + KY L G
Sbjct: 561  RKVGLKQLPHTLALHLKRFKYS-EEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTG 619

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNL--KISSS 1051
            +V H G     GHY SL   D     + G   W  FDDE V+A ++    K +  + S +
Sbjct: 620  IVVHMGGGPQHGHYVSLCKND-----NFG---WLLFDDETVEAVHESTVSKFIGDRDSLT 671

Query: 1052 DVYVLFYERV 1061
              YVLFY+ +
Sbjct: 672  TAYVLFYKEI 681

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFI 630
           + G  N GNTCY NS++QCL+    FR L +
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 103/244 (42%), Gaps = 53/244 (21%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIF-RTLFISANYKNY-LQPPKGSRSAHSSKLSNSL 656
            ++GL N+G+TCY++ +IQCL     F +  F   +YK   ++ P        S LS +L
Sbjct: 135 GLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKECKIRDP-------VSCLSCAL 187

Query: 657 NMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHDEL 711
           + +  ++Y       V      +++ L    KI +D     QQD  EF   L++R+H E 
Sbjct: 188 DSVVFELYGKTQKKAVDDKNGGLIDILNCTWKINEDLVGYSQQDAHEFWQFLMNRIHSE- 246

Query: 712 SNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 771
                                K++NN  +   D + + N I     +FQG +E++++C  
Sbjct: 247 --------------------YKLNNNTIEVPKDTHQLCNCI--YHKVFQGFLESTIECAN 284

Query: 772 CGYTTFNYSTFYV-LSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDC 830
           C   +   +  Y+ LSL +  +                L +C+N F   E L  +  + C
Sbjct: 285 CRKESKTTTEAYMDLSLDLKDKKT--------------LYECLNSFHMKEELK-DFTFHC 329

Query: 831 PRCG 834
             CG
Sbjct: 330 SNCG 333

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 23/110 (20%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI----ILKNNETMK--- 989
             +K +    LP +L++ L RF + L  ++S +   I YP  L +       +NET+    
Sbjct: 338  ALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPD 397

Query: 990  -----YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
                 Y L GV+ HTGT+  GHY          S  +  ++W  F+D ++
Sbjct: 398  DSDIIYELIGVICHTGTVNEGHYIC--------SCKLANNQWVKFNDSMI 439

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 65/147 (44%), Gaps = 39/147 (26%)

Query: 950  PKILVIHLSRFYYDLTK--KNSTVITYPLILNIILKN-----NETMKYRLFGVVNHTGTL 1002
            P IL +HLSR  ++     +N   + YP  L ++ ++      E + YRL  ++ HTGT 
Sbjct: 328  PSILSLHLSRSMFNGASFTRNPCRVEYPETLIVLQRDVENGTAERITYRLRSMIKHTGTH 387

Query: 1003 VSGHYTSLVNKD-----LEHSVDIGRS---------------------KW--YYFDDEVV 1034
             SGHY    +K      +   V + RS                     +W  ++  D VV
Sbjct: 388  YSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSVRRWPYWFISDAVV 447

Query: 1035 KADNKHGSDKNLKISSSDVYVLFYERV 1061
            +  N   + K L+  S  VY+LFYERV
Sbjct: 448  RESN---AGKMLR-ESKYVYMLFYERV 470

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 50/126 (39%), Gaps = 15/126 (11%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHS-SKLSNSLNMLF 660
           G +N+GNTCY+NS +Q L+  K  R L +S N            +  S  K+   L   F
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCF 168

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFL--------MILLDR 706
             +      SV+P   L  + +  P     D       QQD +E          ++  D+
Sbjct: 169 QNLKNKSFKSVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSLSVVFGDK 228

Query: 707 LHDELS 712
             DE S
Sbjct: 229 FEDEFS 234

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 990  YRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH 1040
            Y L GV+ H G    SGHY S +  D +        KWY F+D+ V   +K 
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDED------KWYKFNDDKVSVVDKE 476

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 63/137 (45%), Gaps = 31/137 (22%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNNETMKYRLFG 994
            + +    +P IL +HL RF Y   ++NS +     I YPL L++      + + +Y L G
Sbjct: 550  RIVGLKQVPYILSLHLKRFKYS-EEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSG 608

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNK--------HGSDKN 1045
            VV H G+    GHY  +   +        +  W  +DDE V++ ++        H  D+ 
Sbjct: 609  VVIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESVSEETVLKFTGHSGDQ- 659

Query: 1046 LKISSSDVYVLFYERVH 1062
                 +  YVLFY+ +H
Sbjct: 660  -----TTAYVLFYKEIH 671

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           + G  N GNTCY NS++QCL+    FR
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 10/113 (8%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL N+GNTCY+NS +Q L+     R + +    +  +QP  G    +  KL + L   F 
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQP--GDELHY--KLISELKRCFE 165

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMILLDRLH 708
            +      SV+P  FL ++ +  P     D+      QQD +E    L   L+
Sbjct: 166 NLQKKSYESVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 57/121 (47%), Gaps = 20/121 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYPLILNIILKNNET-MK 989
            K + F + P++L + L RF YD     L K N       T+   P +   +LK  +    
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNLKI 1048
            Y L GV+ HTG + +GHY +++    +        KWY FDDE V +   K   D+N  +
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTD-------DKWYRFDDEKVWRVTKKQVFDENFGL 548

Query: 1049 S 1049
            +
Sbjct: 549  N 549

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 81/235 (34%), Gaps = 64/235 (27%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  F  K FR L          Q P    +      ++S+ +  
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV--------YQIPTADENP-----NDSVALAL 305

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S  P   L++      D      Q D QE   IL+DRL   +         
Sbjct: 306 QRAFYQLQVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMK-------- 357

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 779
                                       G  +   + D+F G+M++ ++C    Y +   
Sbjct: 358 ----------------------------GTSVEGKLTDVFVGKMKSYIKCVNIDYESSRV 389

Query: 780 STFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
             F+ + L +      L  L  + E  +++          E++ GEN +     G
Sbjct: 390 EDFWDIQLNVK----GLEGLANAFENYIEV----------ELMDGENQYAAQDYG 430

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 21/130 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLT--KKNSTVITYPLILNIILKNNETM-----KYRL 992
             +K+   +  P+ LV+HL +F ++ T   K    ++YP+ L++    +E++     +Y+L
Sbjct: 582  ALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISSLPVRYQL 641

Query: 993  FGVVNHTG-TLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
              VV H G +L SGHY +   +            W  +DDE +   NK  S+K L +   
Sbjct: 642  ISVVVHEGRSLSSGHYIAHCKQP--------DGSWATYDDEYI---NKI-SEKQL-LKEP 688

Query: 1052 DVYVLFYERV 1061
            + Y L Y R+
Sbjct: 689  NAYFLVYTRL 698

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G+ NLGNTCY+N+ +Q LF     R   +  + K  ++  +G  + H ++L   L + F 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIK--EGVDTYH-AQLVRELKVTFQ 159

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILLDRL 707
           K+    G ++ P   L+++ ++ P     D       QQD +E    L   L
Sbjct: 160 KLKDRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELFTQLFHTL 211

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 8/57 (14%)

Query: 985  NETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH 1040
            N +  Y L GV+ H G    SGHY + +  D +        KWY FDD+ V A  K 
Sbjct: 410  NPSCIYDLIGVITHQGANSESGHYQAFIRDDADE-------KWYRFDDDKVTAIEKE 459

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 24/129 (18%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDL---TKKNSTVITYPLILNI-----ILKNNET--MK 989
             ++ +    LP +LV+ L RF + +   + K +  I +P  L++       K  ET  + 
Sbjct: 334  AIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETPAIV 393

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKIS 1049
            Y L G+++H G++  GHYTS+          I   +W+ F+D +V A  +      + + 
Sbjct: 394  YELIGLISHQGSVNQGHYTSICK--------IPGGQWFKFNDSMVTAVAE------IDVL 439

Query: 1050 SSDVYVLFY 1058
                Y+LFY
Sbjct: 440  KEQAYLLFY 448

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 77/193 (39%), Gaps = 42/193 (21%)

Query: 585 IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGS 644
           IP++E+ +       + GL N+G+TC+++S+IQ      +    +I  +  + L      
Sbjct: 126 IPSVEKRN------GLAGLVNMGSTCFMSSIIQ-----TLIHNPYILKHSMDQLHSTTCD 174

Query: 645 RSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEF 699
               SS +S +++ + +  Y         T     VN L    +   +     QQD  EF
Sbjct: 175 LQNSSSCMSCAVDQIISDFYGASKSETSETNQQGFVNLLSCSWRKNKNLAGYSQQDAHEF 234

Query: 700 LMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIF 759
              LL++LH+                    D L+ +N +     D N I +        F
Sbjct: 235 WQFLLNQLHN--------------------DHLRATNQKASLKNDCNCISH------RSF 268

Query: 760 QGQMENSLQCKRC 772
           QG +++S+ C  C
Sbjct: 269 QGFLKSSIVCPEC 281

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (46%), Gaps = 23/126 (18%)

Query: 949  LPKILVIHLSRF-YYDLTKKNSTV---ITYPLILNIILKNNETMK--YRLFGVVNHTGTL 1002
            LPK L IHL RF Y D    N  +   I YP+ L +    +E++   Y L G+V H G  
Sbjct: 527  LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 1003 VS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHG-----SDKNLKISSSDVYVL 1056
               GHY S+       + D G   W  FDDE V+  ++        D N   S+   YVL
Sbjct: 587  PQHGHYISVC-----KTSDYG---WLLFDDETVECISEDTVLSFVGDSN---SAGTAYVL 635

Query: 1057 FYERVH 1062
            FY+ ++
Sbjct: 636  FYKEIN 641

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 62/163 (38%), Gaps = 36/163 (22%)

Query: 671 VVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNAD 730
           + P GF+++V +    L   D  QD  EFL  LL+ + D L       N           
Sbjct: 386 ISPGGFMEIVKKENI-LFATDMHQDAHEFLNFLLNDVSDYLDKANTEKNP---------- 434

Query: 731 ALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIP 790
                        D    GN  + ++DIF+G + N ++C  C   T  Y +F    + + 
Sbjct: 435 -------------DNTRSGNETNFVNDIFKGTITNQIRCLTCDTVTSRYESFLDFPIEV- 480

Query: 791 RRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
                   +G  T   + ++  +  +   E+L G N + C  C
Sbjct: 481 --------IGDET---IDIQKMMISYHQKEMLQGSNKFYCGTC 512

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSN 654
           + GL N GNTCY NS++QCL+    FR   +       L P   +++A  S + N
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFRENILG------LTPSIDAKTAEISSIPN 178

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 86/235 (36%), Gaps = 58/235 (24%)

Query: 601 TGLRNLGNTCYINSMIQCLF--AAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
            GL NLGN+CY+NS +QCLF    K + T  +  +    +  P  +  +  +KL  +L  
Sbjct: 331 CGLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKE 390

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
               +Y  G   + P  F K +     +      QQD  EF    +D L           
Sbjct: 391 E-PTIYKQG---IRPKSFKKCIGGSHEEFS-SGRQQDALEFFTYFVDEL----------- 434

Query: 719 NDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
                                    DK +  N     +D+ +  ME+ LQC+ C    ++
Sbjct: 435 -------------------------DKKLFKNSDYNPNDLMKFMMEDRLQCQECHGVKYS 469

Query: 779 YSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
             T  V+ L +           + +     LE+ IN +   EV+     + CP C
Sbjct: 470 TETSNVIQLPL-----------QESNDAQDLEERINAYFSGEVIE----FKCPNC 509

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 30/135 (22%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI----ILKNNET----- 987
             +K +    LP +LV+ L RF + L   N  +   I +P  LN+     ++ +E      
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNK 404

Query: 988  ----MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSD 1043
                + Y L G+V+H GT+  GHY +           I   +W+ F+D +V + ++    
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVSSISQE--- 453

Query: 1044 KNLKISSSDVYVLFY 1058
               ++     Y+LFY
Sbjct: 454  ---EVLKEQAYLLFY 465

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 101/250 (40%), Gaps = 54/250 (21%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANY--KNYLQPPKGSRSAHSSKLSNSL 656
            ++GL N+G+TC+++S++QCL     F    +S ++  K  ++ P    S    K+ + L
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIKHSMSQSHFNKCKVRSPDNCFSCALDKIVHEL 194

Query: 657 NMLFNKMYLNGGCSVV--PTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHD 709
             + N        S      GF+ +   L    KI  +     QQD  EF   +++++H 
Sbjct: 195 YGVLNTDQPPSSSSATNRQAGFIYL---LTCAWKINQNLAGYSQQDAHEFWQFIINQIH- 250

Query: 710 ELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
                Q+     P        + K S        DK  I +    +  +F+G +E+S+ C
Sbjct: 251 -----QNYVLSLP--------STKES--------DKENIKHCDCIVHTVFEGSLESSIVC 289

Query: 770 KRC---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGEN 826
             C     TT +   F  LSL I  +               KL +C++ F   E+L   N
Sbjct: 290 PSCQNNSKTTID--PFMDLSLDIKDKK--------------KLYECLDSFHKKELLKDFN 333

Query: 827 AWDCPRCGPT 836
            + C  C  T
Sbjct: 334 -YHCGECNST 342

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 110/257 (42%), Gaps = 57/257 (22%)

Query: 584 NIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANY--KNYLQPP 641
           ++PT  +   +Y      GL NLG+TC+++S++Q L      +  F+++ +  +  L+ P
Sbjct: 126 SLPTSLRRDGLY------GLLNLGSTCFMSSILQSLIHNTYIQYWFLNSGHARRCALRDP 179

Query: 642 KGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDT 696
                  SS +S +L+ + ++ Y +        GFL +   L    KI  +     QQD 
Sbjct: 180 -------SSCISCALDRIISECYGSLSERNDHAGFLSL---LTCSWKINQNFAGYSQQDA 229

Query: 697 QEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPID 756
            EFL  LL++LH +   ++ V  D           ++ S+++  H             + 
Sbjct: 230 HEFLQFLLNQLHCDYKRERQVDED---------KEVRSSSSQLCHCI-----------VH 269

Query: 757 DIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMF 816
             FQG + +S+ C  C   +         ++  P   + L   G+ T     L DC++ F
Sbjct: 270 SSFQGTLRSSIVCPECQDDS--------KTMLDPFLDLSLDIKGQRT-----LYDCLDSF 316

Query: 817 TDDEVLSGENAWDCPRC 833
              E L  +  + CPRC
Sbjct: 317 HRREQLH-DFDYHCPRC 332

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 53/102 (51%), Gaps = 16/102 (15%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI--ILKNNE---TMKYRL 992
            +K +    L   LV+ L RF +  + +N  +   + +PL L++       E   ++ YRL
Sbjct: 339  IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 993  FGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
             GVV+H+GT+  GHYT+++         +   +W+ F+D ++
Sbjct: 399  SGVVSHSGTVNEGHYTAVLQ--------LNSGEWFKFNDSMI 432

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 34/133 (25%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI--ILKNNET-----MKY 990
            +K +    LP +LV+ L RF + +   N  +   ITYP  LN+     ++E      M Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 991  RLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISS 1050
             L  V++  G++  GHYT +          +   +W+ F+D ++           + I+ 
Sbjct: 394  ELVAVISQEGSVNQGHYTCMCK--------VPGGQWFRFNDTMI-----------VSITE 434

Query: 1051 SDV-----YVLFY 1058
             DV     Y+LFY
Sbjct: 435  EDVLRQQAYLLFY 447

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 60/136 (44%), Gaps = 29/136 (21%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNS----TVITYPLILNIILKNNETM--KYRLFGV 995
            + +    LP IL +HL RF Y   +K++      I YPL L++    N ++  KY L GV
Sbjct: 547  RMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGV 606

Query: 996  VNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNK--------HGSDKNL 1046
            V H G+    GHY  +   +        +  W  +DDE V++  +        H  D+  
Sbjct: 607  VIHMGSGPQHGHYVCICRNE--------KFGWLLYDDETVESIKEETVLQFTGHPGDQ-- 656

Query: 1047 KISSSDVYVLFYERVH 1062
                +  YVLFY+   
Sbjct: 657  ----TTAYVLFYKETQ 668

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFR 626
           S  + G  N GNTCY NS++QCL+    FR
Sbjct: 130 SNKVFGYENFGNTCYCNSVLQCLYNIPEFR 159

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 52/121 (42%), Gaps = 21/121 (17%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTVIT----YPLILNII---------LKNNETM 988
            K + F + P +L + L RF YD        I     +P  +++          L N E  
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 989  KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNLK 1047
             Y L GV+ H G + +GHY +++   +         +WY FDD+ V +   K   D+N  
Sbjct: 440  IYNLHGVLVHAGDISTGHYYTMIRPGVS-------DEWYRFDDDKVWRVTKKQAFDENFG 492

Query: 1048 I 1048
            +
Sbjct: 493  L 493

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 88/234 (37%), Gaps = 62/234 (26%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G +N G TCY+NS++Q  F  K FR L          + P    S      +NS+ +  
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV--------YEIPTDMDSP-----NNSVPLAL 249

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S  P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 250 QRAFYQLQVSNEPLDTLELTRSFGWDNGDAFTQHDVQELNRILMDRLENRMK-------- 301

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
                                  +  V G     ++++F G+M++ ++C    Y +    
Sbjct: 302 -----------------------ETPVEGK----LNELFVGKMKSYIKCINVDYESSRVE 334

Query: 781 TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
            F+ L L +  +++K             LE+  + + + E+++GEN +     G
Sbjct: 335 DFWDLQLNV--KNLK------------GLEESFSNYIEIELMNGENQYAAQDYG 374

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 20/118 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKNNETMK- 989
            K + F + P +L + L RF YD     L K N       ++   P + +  L+ N   K 
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNL 1046
            Y+L GV+ HTG + +GHY +L+           + +WY FDD+ V +A  K   D N 
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPST-------KDEWYRFDDDRVWRATKKQIFDDNF 490

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 87/234 (37%), Gaps = 62/234 (26%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G RN G TCY+NS++Q  +  K FR L        Y  P +G         ++S+ +  
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLV-------YQIPTEGENP------NDSVTLAL 249

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S  P   +++      D      Q D QE   IL+DRL             
Sbjct: 250 QRAFYQLQVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETR---------- 299

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
                      +K ++ E K              I+++F G+M++ ++C    Y +    
Sbjct: 300 -----------MKGTSVEGK--------------INELFVGKMKSYIRCINVDYQSVRTE 334

Query: 781 TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
            F+ + L +  ++M+             L+     + + E++ GEN +     G
Sbjct: 335 DFWDIQLNV--KNMR------------DLQTSFENYIEVELMDGENQYAAQGHG 374

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 60/129 (46%), Gaps = 25/129 (19%)

Query: 949  LPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNI--ILKNNETMKYRLFGVVNHTGT 1001
            LPKIL +HL RF Y   + N+ +     ITYP  L++      + + KY L G++ H G 
Sbjct: 549  LPKILSLHLKRFKYS-EENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGA 607

Query: 1002 LVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA-----DNKHGSDKNLKISSSDVYV 1055
                GHY ++   +        +  W  +DDE V+A       +H  D N     +  Y+
Sbjct: 608  GPQHGHYVAMCKTE--------KFGWLLYDDETVEAVLEKDVLRHVGDSN---DLATAYI 656

Query: 1056 LFYERVHDQ 1064
            LFY+ +  Q
Sbjct: 657  LFYKTIETQ 665

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFI 630
           S  + G  N GNTCY NS++QCL+     R   I
Sbjct: 123 STKVFGFENFGNTCYCNSVLQCLYNFSELRDNLI 156

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 51/140 (36%), Gaps = 39/140 (27%)

Query: 694 QDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGIS 753
           QD  EFL  LL+ L + +        D  NL        K+   E    F KN       
Sbjct: 434 QDAHEFLNFLLNELSEYI--------DRSNL--------KIEETEKTENFIKN------- 470

Query: 754 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCI 813
               IFQG + N ++C  C   T     F  L + +  R+               ++  +
Sbjct: 471 ----IFQGTLTNKIRCLTCDNVTSRDEPFLDLPIEVKSRN------------ETDIKKAL 514

Query: 814 NMFTDDEVLSGENAWDCPRC 833
           + +   E+L+G N + C  C
Sbjct: 515 SNYHQREMLNGSNKFYCDGC 534

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 62/133 (46%), Gaps = 23/133 (17%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNS----TVITYPLILNI--ILKNNETMKYRLFGV 995
            + +    LP IL +HL RF Y   ++++      I YPL L++     ++ + KY L GV
Sbjct: 539  RIVGLKQLPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGV 598

Query: 996  VNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISS---- 1050
            V H G+    GHY  +   +        +  W  +DDE V++  +   +  LK +     
Sbjct: 599  VIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESIRE---ETVLKFTGHPGD 647

Query: 1051 -SDVYVLFYERVH 1062
             +  YVLFY+  H
Sbjct: 648  QTTAYVLFYKETH 660

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFR 626
           S  + G  N GNTCY NS++QCL+    FR
Sbjct: 122 SNKVFGYENFGNTCYCNSVLQCLYNISEFR 151

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 59/137 (43%), Gaps = 32/137 (23%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNII-------------LK 983
             +K +    LP +LV+ L RF + L   N  +   I +P  LN+              + 
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIG 404

Query: 984  NNET--MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHG 1041
            N +   + Y L G+V+H GT+  GHY +           I   +W+ F+D +V + ++  
Sbjct: 405  NGKVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVSSISQE- 455

Query: 1042 SDKNLKISSSDVYVLFY 1058
                 ++     Y+LFY
Sbjct: 456  -----EVLKEQAYLLFY 467

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 101/250 (40%), Gaps = 54/250 (21%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIF--RTLFISANYKNYLQPPKGSRSAHSSKLSNSL 656
            ++GL N+G+TC+++S++QCL     F   ++    + K  ++ P    S    K+ + L
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMRQIHSNKCKVRSPDKCFSCALDKIVHEL 194

Query: 657 NMLFNKMYLNGGCSVV--PTGFLKVVNQLRPDLKIPD-----DQQDTQEFLMILLDRLHD 709
             + N    +   S      GF+ +   L    KI        QQD  EF   L++ +H 
Sbjct: 195 YGVLNTDQPSSSSSATNRQGGFIHL---LTCAWKINQSLAGYSQQDAHEFWQFLINEIH- 250

Query: 710 ELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
               Q +V      L L N   +  +NN+                +  +F+G +E+S+ C
Sbjct: 251 ----QSYV------LSLPNPKEVDRANNKRCDCI-----------VHTVFEGSLESSIVC 289

Query: 770 KRC---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGEN 826
             C     TT +   F  LSL I              + + KL +C++ F   E+L   N
Sbjct: 290 PGCQNNSKTTID--PFMDLSLDI--------------KDKQKLYECLDSFHKKELLKDFN 333

Query: 827 AWDCPRCGPT 836
            + C  C  T
Sbjct: 334 -YHCGECNST 342

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 13/111 (11%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G +N G TCY+NS++Q  F  K FR L          Q P    S +     NS+ +  
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV--------YQIPTDKESPN-----NSVPLAL 252

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
            + +     S  P   L++      D      Q D QE   IL+DRL +++
Sbjct: 253 QRAFFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKM 303

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN-------STVITYPLILNIILKNNETMK 989
            K + F + P +L + L RF YD     L K N       S  ++  L   I   N ++  
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            Y L GV+ HTG + +GHY +++   +E        +WY FDD+ V
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIE-------DQWYRFDDDKV 480

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 24/131 (18%)

Query: 938  LTTVKTINFVTLPKILVIHLSRFYYDLTKKN---STVITYPLILNII-----LKNNET-- 987
            L  +K      LP +LV+ L RF + +   N   +  + YPL LN+        N ET  
Sbjct: 344  LDPIKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPD 403

Query: 988  MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLK 1047
            + Y L G+++H G++  GHY  ++         I   +W+ F+D ++    +   D+ LK
Sbjct: 404  IIYELTGILSHIGSINEGHYVVVLK--------INDGRWFKFNDSMISVIKE---DEALK 452

Query: 1048 ISSSDVYVLFY 1058
                  Y+LFY
Sbjct: 453  ---QQAYLLFY 460

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 108/277 (38%), Gaps = 86/277 (31%)

Query: 585 IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAA------KIFRTLFISANYKNYL 638
           IP+ E+   ++      GL N+G+TC+++S++Q L          + +T F++ + KN  
Sbjct: 128 IPSQERRDGLF------GLVNMGSTCFMSSILQALIHNPYIVNYSMSQTHFVNCSIKN-- 179

Query: 639 QPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVP-------------TGFLKVVNQLRP 685
                     S  +S +L+ +  + Y  G   + P             +     ++ L  
Sbjct: 180 ---------SSLCMSCALDAMIIEFY--GQSKLQPISSSSSSSSSSSSSSPSAFISLLTC 228

Query: 686 DLKIPDD-----QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYK 740
            LKI ++     QQD  EFL   L++LH +                Y  D+   S+NE +
Sbjct: 229 SLKINENFAGYSQQDAHEFLQYFLNQLHQD----------------YKRDS---SHNEQE 269

Query: 741 HWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN-YSTFYVLSLAIPRRSMKLSKL 799
           +        N       IFQG++++S+ C  C   +      F  LSL I          
Sbjct: 270 N--------NCPCVAHSIFQGELKSSIVCPECQNDSKTIIDPFMDLSLDI---------- 311

Query: 800 GRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCGPT 836
               + +  L  C++ F   E L   N + C RC  +
Sbjct: 312 ----KDKTDLYQCLDSFHKKEKLHDFN-YHCSRCNTS 343

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 62/151 (41%), Gaps = 24/151 (15%)

Query: 583 YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642
           Y I  +  + N   S+   G+ N GN C+++S++Q L   K F ++    +Y+   +   
Sbjct: 315 YTIENVPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFISILNVISYRTVAK--I 372

Query: 643 GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVP---------TGFLKVVNQLRPD------L 687
           GS  + S      L   F+K         VP          G       ++PD       
Sbjct: 373 GSSVSPSLDACLELYRRFDKQTCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKTLS 432

Query: 688 KIP-------DDQQDTQEFLMILLDRLHDEL 711
           K+P         Q+D +EFL  LLD+LH+E 
Sbjct: 433 KLPKFRDLRWGHQEDAEEFLTHLLDQLHEEF 463

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 54/145 (37%), Gaps = 42/145 (28%)

Query: 949  LPKILVIHLSRFYYDLTKKNSTVITYPLILNIILK------------------------- 983
            LP++L+I L RF +        ++ Y      + K                         
Sbjct: 638  LPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHYNHELTIPKETISSVHSNF 697

Query: 984  -NNETMKYRLFGVVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH- 1040
             ++   KY+L GVV H G   S GHYT+    D+ H       KW+  DD  +   NK  
Sbjct: 698  YDDAGTKYKLVGVVYHHGVSPSGGHYTA----DVYHQ---EMDKWFRIDDVNIAELNKEE 750

Query: 1041 ----GSDKNLKISSSDVYVLFYERV 1061
                G D      S   Y+L Y+++
Sbjct: 751  VLKGGED---GFDSRTAYILMYQKI 772

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 86/238 (36%), Gaps = 70/238 (29%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
            G +N G TCY+NS++Q  F  K FR L          Q P  + S      +NS+ +  
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV--------YQIPTENDSP-----NNSVPLAL 239

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720
            + +     S  P   L++      D      Q D QE   IL+DRL +++         
Sbjct: 240 QRAFYQLQVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRLENKMKG------- 292

Query: 721 YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDD----IFQGQMENSLQCKRCGYTT 776
                                           +P++D    IF G+M++ ++C    Y +
Sbjct: 293 --------------------------------TPVEDKLNEIFVGRMKSYIKCINVDYES 320

Query: 777 FNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
                F+ L + +      L  L  S E  +++          E+++GEN +     G
Sbjct: 321 SRVEEFWDLQMNVKN----LKDLKSSFENYIEI----------ELMNGENQYAAQDYG 364

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 20/106 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKNS------TVITYPLILNIILKNNET--M 988
            K + F + P +L + L RF YD     L K N       ++     I  +  ++ E    
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 989  KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
             Y+L GV+ H G + +GHY +++    E        +WY FDDE V
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKPSTE-------DQWYRFDDEKV 468

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 10/85 (11%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLT--KKNSTVITYP--LILN-IILKNNE-----TM 988
            T VK    V  P++L++HLSR  ++     KN+  +T+P  L++N  +L+NN+      +
Sbjct: 377  TIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVRAV 436

Query: 989  KYRLFGVVNHTGTLVSGHYTSLVNK 1013
            +Y+L  ++ H GT   GHY    +K
Sbjct: 437  RYKLCAMIKHIGTHSQGHYACFRHK 461

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 10/131 (7%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR-----TLFISANYKNYLQPPKGSRSAHSSKLSNS 655
            GL NLGN+CY+NS++QCL    +          I  ++   +  P G+      KL N+
Sbjct: 342 CGLINLGNSCYLNSVMQCLLNGGVPNWSDKLGNIIGHDFPKDVIYPTGNLRCQMIKLLNA 401

Query: 656 LNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 715
              L  + Y  G   + P  F + V +   + K  ++QQD+ EFL  + + L   L  + 
Sbjct: 402 FK-LNPEDYEEG---IRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVTEELEKGLFPKI 456

Query: 716 HVANDYPNLLL 726
             A+  PN LL
Sbjct: 457 QDASINPNNLL 467

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 29/133 (21%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNS----TVITYPLILNI--ILKNNETMKYRLFGV 995
            + +    LP IL +HL RF Y   +K++      I YPL L++      + + KY L GV
Sbjct: 545  RIVGLKQLPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGV 604

Query: 996  VNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNK--------HGSDKNL 1046
            V H G+    GHY  +   +        +  W  +DDE V++  +        H  D+  
Sbjct: 605  VIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESIREETVLQFTGHPGDQ-- 654

Query: 1047 KISSSDVYVLFYE 1059
                +  YVLFY+
Sbjct: 655  ----TTAYVLFYK 663

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSL 656
           S  + G  N GNTCY NS++QCL+    FR      N   Y + P  +R   S    +  
Sbjct: 130 SNKVFGYENFGNTCYCNSVLQCLYNIPEFR-----CNILQYPEKPATNRIRKSDLKGSKA 184

Query: 657 NMLFNKMY---LNGG 668
            +  N+ +   +NGG
Sbjct: 185 RIFTNESFETSVNGG 199

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 21/126 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDL---TKKNSTVITYPLILNI--ILKNNET--MKYRL 992
             +K +    LP +LV+ L RF + L   + K + ++ +PL LN+      ++   + + L
Sbjct: 348  AIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFEL 407

Query: 993  FGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSD 1052
             G++ H GT+  GHY +       H        W+ F+D +V +  +       ++    
Sbjct: 408  IGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMVSSITEE------ELLQEQ 453

Query: 1053 VYVLFY 1058
             Y+LFY
Sbjct: 454  AYLLFY 459

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 88/233 (37%), Gaps = 62/233 (26%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G +N G TCY+NS++Q  F  K+FR +     YK     P  + S +     +S+++   
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV----YK----IPSDNESPN-----DSVSLALQ 249

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDY 721
           + +     S  P   L++      D      Q D QE   IL+DRL   +   +      
Sbjct: 250 RSFYLLEKSKEPLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMKGTE------ 303

Query: 722 PNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                                    V G     ++D+F G+M++ ++C    Y +F    
Sbjct: 304 -------------------------VEGT----LNDLFVGKMKSYIRCVNVDYESFRVED 334

Query: 782 FYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
           F+ + L +      L  +  S E  V++          E++ GEN +     G
Sbjct: 335 FWDIQLNVK----NLKDVKESFENYVEV----------EMMDGENQYAAQDYG 373

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 20/118 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKNS-----TVITYPLILNIILKNN--ETMK 989
            K + F + P +L + L RF YD     L K N        I     L+  +K+N   T  
Sbjct: 379  KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCI 438

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNL 1046
            Y L  V+ H+G + +GHY +++  ++         +W+ FDD+ V K       D+N 
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNV-------TDQWFRFDDDKVWKVTKTQAFDENF 489

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 18/120 (15%)

Query: 938  LTTVKTINFVTLPKILVIHLSRFYYD-----LTKKNSTV-----ITYPLILNIILKNNET 987
            L   + + F + P +L + L RF YD     L K N        I     L+     +  
Sbjct: 369  LQDAQKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTP 428

Query: 988  MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNL 1046
              Y L GV+ H+G + +GHY +++  D           WY FDD+ V+KA +K   ++N 
Sbjct: 429  ADYILHGVLVHSGDISTGHYYAMIQPD-------AHGSWYRFDDDRVIKATDKQVFEENF 481

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 88/236 (37%), Gaps = 62/236 (26%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
              G +N G TCY+NS++Q     K+FR L        Y  P +          +NS+ +
Sbjct: 195 GFVGFKNQGATCYLNSLLQSYHFTKLFRKLV-------YQIPTEDENP------TNSVAL 241

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
              + +     S  P    ++      D      Q D QE   IL+DRL       +H  
Sbjct: 242 ALQRAFYLLQTSKEPLDTTELTKSFGWDTGDAFTQHDVQELNRILMDRL-------EH-- 292

Query: 719 NDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
                        +K ++ E K              I+++F G+M++ ++C    Y +  
Sbjct: 293 ------------RMKGTSVEGK--------------INELFVGKMKSCIKCINVDYESSR 326

Query: 779 YSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
              F+ + L +  + MK             L++    + + E+++GEN +     G
Sbjct: 327 VEDFWDIQLNV--KDMK------------NLQESFEQYIEVELMNGENQYAAQDHG 368

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR---TLFISANYKNYLQPPKGSRSAHSSKLSNSLN 657
            GL N+GN+CY+NS++QCLF  + +     + +   +   +  P  +      KL  ++ 
Sbjct: 320 CGLINMGNSCYLNSVLQCLFQDETWTGKLQMAVGEEFPTDVVFPSNNLRCQLIKLYRAMK 379

Query: 658 MLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
            L  ++Y  G   + P  F K  +    +      QQD  EFL  ++D L  +LS
Sbjct: 380 -LEPELYPQG---IKPQSFKKCFSAGHEEFA-SQRQQDAMEFLTYMIDNLDKKLS 429

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 21/128 (16%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGS-RSAHSSKLSNSLNMLF 660
           GL+N+GNTCY+N+ +Q LF     R L +  NY     P K S +     K+   +   F
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLIL--NY----DPAKASPQDEMHHKIVLEMKRCF 161

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQE--------FLMILLDR 706
             +      SV+P   L V+ +  P     D       QQD +E        F ++  D+
Sbjct: 162 ENLENKSYKSVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELFTQLFHTFDIVFGDK 221

Query: 707 LHDELSNQ 714
             D+ + Q
Sbjct: 222 FSDDFTVQ 229

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 7/116 (6%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKI--FRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
            GL NLGN+CY+NS++Q LF A +  +    I   +   +  P  +      KL N++ +
Sbjct: 322 CGLINLGNSCYMNSVLQLLFNAGVPDWSLEQIGTEFPLDVVYPSNNILCQLIKLRNAMKI 381

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 714
              + Y NG   + PT F + + Q   +      QQD+ EF   L+++L  ++ N+
Sbjct: 382 EPER-YPNG---IKPTSFKRCIAQAHEEFS-SSRQQDSMEFFTFLIEQLDKKVLNK 432

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 25/130 (19%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYDLTK---KNSTVITYPLILNI--ILKNNET------M 988
             +K ++   LP +LV+ L RF + L     K +  I YP  LN+     + ++      +
Sbjct: 342  AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDL 401

Query: 989  KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKI 1048
             Y L GVV H GT+  GHY +        +  +   +W+ F+D +V +  +       + 
Sbjct: 402  IYELIGVVAHKGTVNEGHYVA--------TTKVAGRQWFKFNDSMVSSVTQE------EA 447

Query: 1049 SSSDVYVLFY 1058
             +   Y+LFY
Sbjct: 448  LNEQAYLLFY 457

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 30/141 (21%)

Query: 585 IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANY--KNYLQPPK 642
           +P++E+   ++      GL NLG+TC+++S++Q L     F    IS ++  K  +Q PK
Sbjct: 127 VPSVERRDGLH------GLLNLGSTCFMSSILQILIRNPYFFNFSISQSHSKKCPIQDPK 180

Query: 643 GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTG-------FLKVVNQLRPDLKIPDD--- 692
                  S +S +L  +  + Y   G S   TG       +   +  L    KI ++   
Sbjct: 181 -------SCISCALEKMVCEFY---GSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAG 230

Query: 693 --QQDTQEFLMILLDRLHDEL 711
             QQD  EF   LL++LH + 
Sbjct: 231 YSQQDAHEFWQFLLNQLHHDF 251

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 59/134 (44%), Gaps = 27/134 (20%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LPK L +HL RF Y   ++N  +     + YPL L++    N  +  +Y L G
Sbjct: 952  RIVGLKQLPKTLSLHLKRFKYS-EEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNG 1010

Query: 995  VVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH------GSDKNLK 1047
            +V H G     GHY ++   D        +  W   DDE V+  ++       G  K+L 
Sbjct: 1011 IVVHMGGGPQHGHYVAICKND--------KFGWLLMDDETVETISEETVLRCKGDSKDL- 1061

Query: 1048 ISSSDVYVLFYERV 1061
               +  YVLFY+  
Sbjct: 1062 ---TTAYVLFYKEC 1072

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 578 QPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRT 627
           QP+    IP  + S+ V+      G  N GNTCY NS++QCL+     RT
Sbjct: 499 QPRTNPLIPFGDGSNKVF------GYENFGNTCYCNSVLQCLYNMTNLRT 542

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 22/148 (14%)

Query: 694 QDTQEFLMILLDRLHD-------ELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKN 746
           QD  EFL  LL+ L D       E + ++ +AN+ PN   +N   L  S+       + N
Sbjct: 813 QDAHEFLNFLLNELSDYMIKCINEENLKKTIANN-PNTDTHNT--LTQSHTSNNQQEEDN 869

Query: 747 VIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKR 806
            +      I D+F+G + N  +C  C   T     F    + +             TE  
Sbjct: 870 NLPRMSDFISDLFRGTLINKTRCLTCDNVTSREEPFLDFPIEV----------KDDTETN 919

Query: 807 VKLEDCINMFTDDEVLSGENAWDCPRCG 834
           ++ E  +  +   E+L+G N + C  CG
Sbjct: 920 IQTE--LKSYHQREMLNGSNKFYCDECG 945

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 59/137 (43%), Gaps = 33/137 (24%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDL---TKKNSTVITYPLILNIIL----KNNET------ 987
            +K +    L  +LV  L RF + L   T K +  I YPL LN+       NN+T      
Sbjct: 365  IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 988  ------MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHG 1041
                  M Y L  +++H GT+  GHY  +        V +   +W+ F+D +V A  +  
Sbjct: 425  SENVPDMIYELTSIISHKGTVNEGHYIVV--------VKVNDGQWFKFNDSMVSAITEEE 476

Query: 1042 SDKNLKISSSDVYVLFY 1058
            + K         Y+LFY
Sbjct: 477  ALK------QQAYLLFY 487

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 60/116 (51%), Gaps = 15/116 (12%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL N+G+TC+++S++Q L          +   + N  Q  K   S  S     +L+++  
Sbjct: 138 GLVNMGSTCFMSSILQTLIHNPYVVNYSMCQTHYNMCQ-SKNPLSCTSC----ALDLIIT 192

Query: 662 KMYL--NGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHDE 710
           + Y   + G +   TGF+ ++N L   L++ ++     QQD  EFL  +L+++H++
Sbjct: 193 EFYATESKGNNSSHTGFISLLNSL---LQVNENFAGYSQQDAHEFLQFILNQIHND 245

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 56/118 (47%), Gaps = 20/118 (16%)

Query: 942  KTINFVTLPKILVIHLSRFYYD-----LTKKN------STVITYP-LILNIILKNNETMK 989
            K + F + P +L + L RF YD     L K N       T+   P L  +++ KN     
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 990  YRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNL 1046
            Y L GV+ H+G +  GHY +++        D+G  +W+ FDD+ V +   +   D+N 
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKP------DVG-DQWFRFDDDKVWRVTKEQAFDENF 489

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 50/114 (43%), Gaps = 13/114 (11%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL+N G TCY+NS++Q  F  K+FR +     YK     P  + S + S L   L +  +
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV----YK----IPSENESPNDSVL---LALQRS 251

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 715
              L      + T  L++      D      Q D QE   IL+DRL   +   +
Sbjct: 252 FYLLQKSNETLDT--LELTRSFGWDTGDAFTQHDVQELNRILMDRLETRMKGTE 303

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 83/204 (40%), Gaps = 53/204 (25%)

Query: 594 VYVSLSITGLRNLGNTCYINSMIQCLF---AAKIFRTLFISANYKNYLQPPKGSRSAHSS 650
           V+ +L   GL N G TCY N+ +Q +    A + +    +   YKN + P         +
Sbjct: 435 VFANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKYKN-IDP---------N 484

Query: 651 KLSNSLNMLFNKMYLN---GGCSVV----PTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
            +S +L     +M+L+   G   V+    P   ++ ++ +   +  P +Q+D+ E+ M L
Sbjct: 485 SVSYTLAETTRRMWLSNKKGNKKVIAYYNPNELIERLDDINWSMN-PYNQEDSHEYFMSL 543

Query: 704 LDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQM 763
           + +L +   N   +  +    ++Y                             DIF G +
Sbjct: 544 MSKLQE---NSVPIGRNMTESIIY-----------------------------DIFGGLL 571

Query: 764 ENSLQCKRCGYTTFNYSTFYVLSL 787
           E ++ CK CG  +     FY LSL
Sbjct: 572 EQTVTCKSCGGVSKTEQEFYDLSL 595

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 59/130 (45%), Gaps = 21/130 (16%)

Query: 940  TVKTINFVTLPKILVIHLSRFYYD--LTKKNSTVITYPLILNII-----LKNNETMKYRL 992
             +K    +  P+ LV+HL +F ++   + K    ++YP+ L+I       K     KY+L
Sbjct: 704  AIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLPAKYQL 763

Query: 993  FGVVNHTG-TLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSS 1051
              VV H G +L SGHY +   +            W  +DDE++   NK    K L  +  
Sbjct: 764  LSVVVHEGRSLSSGHYIAHCRQ--------PDGTWATYDDELI---NKISELKLL--TEP 810

Query: 1052 DVYVLFYERV 1061
            + Y L Y R+
Sbjct: 811  NAYYLVYTRL 820

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFIS 631
           I G  N GNTCY NS++QC F   +FRT  +S
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 53/129 (41%), Gaps = 15/129 (11%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTK----KNSTVITYPLILNI--ILKNNETMKYRLFGV 995
            + +    LPK L +HL RF Y   K    K    I YP  L +     +  + +Y L   
Sbjct: 505  RLVGLKRLPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASA 564

Query: 996  VNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVY 1054
            V H G     GHY SL   +       G   W  FDDE V+A ++         +S   Y
Sbjct: 565  VIHLGDGPQYGHYISLCKTET-----FG---WLLFDDETVEAVDEQTVLSFTGENSDTAY 616

Query: 1055 VLFYERVHD 1063
            VLFY  V +
Sbjct: 617  VLFYNEVSE 625

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 34/79 (43%), Gaps = 12/79 (15%)

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCIN 814
           + DIFQG + N ++C  C   T     F   ++ +              ++ + ++  + 
Sbjct: 431 VQDIFQGSLTNQIRCYTCDSITSTEEPFLDFAIEVKE------------DENLNIQRHLE 478

Query: 815 MFTDDEVLSGENAWDCPRC 833
            F   E+L+G + + C RC
Sbjct: 479 SFHQRELLNGSDKFYCDRC 497

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 113/273 (41%), Gaps = 71/273 (26%)

Query: 574 LLQPQPQRAYNIP----TIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTL- 628
           +L P   RA+N+     +IE+S  +      TGL N  N C++NS +Q L   +   T  
Sbjct: 46  VLLPSVSRAFNVKKGPLSIEESKRL--DRFTTGLLNARNDCFLNSSLQALVPIESLTTYL 103

Query: 629 --FISANYK-NYLQPPKGSRSA--HSS--KLSNSLNMLFNKMYLNGGCSVVPTGFLKVVN 681
             F+ A +  +  Q  +  R A  H++  KL + L  L  K       ++V T    + +
Sbjct: 104 NQFVEALHSVDEGQVFELERLAPLHANLIKLLHELQSLIVKPQTVSAKNIVKT----LED 159

Query: 682 QLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKH 741
            LR   K+  DQ D  EF  ILL+ LH E                     +K+ +N    
Sbjct: 160 TLRR--KMSSDQNDAHEFTQILLETLHSEY--------------------IKLQSN---- 193

Query: 742 WFDKNVIGNGISPIDDIFQGQMENSLQCKRCG-YTTFNYSTFYVLSLAIPRRSMKLSKLG 800
                 I  G  P    F+G   N L C +C  Y+   +S F +L +A+P         G
Sbjct: 194 ------IEIGSFP----FEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVP---------G 234

Query: 801 RSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
             +E   KL D I + + DE++ G   + C  C
Sbjct: 235 NYSE---KLTDLI-LHSQDEIIEG---YSCLYC 260

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 10/68 (14%)

Query: 950  PKILVIHLSRFYYD---LTKKNSTV-------ITYPLILNIILKNNETMKYRLFGVVNHT 999
            P  L++HLSR  ++   +T+    V       +   +++N   +  E +KY L  VV HT
Sbjct: 337  PASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTEPIKYELKSVVKHT 396

Query: 1000 GTLVSGHY 1007
            G+ V GHY
Sbjct: 397  GSHVQGHY 404

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 8/109 (7%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G +N+GNTCY+N+ +Q LF     R L ++ + K +          H  KL   L   F 
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLNPQDEMHH--KLILELKHCFE 166

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
            +      SV+P   + V+ ++ P     D       QQD +E    L 
Sbjct: 167 SLKQKNYQSVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELFTQLF 215

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
            YBL067C
          Length = 714

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 61/130 (46%), Gaps = 19/130 (14%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP  L +HL RF Y L +KN+       I YPLIL++    N+++  KY L  
Sbjct: 497  RIVGLKKLPHTLALHLKRFKY-LEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELIS 555

Query: 995  -VVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLK--ISSS 1051
             VV+  G    GHY S+   D        +  W  FDDE V++ N+    K +      +
Sbjct: 556  IVVHLGGGPHHGHYVSICKSD--------KFGWLLFDDETVESINEETVLKFVGDPEDQT 607

Query: 1052 DVYVLFYERV 1061
              YVLFY  +
Sbjct: 608  TAYVLFYREI 617

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           I G  N GNTCY NS++QCLF    FR
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 57/143 (39%), Gaps = 50/143 (34%)

Query: 693 QQDTQEFLMILLDRLHD--ELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGN 750
           QQD  EFL  LL+ L+D  +LSN++       N +L                        
Sbjct: 395 QQDAHEFLNFLLNELNDFLQLSNEK-------NFIL------------------------ 423

Query: 751 GISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLE 810
                 D FQG + N ++C  C   T N   F    + +           ++ ++ + ++
Sbjct: 424 ------DQFQGTLTNQIKCLTCDTLTSNNEPFLDFPIEV-----------KNDDEDLNIQ 466

Query: 811 DCINMFTDDEVLSGENAWDCPRC 833
           D +N +   E+L+G N + C +C
Sbjct: 467 DILNKYHQREILNGTNKFYCNQC 489

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 17/116 (14%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G +N+GNTCY+NS +Q LF   + + + +  NYK      +G+  +   +L + + +   
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMIL--NYKT-----EGNNISPEDELHHKIVIELK 162

Query: 662 KMY--LNGG--CSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMILLDRL 707
           K +  L+G    +V+P   L V+ +  P     D       QQD +E    L   L
Sbjct: 163 KCFETLDGKKFKAVMPVVLLSVLRKCYPQFAERDSQSGFYKQQDAEELFTQLFQTL 218

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 97/257 (37%), Gaps = 68/257 (26%)

Query: 602 GLRNLGNTCYINSMIQCLF-AAKIFRTLF--ISANYKNYLQPPKGSRS-AHSSKL----S 653
           GL N G TCY N+ +Q L     I   LF  +   YK+ + P   ++  A ++K      
Sbjct: 125 GLLNHGVTCYTNAAVQALVHIPAIQHYLFDVLRGEYKSTIAPQSVTQVLAETTKRMWSNE 184

Query: 654 NSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713
           +S N   N   L         G L  +N +  + +    Q+D+ E+ M L+ RL ++   
Sbjct: 185 SSKNQFINPKKL--------IGRLDDINCMMSEWQ----QEDSHEYFMSLISRLQEDSVP 232

Query: 714 QQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCG 773
           + H   +    +LY                             DIF G +   + CK CG
Sbjct: 233 RGHKLTES---ILY-----------------------------DIFGGLLRQEVTCKSCG 260

Query: 774 YTTFNYSTFYVLSLAIPRRSMKLSKLGRST----------EKRVKLEDCINMFTDDEVLS 823
             +      Y LSL +  +  K S  G S           ++R  +E  I  F + E++ 
Sbjct: 261 EVSKTEQPIYDLSLHL--KGKKNSSQGESAKNSSEYEEEPQRRFSIEKSIRDFFNPELIK 318

Query: 824 GENA----WDCPRCGPT 836
            + A    + C +C  T
Sbjct: 319 ADKATKEGYVCEKCHKT 335

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 62/138 (44%), Gaps = 31/138 (22%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKI----------FRT--LFISANYKNYLQPPKGSRSAH 648
            GL NLGN+CY+N+++Q LF   +          F T  +++S+N K  L          
Sbjct: 309 CGLLNLGNSCYMNAVLQVLFNGGVSSWSLDELGDFPTDVVYVSSNLKCQL---------- 358

Query: 649 SSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLH 708
             KL N+L     +MY NG   V P+ F   V     +      QQD  EF   L+D L 
Sbjct: 359 -IKLRNALRT-NPEMYPNG---VKPSTFKDCVGGTHEEFS-SGRQQDALEFFSYLIDLLD 412

Query: 709 DELSNQQHVANDYPNLLL 726
            +L N+      +PN L+
Sbjct: 413 KKLFNRSEF---HPNDLM 427

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 7/51 (13%)

Query: 990  YRLFGVVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADN 1038
            +RL  V+ H G+ V SGHY + + KD+E+      +KW  ++DE +V AD+
Sbjct: 698  FRLSAVICHKGSSVHSGHYVAFIKKDVEN-----ETKWVLYNDEKMVVADD 743

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 8/127 (6%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR-TLFISANYKNYLQPPKGSRSAHSSKLSNSLNML 659
            GL NLGN+CY+NS++Q LF   +    L +  ++   +  P  +      KL N+L + 
Sbjct: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377

Query: 660 FNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 719
             K Y +G   V P    K + +   +      QQD  EFL   +D+L  ++ ++   +N
Sbjct: 378 PEK-YQHG---VKPASVKKCIGEDNEEFS-SGRQQDAMEFLTYFIDKLDRKVFSKASSSN 432

Query: 720 DYPNLLL 726
             PN L+
Sbjct: 433 --PNDLM 437

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 20/127 (15%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSS----KLSNSLN 657
           GL+N+GNTCY+N+ +Q LF A   + L +  +      P K + S  +     K+   L 
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYD------PSKVTNSDANDEIHYKIVLELK 163

Query: 658 MLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILLDRL---- 707
             F  +      SV+P   L  + +  P     D       QQD +E    L   L    
Sbjct: 164 RTFETLKKRSFKSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTVVF 223

Query: 708 HDELSNQ 714
            D+ +NQ
Sbjct: 224 GDKFANQ 230

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 979  NIILKNNETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            N+    N +  Y L GV+ H G    SGHY + +  + +       +KWY F+D+ V
Sbjct: 415  NLAAGENPSSVYDLIGVITHQGANSESGHYQAFIRDESDE------NKWYKFNDDKV 465

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 75/186 (40%), Gaps = 46/186 (24%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKI--FRTLFISANYKNY---LQPPKGSRSAHSSKLSNS 655
            GL NLGN+CY+NS++Q LFA  +  +  + +    K++   +  P  +      KL N+
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVVYPSNNVKCQLIKLLNA 378

Query: 656 LNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 715
           + +  ++ Y  G   + P  F   + Q   +    + QQD  EFL   ++ L  +L    
Sbjct: 379 MKINPSR-YPEG---IKPRSFKNCIGQNNKEF-TSNKQQDALEFLSYFVNELDKKL---- 429

Query: 716 HVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYT 775
                                      F K +   G     D+ +  ME+ LQC RC + 
Sbjct: 430 ---------------------------FKKELTNPG-----DLMRCYMEDRLQCLRCKHV 457

Query: 776 TFNYST 781
            ++Y  
Sbjct: 458 KYSYQA 463

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 14/74 (18%)

Query: 990  YRLFGVVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGSDKNLK 1047
            Y+L GVV H GT V SGHY + + K +++       +W  ++DE +V  D+     KN  
Sbjct: 707  YKLTGVVCHKGTSVHSGHYVAFIKKIVDNV-----ERWVLYNDEKIVLGDDTAEIKKN-- 759

Query: 1048 ISSSDVYVLFYERV 1061
                  Y+ FY RV
Sbjct: 760  -----GYIYFYSRV 768

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 80/205 (39%), Gaps = 44/205 (21%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKI--FRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
            GL NLGN+CY+NS++Q L    I  +   F+ + +   +  P  +      KL N++  
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGIPNWSLDFLGSEFPLDVVYPGNNLKCQWIKLFNAMRC 382

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718
              + Y NG   + PT F K + Q                         H+E S+ +   
Sbjct: 383 E-PEFYPNG---IKPTTFKKCIGQN------------------------HEEFSSNRQ-- 412

Query: 719 NDYPNLLLYNADALKVSNNEYKHWFDK--NVIGNGISPIDDIFQGQMENSLQCKRCGYTT 776
                      DA++           K  ++  +G S ++D+ +  ME+ LQC +CG   
Sbjct: 413 ----------QDAMEFLTFLLDLLDRKFFSIGSSGASNVNDLVRFIMEDRLQCNKCGKVK 462

Query: 777 FNYSTFYVLSLAIPRRSMKLSKLGR 801
           ++Y     + + +   S     L R
Sbjct: 463 YSYEPAEAIQIPLEENSETQDLLER 487

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 23/107 (21%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTV---ITYPLILNI--------ILKNNETMK 989
            ++ +    LP +L++ L RF + +   +  +   I++PL LN+         L     M 
Sbjct: 349  IRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPVPNMM 408

Query: 990  YRLFGVVNHTGTLVSGHYTSL--VNKDLEHSVDIGRSKWYYFDDEVV 1034
            Y+L  +++H GT+  GHYT++  +N D+          W  F+D +V
Sbjct: 409  YKLSAIISHHGTVHQGHYTTICRINGDI----------WAKFNDSMV 445

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 44/109 (40%), Gaps = 8/109 (7%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G +N+GNTCY+N+ +Q L+     R   +  N+   +   K   +    KL   L   F 
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVL--NFDVSINNDKNGENETHIKLVTELKRCFE 165

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
            +      SV+P   L  + +  P     D       QQD +E L  L 
Sbjct: 166 GLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELLTQLF 214

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 74/193 (38%), Gaps = 41/193 (21%)

Query: 641 PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFL 700
           PKG++    S L +    +       G   V P+ F+ ++ Q    L      QD  EFL
Sbjct: 351 PKGTKPTLYSGLKDIFECIAENESAIG--VVSPSNFVNILKQ-ENILFSSSMHQDAHEFL 407

Query: 701 MILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760
             LL+ L D L     +          + D L     E K  F           I+D+F+
Sbjct: 408 NYLLNELSDTLKRDMEL----------DTDKL-----ESKPTF-----------IEDLFK 441

Query: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDE 820
           G + NS +C  C   T     F    + I              ++ +K++D +N +   E
Sbjct: 442 GSLCNSTKCFTCDTITARDEPFLDFPIEI------------QEDEEIKIQDILNNYKHRE 489

Query: 821 VLSGENAWDCPRC 833
           +L+G N + C +C
Sbjct: 490 LLTGANKFYCDKC 502

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 597 SLSITGLRNLGNTCYINSMIQCLFAAKIFRT 627
           S  + G  N GNTCY NS++QCL+    FRT
Sbjct: 111 STKVFGYENFGNTCYCNSVLQCLYNLTEFRT 141

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 59/127 (46%), Gaps = 17/127 (13%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV----ITYPLILNIILKNNETM--KYRLFG- 994
            +T+   +LPK L IHL RF Y   +  +      I YPL L +    +  +   Y L G 
Sbjct: 510  RTVGLKSLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCSSFDSAVCKDYELNGI 569

Query: 995  VVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISS--SD 1052
            V++  G    GHY ++   DL      G   W  FDDE V++ N+    K +  ++  + 
Sbjct: 570  VIHMGGGPHHGHYVAICKNDL-----FG---WLLFDDETVESINEETVLKFIGDANELTT 621

Query: 1053 VYVLFYE 1059
             YVL Y+
Sbjct: 622  AYVLIYK 628

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 42/109 (38%), Gaps = 15/109 (13%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GLRN+GNTCY N+ +Q L+  K  R   ++ N  N              +L   L   FN
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPN---------PDLHGQLVIQLRNCFN 157

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
                      P   L V+ ++ P     D       QQD +E    LL
Sbjct: 158 AFAQRKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLL 206

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 990  YRLFGVVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            Y L GVV H G    SGHY + V  D +       +KWY ++D+ V
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADE------NKWYKYNDDKV 454

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 21/106 (19%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTK---KNSTVITYPLILNI-----ILKNNET-----M 988
            K +    L  +L+    RF + L+    K + VI +PL LN+     + + +++     +
Sbjct: 345  KQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDL 404

Query: 989  KYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
             Y L G++ HTGT+  GHYT++          I   +W  F+D +V
Sbjct: 405  IYELIGIICHTGTVNEGHYTAICK--------IPEGQWIKFNDSMV 442

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 93/222 (41%), Gaps = 36/222 (16%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNY-LQPPKGSRSAHSSKLSNSLN 657
            ++GL N+G+TCY++ +IQCL     F  L  S N  ++ +       +  S  L + + 
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCLVRNPYF--LKYSLNQSHFKICKTHDPTTCISCALDSIVT 192

Query: 658 MLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHDELS 712
             +    L+    V  T    +++ L    KI  +     QQD  EF   LL+RLH E  
Sbjct: 193 DFYGISDLDD--DVKKTNNDGLIDLLTCSWKINQNLAGYSQQDAHEFWQFLLNRLHSEYK 250

Query: 713 NQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
           +     +  P         LK  N+E         + N I     +FQG +++S+ C  C
Sbjct: 251 SNIGPTDTAP---------LKEGNHE---------LCNCI--YHKVFQGFLKSSIVCPEC 290

Query: 773 ---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLED 811
                TT     F  LSL I  ++  L +   S  K+ +L D
Sbjct: 291 NSDAKTTI--EPFMDLSLDIKGKNT-LYECLNSFHKKEQLHD 329

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
            Ashbya gossypii AEL242W
          Length = 696

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 10/77 (12%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTK--KNSTVITYP--LILNII-LKNNETM-----KY 990
            +K    V+ PK+L++HLSR  +D     KNS  + +P  LILN   +K +  +     +Y
Sbjct: 395  LKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIAVHCVRY 454

Query: 991  RLFGVVNHTGTLVSGHY 1007
            +L  ++ HTGT   GHY
Sbjct: 455  KLQAMIKHTGTHFQGHY 471

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 59/145 (40%), Gaps = 41/145 (28%)

Query: 949  LPKILVIHLSRF-----------------YYDLTKKNSTVITYPLILNI--------ILK 983
            LP+IL+I L RF                 Y    +K    I+Y   L I         L+
Sbjct: 681  LPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPDETLASSALR 740

Query: 984  NNETMKYRLFGVVNHTG-TLVSGHYTSLVNKDLEHSVDIGRSKWYYFDD-EVVKADN--- 1038
            NN +  Y L GV+ H G +   GHYT+    D+ H        WY  DD  + K ++   
Sbjct: 741  NNSSKTYELSGVIYHHGMSPDGGHYTA----DVFHKQ---TKTWYRIDDVNITKLEDDDV 793

Query: 1039 -KHGSDKNLKISSSDVYVLFYERVH 1062
             K G D    + S   Y+L Y+ VH
Sbjct: 794  LKGGED---NMDSRTAYILMYQNVH 815

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 55/138 (39%), Gaps = 32/138 (23%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G+ N  N C+++S++Q L     F  +    + +N +    GS SA   KL ++   ++ 
Sbjct: 375 GIINNANICFMSSVLQVLLYCAPFVDILNVVSTRN-MNAKSGSSSA---KLLDACLTIYK 430

Query: 662 KM---------------YLNGGCSVVPTGFLKVVNQLRPD------LKIP-------DDQ 693
           K                   G     P  +  +   + PD        IP         Q
Sbjct: 431 KFDKANYEKEKEKESEKEKPGSKKSSPPAYASITEAVNPDEFYRSLSTIPKFKDLRWGHQ 490

Query: 694 QDTQEFLMILLDRLHDEL 711
           +D +EFL  LLD+LH+EL
Sbjct: 491 EDAEEFLTHLLDQLHEEL 508

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 68/155 (43%), Gaps = 39/155 (25%)

Query: 602 GLRNLGNTCYINSMIQCLF----------------AAKIFRTLFISANY---------KN 636
           G+ N GN C+++S++Q L                 +AK+  T F+  +          K 
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLELYRKFDKQ 407

Query: 637 YLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRP--DLKIPDDQQ 694
             +  K SRS+    +S++L             ++ P  F K +++L    DL+    Q+
Sbjct: 408 AFEREKASRSSSGVNISSAL-----------ADAIKPDDFYKTLSKLPKFKDLRW-GHQE 455

Query: 695 DTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNA 729
           D +EFL  LLD+LH+E  N     +D   + L N+
Sbjct: 456 DAEEFLTHLLDQLHEEFVNSIDSLSDSEVISLINS 490

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 98/249 (39%), Gaps = 50/249 (20%)

Query: 598 LSITGLRNLGNTCYINSMIQC-LFAAKIFRTLF--ISANYKNYLQPPKGSRS-AHSSKLS 653
           L   GL N G TCY N+ +Q  L    I   LF  +  ++K  + P   ++  A +SK  
Sbjct: 359 LKPKGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDVLRGDHKTTISPQSVTQVLAETSKRM 418

Query: 654 NSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713
            S     N  Y+N    +   G L  +N +  + +    Q+D+ E+ M L+ RL ++   
Sbjct: 419 WSPEPNKN-TYINPKKLI---GRLDDINCMMSEWQ----QEDSHEYFMSLMSRLQEDSVP 470

Query: 714 QQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCG 773
           + H   +                                S I DIF G +   + CK CG
Sbjct: 471 RGHKLTE--------------------------------SIIYDIFGGLLHQKVTCKSCG 498

Query: 774 YTTFNYSTFYVLSLAIPRRSMKLSKLGRSTE----KRVKLEDCINMFTDDEVLS--GENA 827
             +     FY LSL +  +      +  + E    +R  +E  I+ F + E++    ++ 
Sbjct: 499 GVSKTEQPFYDLSLHLKGKKKSDETVPENQEDVPQRRYSIEKSISDFFNPELIKVDKKDG 558

Query: 828 WDCPRCGPT 836
           + C +C  T
Sbjct: 559 YVCEKCHKT 567

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 947  VTLPKILVIHLSRFYYDLT-----------KKNSTVITYPLILNIILKNNETMKYRLFGV 995
            V LPK+LVIHLSR  ++             ++   +  Y  I N+ L  N  + Y L  V
Sbjct: 345  VKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSV 404

Query: 996  VNHTGTLVSGHY 1007
            V HTG+   GHY
Sbjct: 405  VKHTGSHSRGHY 416

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 44/112 (39%), Gaps = 6/112 (5%)

Query: 599 SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658
           S  G +N+GNTCY+N+ +Q L+     R + ++ N    +            ++   +  
Sbjct: 107 SPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIEMKR 166

Query: 659 LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMILL 704
            F  ++     SV+P   L  + +  P     D       QQD +E    L 
Sbjct: 167 CFENLHNKSFKSVLPIVLLNTLRKCYPQFAERDQQGGFYKQQDAEELFTQLF 218

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 979  NIILKNNETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1037
            N+    N +  Y L GV+ H G    SGHY + +  +L+ +      KWY F+D+ V A 
Sbjct: 420  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVTAV 473

Query: 1038 NKH 1040
             K 
Sbjct: 474  EKE 476

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 46/112 (41%), Gaps = 10/112 (8%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G +N+GNTCY+N+ +Q L+  +  R + +  N  +   P   +      ++      L +
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNSTTTPVDETHKKIVVEMKRCFENLKS 169

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILLDRL 707
           K Y     SV+P   L  + +  P     D       QQD +E    L   +
Sbjct: 170 KSYK----SVMPMVLLTALRKCYPQFAERDPQSGFYKQQDAEELFTQLCQSM 217

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 990  YRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            Y L GV+ H G    SGHY S +  D++        KWY F+D+ V
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDED------KWYNFNDDKV 464

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
            (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 11/80 (13%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYD--LTKKNSTVITYPLILNIILKN----NETMK--- 989
            T +K  + +  PKIL+IHLSR  Y+  +  +NS  + +   ++I  +     NE +K   
Sbjct: 333  TIIKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKIEL 392

Query: 990  --YRLFGVVNHTGTLVSGHY 1007
              Y+L  ++ HTGT  SGHY
Sbjct: 393  VDYQLQSIIKHTGTHNSGHY 412

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 89/198 (44%), Gaps = 28/198 (14%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFIS---ANYKNYLQPPKGSRSAHSSKLSNSLN 657
           TGL N    CY NS +Q L +   F T++++   + ++  L+  K  + A  +       
Sbjct: 66  TGLVNTSTECYANSSVQVLASLSNF-TIYLNKVISIFELELKIEKVEKDAKEA------- 117

Query: 658 MLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD---QQDTQEFLMILLDRLHDELSNQ 714
             F+  YL     V+P  +   + QL  DL+   D   ++    F+ IL   +H  ++  
Sbjct: 118 --FD-TYL---YKVIPVHY--ALCQLLADLQELIDRPRERSVSNFIRILEASIHKRITGG 169

Query: 715 QHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGY 774
           Q  AN+   ++L   + L+      K + ++  +   +      F+G++ + L C  CG 
Sbjct: 170 QQDANELTQIVL---EVLQNELESLKKYVNRMELSIEVPRFP--FEGKLASYLSCLNCGQ 224

Query: 775 TTF-NYSTFYVLSLAIPR 791
           T+  N STF +L +  P+
Sbjct: 225 TSIPNISTFNILPIQTPQ 242

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 6/121 (4%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKI-FRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNML 659
            GL NLGN+CY+NS++Q LF   +   +L +  ++   +  P  +      KL N++   
Sbjct: 313 CGLNNLGNSCYMNSVLQVLFNGAVPDWSLEVLGDFPRDVVYPSTNLKCQLIKLRNAIKRN 372

Query: 660 FNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 719
            +  Y  G   + P+ F + + +   +      QQD  EF    +D L  +L ++    N
Sbjct: 373 PSD-YTTG---IKPSTFKRCIGESHEEFS-SGRQQDAMEFFTYFIDELDKKLFSRGSNPN 427

Query: 720 D 720
           D
Sbjct: 428 D 428

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 54/111 (48%), Gaps = 6/111 (5%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFR-TLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
           GL NLGN+CY+NS++Q L    I    L    ++   +  P+ +      K+ N++ +  
Sbjct: 317 GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQQ 376

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
           ++ Y  G   + PT F KV+     +      QQD+ EF   L D+L  E+
Sbjct: 377 SR-YPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREI 422

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626
           TG+ N+GNTCY+NS++Q  F+  +FR
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFR 783

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 67/194 (34%), Gaps = 34/194 (17%)

Query: 594 VYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLS 653
            Y  L   GL N G TCY N+ +Q L      +          Y      +  +H     
Sbjct: 378 TYSKLKPKGLLNHGVTCYTNAAVQALLHIPAMQHYLNDILAGKYSSTISSNSVSHVL-AE 436

Query: 654 NSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713
            S  M  N    +G   + P   +  ++ +   +     Q+D+ E+ M ++ RL ++   
Sbjct: 437 TSRRMWHNDGKKSGNSYINPKKLIARLDDINC-MMSEWQQEDSHEYFMSIMSRLQEDSVP 495

Query: 714 QQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCG 773
           + H   +                                S I DIF G ++ ++ CK CG
Sbjct: 496 KGHKMTE--------------------------------SIIYDIFGGSLKQTVTCKSCG 523

Query: 774 YTTFNYSTFYVLSL 787
             +     FY LSL
Sbjct: 524 EVSTTEQPFYDLSL 537

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
            YPL072W
          Length = 734

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLT--KKNSTVITYPLILNI---ILKNNET-----M 988
            T VK    V  PK LV+HLSR  +D    ++NS  + +  IL     ++++N+      +
Sbjct: 422  TIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGINPI 481

Query: 989  KYRLFGVVNHTGTLVSGHY 1007
             Y+L  +V H+G+   GHY
Sbjct: 482  SYKLKAIVAHSGSHSQGHY 500

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 17/114 (14%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSS-----KLSNSL 656
           G +N+GNTCY+N+ +Q L+     R + +  +YK    PP  S + +       K+   +
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMIL--DYK----PPAQSSTYNPEDEMHHKIVLEI 165

Query: 657 NMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
              F  +      SV+P   L V+ +  P     D       QQD +E    L 
Sbjct: 166 KRCFENLEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELFTQLF 219

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar to
            gnl|GLV|KLLA0E23463g Kluyveromyces lactis KLLA0E23463g
            and some similarites with YPL072W uniprot|Q02863
            Saccharomyces cerevisiae YPL072W UBP16 Putative
            ubiquitin-specific protease
          Length = 767

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 39/79 (49%), Gaps = 10/79 (12%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLTK--KNSTVITYP----LILNIILKNN----ETM 988
            T VK    V  P++L+IHLSR  ++     +NS  + +     L   II KN       +
Sbjct: 442  TIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVNNV 501

Query: 989  KYRLFGVVNHTGTLVSGHY 1007
            KYRL   V H GT  +GHY
Sbjct: 502  KYRLRATVRHQGTHSAGHY 520

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 54/141 (38%), Gaps = 42/141 (29%)

Query: 694 QDTQEFLMILLDRLHDELSNQ-QHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGI 752
           QD  EFL  L++ L D L  Q Q + +  P   ++                         
Sbjct: 431 QDAHEFLNFLMNALSDSLQLQLQRLPDKSPENFIHT------------------------ 466

Query: 753 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDC 812
                +FQG M NS++C  C   T N   F+  ++ +            S ++ + ++D 
Sbjct: 467 -----LFQGTMNNSIKCLTCDNITSNEEPFFDFAIPV------------SEDEELNVQDI 509

Query: 813 INMFTDDEVLSGENAWDCPRC 833
           +  F   E+L+G N + C  C
Sbjct: 510 LRDFHQREMLNGANKFYCDSC 530

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           + GL N GNTCY NS++QCL+  K  R
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 47/122 (38%), Gaps = 7/122 (5%)

Query: 589 EQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAH 648
           EQ    +  L + G +N+GNTCY+N+ +Q L+     R + ++ N    +          
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEI 156

Query: 649 SSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMI 702
             ++   +   F  +      SV+P   L  + +  P     D       QQD +E    
Sbjct: 157 HKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFTQ 216

Query: 703 LL 704
           L 
Sbjct: 217 LF 218

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 979  NIILKNNETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            N+    N +  Y L GV+ H G    SGHY + +  +L+ +      KWY F+D+ V
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKV 469

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 9/112 (8%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           GL+N+GNTCY+N+ +Q L+     R   ++ + K+   P      +H   L   L   F 
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNFP--ADDESHFL-LVQELKRCFQ 161

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMILLDRL 707
           ++      SV P   L V+ +  P     D       QQD +E    L   L
Sbjct: 162 QLKDKPQESVTPILLLSVLRRCYPQFAERDSQSGFYKQQDAEELFTQLFHSL 213

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 985  NETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            N +  Y L GV+ H G    SGHY + +  +++ +      KWY F+D+ V
Sbjct: 418  NPSCVYDLIGVITHQGANSESGHYQAFIRDEMDEN------KWYKFNDDKV 462

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt, 250
            aa]
          Length = 249

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 14/79 (17%)

Query: 985  NETMKYRLFGVVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADNKHGS 1042
            NE  KY+L  VV H G  V SGHY + + K++E+       +W  ++DE +V A+     
Sbjct: 182  NEPGKYKLTSVVCHKGNSVQSGHYVAFIKKEIENV-----ERWVLYNDEKIVIAE----- 231

Query: 1043 DKNLKISSSDVYVLFYERV 1061
              +L+  S + Y+  Y RV
Sbjct: 232  --DLEELSKNGYIYIYSRV 248

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 947  VTLPKILVIHLSRFYYDLTK-----------KNSTVITYPLILNIILKNNETMKYRLFGV 995
            V LP IL++HLSR  ++              +  T+  Y L  +  +  N  +KY L  V
Sbjct: 337  VQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITENRQVKYNLKSV 396

Query: 996  VNHTGTLVSGHY 1007
            V HTG+  SGHY
Sbjct: 397  VKHTGSHSSGHY 408

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 10/79 (12%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLTK--KNSTVITYPLILNI---ILKNNE-----TM 988
            T VK    V  P++L+IHLSR  ++ T   +N   + +  IL +   +++N+      ++
Sbjct: 459  TIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGINSV 518

Query: 989  KYRLFGVVNHTGTLVSGHY 1007
             Y L  +V H G+   GHY
Sbjct: 519  NYELKAIVKHAGSHSQGHY 537

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ 639
           TGL N+GNTCY+NS++Q  F+    R   +  +Y+N +Q
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL--DYRNTVQ 769

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 46/109 (42%), Gaps = 9/109 (8%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G+ N+GNTCY+N+ +Q L+     R   ++ + K            +  +L   +   F 
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAE---GMDLYHVQLIREIQATFR 117

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
           K+    G ++ P   L+++ ++ P     D       QQD +E    L 
Sbjct: 118 KLRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLF 166

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 984  NNETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKH 1040
             N +  Y L GV+ H G    SGHY + +  + +        KWY F+D+ V A  K 
Sbjct: 371  ENPSCVYDLIGVITHQGANSESGHYQAFMRDEFDDD------KWYKFNDDKVTAIEKE 422

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 38.9 bits (89), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 16/89 (17%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTL----------FISANYKNYLQPPKGSRSAHSSK 651
           GL N+GNTCY+NS++Q  FA    R            F + +    +    G R   +S+
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQSTTESFEATDTDAKINRRIGGRQVCASE 785

Query: 652 LSNSLNM------LFNKMYLNGGCSVVPT 674
           +  S+        LFN M  +    V PT
Sbjct: 786 VERSIQFTYQLRDLFNGMIFSNSRCVSPT 814

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 63/146 (43%), Gaps = 44/146 (30%)

Query: 949  LPKILVIHLSRFYY-------DLTKKNS------------------TVITYPLILNIILK 983
            LP+ L+I   RF +       DL+  NS                  T+    +  N++  
Sbjct: 637  LPQALLIQFKRFSFVSQSSKNDLSNYNSFNGRIEKIRKMVKYNHELTIPKESISPNLVST 696

Query: 984  NN--ETMKYRLFGVVNHTGTLVS-GHYTSLV-NKDLEHSVDIGRSKWYYFDDEVVKADNK 1039
            +N  E+ KY L GV+ H G   S GHYT  V +KDL+        KWY  DD  V  D  
Sbjct: 697  SNSEESFKYYLSGVIYHHGVSPSGGHYTCDVYDKDLD--------KWYRIDD--VNVDEI 746

Query: 1040 HGSDKNLKI--SSSD---VYVLFYER 1060
               +  L+   S+SD    Y+L YE+
Sbjct: 747  KNKEDILRSGDSASDSRTAYILLYEK 772

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 38.9 bits (89), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISAN 633
            GL N+GNTCY+NS++Q  FA    R   I+ N
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLINFN 794

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 57/274 (20%), Positives = 105/274 (38%), Gaps = 61/274 (22%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNML 659
           + GL N GNTC++NS++Q L +++           ++     + + S     L + LN  
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAHFLDDIIEESEPNKNELNFSVAFKTLLDKLNAK 124

Query: 660 F--NKMYLNGGCSVVPTGFLKVVNQL-RPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 716
           +  N+ Y        P   LK +      ++ +  DQ+D QEF   ++ +L  +L  +  
Sbjct: 125 YGRNRKYYR------PNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDT 178

Query: 717 ---------------------VANDYPNLLLYNADALKVSNNEY--KHWFDKN-VIGNG- 751
                                + +D P   L N + L+     Y      + N  +G G 
Sbjct: 179 DGDFKKEESVQPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGE 238

Query: 752 ----------ISPIDDIFQGQMENSLQCKRCGYT-TFNYSTFYVLSLAIPRRSMKLSKLG 800
                     ++P+D    G +   + C  CG      YS    LSL +P  ++  +   
Sbjct: 239 HESFYTPYKLLTPLD----GIIAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGAT--- 291

Query: 801 RSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
                 +KL + ++ + + E++ G    DC RC 
Sbjct: 292 ------LKLSELLDKWVEPEIIEG---VDCNRCA 316

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 117/313 (37%), Gaps = 100/313 (31%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAA----KIFRTLFISAN--YKNYL--------------- 638
           + GL N GNTC++NS++QCL ++    K   T+ + +N   +N +               
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASSKELHKFMDTIILDSNDDSQNTIDENGEESDLPNEQST 142

Query: 639 --QPPKGS-------------RSAHSSKLSNS----------LNMLFNKM----YLNGGC 669
             + PK +             R A +  L NS          L  LF+K+    Y N   
Sbjct: 143 VEKKPKATKNKTYGKRKKIAVRQADNELLKNSTEPNMHFTLALQDLFSKLNAKHYRN--- 199

Query: 670 SVVPTGFLKVVNQLRPDLKIPD-------DQQDTQEFLMILLDRLHDELSN--------- 713
                 + K    L+   K P+       DQ+D QEF   +L  L   + +         
Sbjct: 200 ----RPWFKTNKLLKTMSKAPNRNIILGYDQEDAQEFFQTILSELEKNVESIYGKPEKDP 255

Query: 714 QQHVANDYPNLLLYNADALKVSNNEY--KHWFDKN-VIGNG---------ISPIDDIFQG 761
           +    +D P   +   + L    + Y      D N V+ +G         ++P+D I   
Sbjct: 256 KPVPQDDLPEDAIVGQEHLGEIGDVYIPTEQIDPNSVLASGRKFYSPYKIVTPLDGITAE 315

Query: 762 QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEV 821
           ++   LQC   G     YS F  LSL +P  ++            +KL   ++ ++  E+
Sbjct: 316 RI-GCLQCGENG--GIRYSVFSGLSLNLPSDNIG---------SPIKLSQLLDEWSKPEI 363

Query: 822 LSGENAWDCPRCG 834
           + G    DC RC 
Sbjct: 364 IEG---VDCNRCA 373

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
            weakly similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072w UBP16
          Length = 483

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 68/159 (42%), Gaps = 36/159 (22%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYD--LTKKNSTVITYPLILNII------LKNNE---T 987
            + +K   FV  P I VIHLSR  Y+     +N   + +   L+          +NE    
Sbjct: 324  SILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKR 383

Query: 988  MKYRLFGVVNHTGTLVSGHYTSL----------VNKDLEHS-VDIGRSKWYYFDDEVVKA 1036
            ++YRL  +V HTG+  SGHY  L          V+ D+ ++   IG  K    D    + 
Sbjct: 384  VRYRLKSIVIHTGSHYSGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTVMDSNFRRM 443

Query: 1037 DNKH------GSDKNLK---IS-----SSDVYVLFYERV 1061
             +         SD N+K   IS        VY+LFYER+
Sbjct: 444  KSTTIYPFWLISDTNVKEKRISDIVNEQKSVYMLFYERI 482

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
            (REAL)
          Length = 501

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 947  VTLPKILVIHLSRFYYDLTK-----------KNSTVITYPLILNIILKNNETMKYRLFGV 995
            V LP ILV+HLSR  ++              +   +  Y L  N  +  N  +KY L  V
Sbjct: 337  VQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVKYNLKSV 396

Query: 996  VNHTGTLVSGHY 1007
            V HTG+   GHY
Sbjct: 397  VKHTGSHSRGHY 408

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 754

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 61/134 (45%), Gaps = 25/134 (18%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP IL +HL RF Y  T +N  +     I YPL L +    + ++  +Y L G
Sbjct: 551  RIVGLKQLPHILALHLKRFKYSET-QNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTG 609

Query: 995  -VVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISS--- 1050
             VV+  G    GHY SL   +        +  W  FDDE V++ ++      +K      
Sbjct: 610  IVVHMGGGPHHGHYVSLCKNE--------KFGWLLFDDETVESVDESSV---MKFCGDLH 658

Query: 1051 --SDVYVLFYERVH 1062
              +  YVLFY+ ++
Sbjct: 659  DLTTAYVLFYKEIN 672

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFR 626
           + G  N GNTCY NS++QCL+    FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 62/166 (37%), Gaps = 46/166 (27%)

Query: 671 VVPTGFLKVV---NQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLY 727
           V PT F++++   N L   +      QD  EFL  LL+ L D L  Q             
Sbjct: 421 VSPTSFVEILKRENVLFSTMM----HQDAHEFLNFLLNELSDSLQRQ------------I 464

Query: 728 NADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSL 787
           + D++   N+ +               ID +F+G M N  +C  C   T     F    +
Sbjct: 465 SDDSIITPNDNF---------------IDRLFKGTMTNQTKCLTCDNITSRDEPFLDFPI 509

Query: 788 AIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833
            +            +      +++ ++ F   E+L+G N + C +C
Sbjct: 510 EV------------NGNCETDIQEMLSDFHQKEMLNGSNKFYCDKC 543

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 575 LQPQPQRAYNIPTIEQSSNVYVSLSIT-----GLRNLGNTCYINSMIQCLFAAKI--FRT 627
           LQ +    +    ++ S   +  LS +     GL NLGN+CY+NS+IQ L    +  +  
Sbjct: 292 LQVEQNENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSL 351

Query: 628 LFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDL 687
            F+ + +   +  P  +      KL N++     ++Y NG   + PT F K + Q   + 
Sbjct: 352 DFLGSKFPLDVVYPDNNLKCQWIKLLNAMK-CEPELYPNG---IKPTTFKKCIGQNHQEF 407

Query: 688 KIPDDQQDTQE 698
              + QQD  E
Sbjct: 408 S-SNRQQDAME 417

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 20/95 (21%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK------------GSRSAH 648
            GL N+GNTCY+NS++Q  F     R     A+Y+  L+  +            G R  +
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV--ADYQKTLEAVENCLEDGWDKRRIGGREIN 783

Query: 649 SSKLSNSLNM------LFNKMYLNGGCSVVPTGFL 677
             ++  S+        LFN+M  +    V PT  L
Sbjct: 784 KVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKEL 818

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLS 653
           TGL N+GNTCY+NS++Q  F+    R   +  NY+  L   +    A   ++S
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVL--NYQKMLNCFRDIEDATGGEIS 751

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFIS 631
           TGL N+GNTCY+NS++Q  FA    R   I+
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 589 EQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISAN 633
           EQ    +  L + G +N+GNTCY+N+ +Q L+     R + ++ N
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLREMILNYN 141

 Score = 35.0 bits (79), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 979  NIILKNNETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            N+    N +  Y L GV+ H G    SGHY + +  +L+ +      KWY F+D+ V
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKV 469

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 61/143 (42%), Gaps = 39/143 (27%)

Query: 949  LPKILVIHLSRFYY-DLTKKNSTVITYPLILNIILK------------------------ 983
            LP++L+I L RF + + T K+++++ Y      I K                        
Sbjct: 693  LPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELIIPIESISSANAY 752

Query: 984  NNETMKYRLFGVVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDD----EVVKADN 1038
             +E  +Y L GV+ H G     GHYT+    D+ H       KWY  DD    E+ K D 
Sbjct: 753  KDENRRYHLTGVIYHHGVSSDGGHYTA----DVYHRES---DKWYRIDDVSIIELEKEDV 805

Query: 1039 KHGSDKNLKISSSDVYVLFYERV 1061
              G +++    S   Y+L Y+++
Sbjct: 806  LKGGEESG--DSRTAYILMYQKI 826

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 37/141 (26%)

Query: 949  LPKILVIHLSRFYYDL-TKKNSTV----------------------ITYPL--ILNIILK 983
            LP++L+I L RF +   + K+S +                      +T P+  + +  L+
Sbjct: 783  LPRVLLIQLKRFAFVTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLTIPIESVSSTSLR 842

Query: 984  NNETMKYRLFGVVNHTGTLV-SGHYTSLVNKDLEHSVDIGRSKWYYFDD---EVVKADNK 1039
            ++   +Y+L GV+ H G+    GHYT+    D+ H      +KWY  DD     +K D+ 
Sbjct: 843  DDANREYKLTGVIYHHGSSPDGGHYTA----DVFHQ---QTNKWYRIDDVNISELKNDHV 895

Query: 1040 HGSDKNLKISSSDVYVLFYER 1060
              +D N  + +   Y+L YE+
Sbjct: 896  LDADDN-DMGTRTAYILIYEK 915

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFI 630
           TG+ N+GNTCY+NS++Q  FA    R   +
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIV 751

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 56/139 (40%), Gaps = 23/139 (16%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKN-----------YLQPPKGSRSA-- 647
            G+ N+GNTCY+NS++Q  F  K  R   +  NY +           + +   G R    
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFIL--NYDDDSAKLLDASEYHSRRRIGGREVSK 755

Query: 648 ----HSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRP---DLKIPDDQQDTQEFL 700
                S +    L  LFN M       V PT  L V     P   +++  DD    +E +
Sbjct: 756 QEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKEL-VYLAFAPSNVEVEFGDDTVAQKELI 814

Query: 701 MILLDRLHDELSNQQHVAN 719
            +  D + D     +H+A+
Sbjct: 815 DLTTDVVEDPTDTTRHLAS 833

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 24/133 (18%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIF-------------------RTLFISANYKNYLQPPK 642
           G+ N  N C+++S++Q L +   F                   +T  + A  K Y +  K
Sbjct: 420 GIINSANICFMSSVLQVLLSCAPFINILNVVSINSNIMKPGVNQTKLLDACIKLYSRFDK 479

Query: 643 GSRSAHSSKLSNS--LNMLFNKMYLNGGCSVVPTGFLKVVNQLRP--DLKIPDDQQDTQE 698
            S  A   K  ++   +   +  Y     ++ P  F KV++ +    DLK    Q+D +E
Sbjct: 480 ESFEAEKEKEKDNESSSKKQSSQYNAKATAISPEEFYKVLSTISKFKDLKW-GHQEDAEE 538

Query: 699 FLMILLDRLHDEL 711
           FL  LLD+LH+E 
Sbjct: 539 FLTHLLDQLHEEF 551

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFI 630
            GL N+GNTCY+NS++Q  F+ K  R   +
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFI 630
           TGL N+GNTCY+NS++Q  F     R   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin- specific
            protease
          Length = 752

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 941  VKTINFVTLPKILVIHLSRFYYDLTK--KNSTVITYPLILNI---ILKNNET-----MKY 990
            VK       P+IL++HLSR  ++ T   +NS  + +   L+     ++NN       +KY
Sbjct: 436  VKKTVVTESPEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKY 495

Query: 991  RLFGVVNHTGTLVSGHY 1007
            +L  +V H GT   GHY
Sbjct: 496  KLKSMVKHQGTHSQGHY 512

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 18/90 (20%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR--TLFISANYKNYLQPPK--------GSRSAHSS 650
           TG+ N+GNTCY+NS++Q  F+    R   L  S  Y+++    +        G R    +
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDN 811

Query: 651 KLSNSL-------NMLFNKMYLNGGCSVVP 673
           ++  S+       ++ +  +Y N  C V P
Sbjct: 812 EVERSIQFIYQLRDLFYAMIYTNKRC-VTP 840

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 58/144 (40%), Gaps = 41/144 (28%)

Query: 949  LPKILVIHLSRFYY--DLTKKNST-----------------------VITYPLILNIILK 983
            LP +L+IHL RF +  +  K NS                        VI    I N    
Sbjct: 886  LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAETITNGKQL 945

Query: 984  NNETMKYRLFGVVNHTG-TLVSGHYTSLVNKDLEH-SVDIGRSKWYYFDD----EVVKAD 1037
              E   Y L GVV H G +   GHYT+    D+ H  VD    KWY  DD    E+ K D
Sbjct: 946  APENRTYELTGVVYHHGLSSDGGHYTA----DIYHKEVD----KWYRIDDVTVTELEKDD 997

Query: 1038 NKHGSDKNLKISSSDVYVLFYERV 1061
               G + +    S   Y+L Y+++
Sbjct: 998  VLKGGENS--TDSRTAYILMYQKL 1019

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin-specific
            protease
          Length = 782

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 47/85 (55%), Gaps = 10/85 (11%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLT--KKNSTVITY--PLILN-IILKNNETM----- 988
            T VK    V  P +L++HLSR  +D    +KN+  +++   L++N  +++NN+ +     
Sbjct: 437  TIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNKCVGIRKD 496

Query: 989  KYRLFGVVNHTGTLVSGHYTSLVNK 1013
             Y+L  ++ H G+  +GHY    +K
Sbjct: 497  SYKLRSMLRHQGSHSTGHYECFRHK 521

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL 638
           TG+ N+GNTCY+NS++Q  F+    R+  +  NY+  L
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTL 771

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa] {ON}
            YPL072W (UBP16) - putative deubiquitinating enzyme
            [contig 24] FULL
          Length = 749

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 10/79 (12%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLTK--KNSTVITYPLILNII---LKNNET-----M 988
            T VK       P IL++HLSR  ++     +NS  +T+   L+     ++NN       +
Sbjct: 436  TIVKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNRCVGVKPI 495

Query: 989  KYRLFGVVNHTGTLVSGHY 1007
            KY+L  +V H GT   GHY
Sbjct: 496  KYKLKAMVKHEGTHSQGHY 514

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 41/109 (37%), Gaps = 6/109 (5%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFN 661
           G +N+GNTCY+N+ +Q L+     R + ++ N                 ++   +   F 
Sbjct: 110 GFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQIIIEMKRCFE 169

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
            +      SV+P   L  + +  P     D       QQD +E    L 
Sbjct: 170 NLQNKSFKSVLPIVLLNTLRKCYPQFAERDAQGGFYKQQDAEELFTQLF 218

 Score = 35.4 bits (80), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 979  NIILKNNETMKYRLFGVVNHTGT-LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1034
            N+    N +  Y L GV+ H G    SGHY + +  +L+ +      KWY F+D+ V
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKV 469

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626
           TGL N+GNTCY+NS++Q  F+    R
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 50/118 (42%), Gaps = 28/118 (23%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFR------------TLFISANYKNYLQPPKGSRSAHS 649
           GL+NLGN+CY+NS++Q L    + R             L++S+N +  L           
Sbjct: 310 GLQNLGNSCYLNSVLQVLLNGDLSRWSLEGLGDFPGDVLYVSSNLRCQL----------- 358

Query: 650 SKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRL 707
            K+ N+L     K Y +G   V PT F   +     +      QQD  EF    +D L
Sbjct: 359 IKMRNALKNEPEK-YPHG---VKPTTFKHCIGGTHEEFS-SGRQQDALEFFSYFVDLL 411

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 60/148 (40%), Gaps = 46/148 (31%)

Query: 949  LPKILVIHLSRF-----------------YYDLTKKNSTVITYPLILNI----------- 980
            LP++L+I L RF                 Y    +K    I Y   L I           
Sbjct: 698  LPQVLLIQLKRFEFVNNNSERRELVNYNAYNGRIEKICKWIKYDHDLTIPKEALSSINAK 757

Query: 981  -ILKNNETMKYRLFGVVNHTGTLVSG-HYTS-LVNKDLEHSVDIGRSKWYYFDDEVVKAD 1037
             +  +N+T  Y+L GVV H G   SG HYT+ ++++D E        KWY  DD  V   
Sbjct: 758  FLFSDNDT-SYKLTGVVYHHGLSSSGGHYTADVLHQDEE--------KWYRIDDTTVTEI 808

Query: 1038 NKH----GSDKNLKISSSDVYVLFYERV 1061
            NK     G ++     S   Y+L Y+R 
Sbjct: 809  NKEEVVTGGEEGSH--SRTAYILIYQRA 834

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 59/142 (41%), Gaps = 39/142 (27%)

Query: 949  LPKILVIHLSRFYY-DLTKKNSTVITYPLILNIILK------------------------ 983
            LP++L+I L RF + + T K++++I Y      I K                        
Sbjct: 662  LPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMIPIESISSTNAL 721

Query: 984  NNETMKYRLFGVVNHTG-TLVSGHYTSLVNKDLEHSVDIGRSKWYYFDD----EVVKADN 1038
             +E  +Y L GV+ H G +   GHYT+    D+ H       KWY  DD    EV K   
Sbjct: 722  RDEDRQYSLSGVIYHHGLSSDGGHYTA----DVYHKE---TDKWYRIDDINITEVQKDSV 774

Query: 1039 KHGSDKNLKISSSDVYVLFYER 1060
              G +    + S   Y+L Y++
Sbjct: 775  LKGGEDG--VDSRTAYILMYQK 794

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLR 721

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 18/88 (20%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK----------GSRSAHSSK 651
           GL N+GNTCY+NS++Q  F+    R   +  NYK  +   +          G R    ++
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYIL--NYKGSISNYEIDETSNKRRIGGREVSENE 768

Query: 652 LSNSLNM------LFNKMYLNGGCSVVP 673
           +  S+        LFN M  +    + P
Sbjct: 769 VERSIQFMYQLRDLFNDMIYSKSRCITP 796

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 68/157 (43%), Gaps = 48/157 (30%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNML-- 659
           G+ N GN C+++S++Q L   + F +L    + K             S+K+ N+  +L  
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIKT------------SAKMGNTGFLLLD 57

Query: 660 --------FNKM--------YLNGGCSVVPTGFLKVVNQLRPD------LKIP------- 690
                   F+K+         +N G S + +    + + ++PD       K+P       
Sbjct: 58  ACLELYRKFDKVTFEREKAARINAGNSGISSA---LADAIKPDDFYKTLSKLPKFKDLRW 114

Query: 691 DDQQDTQEFLMILLDRLHDEL--SNQQHVANDYPNLL 725
             Q+D +EFL  LLD+LH+E   S      ND  NL+
Sbjct: 115 GHQEDAEEFLTHLLDQLHEEFVQSIDSLSDNDVSNLI 151

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 55/148 (37%), Gaps = 48/148 (32%)

Query: 949  LPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMK------------------- 989
            LP++ +I L RF +      S V+ Y      + K  + ++                   
Sbjct: 310  LPEVFLIQLKRFSFINNTDKSKVVNYNAYSGRVEKIRKKIRFGSELTIPSSAISSVHANF 369

Query: 990  -------YRLFGVVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDD--------EV 1033
                   Y+L GVV H G   S GHYT  V ++        + KW+  DD        E 
Sbjct: 370  YKESGSTYKLIGVVYHHGVSSSGGHYTCDVYQE-------AQKKWFRIDDINVQEIEMEE 422

Query: 1034 VKADNKHGSDKNLKISSSDVYVLFYERV 1061
            V    + GSD      S   Y+L Y+++
Sbjct: 423  VLQPGEEGSD------SRTAYILIYQKL 444

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 89/205 (43%), Gaps = 34/205 (16%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660
           TGL N GN C+INS +Q L  ++ F          +YL           + +   L  L 
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRF---------NHYL-----------NSVLRCLKFLN 108

Query: 661 NKMYLNGGCSVVPTGFLKVVNQLRPDLKIP---DDQQDTQEFLMILLDRLHDELSNQQHV 717
                 G    +P    +V+ +   DL+ P   +  + + + ++ +      ++S +Q+ 
Sbjct: 109 ENPKQEGNRYALP--LHQVMAEFIYDLQAPTFLNTVESSDKIIVTMESIFKQKMSRRQND 166

Query: 718 ANDYPNLLLYNADALKVSNNEYKHWFD-KNVIGNGISPIDDIFQGQMENSLQCKRCGYTT 776
           A ++  LL      L+V +NEY+      N I N +      F+G+  + L C +CG  +
Sbjct: 167 AQEFTQLL------LEVLHNEYQELIRLMNFITNNLDIPTYPFEGKYCHELTCLKCGRNS 220

Query: 777 -FNYSTFYVLSLAIPRR-SMKLSKL 799
                 F +L+L +P + S+ L +L
Sbjct: 221 EVKMFDFDILTLNLPAQPSISLDEL 245

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 10/79 (12%)

Query: 939  TTVKTINFVTLPKILVIHLSRFYYDLTK--KNSTVITY--------PLILNIILKNNETM 988
            T VK   FV +P IL+IHL+R  ++     +N+  I Y         L+++ +      +
Sbjct: 322  TIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQLVMDGVSVMRNNI 381

Query: 989  KYRLFGVVNHTGTLVSGHY 1007
            +Y L   + H+G+   GHY
Sbjct: 382  QYTLSSAIKHSGSHSMGHY 400

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 35.8 bits (81), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANY 634
           TG+ N+GNTCY+NS++Q  F     R   ++ ++
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILAYDH 710

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098W UBP9 Ubiquitin-specific protease that
            cleaves ubiquitin-protein fusions
          Length = 714

 Score = 35.4 bits (80), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 57/127 (44%), Gaps = 19/127 (14%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNIILKNNETM--KYRLFG 994
            + +    LP  L +H+ RF Y   ++N  V     I YPL L +    + ++  +Y L G
Sbjct: 518  RVVGLKQLPFYLALHMKRFKYS-EEQNCNVKLFNRIRYPLDLKVCSTFDASVCKQYELVG 576

Query: 995  -VVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISS--S 1051
             VV+  G    GHY SL   +        R  W  FDDE V+  N+    K +  S   +
Sbjct: 577  LVVHMGGGPHHGHYVSLCKNE--------RFGWLLFDDETVETVNESTVLKFVGNSDDLT 628

Query: 1052 DVYVLFY 1058
              Y+LFY
Sbjct: 629  TAYLLFY 635

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
            YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
            [contig 33] FULL
          Length = 711

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 58/131 (44%), Gaps = 19/131 (14%)

Query: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTV-----ITYPLILNII--LKNNETMKYRLFG 994
            + +    LP  L +H+ RF Y   ++N  V     I YPL L +     ++   +Y L G
Sbjct: 516  RVVGLKQLPFYLALHMKRFKYS-ERQNCNVKLFNRIHYPLHLKVCSTFDSSVCKQYELVG 574

Query: 995  -VVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLKISS--S 1051
             VV+  G    GHY S+   +        R  W  FDDE V+  N+    K +  S   +
Sbjct: 575  LVVHMGGGPHHGHYVSICKNE--------RFGWLLFDDETVETVNESTVLKFVGNSDDLT 626

Query: 1052 DVYVLFYERVH 1062
              Y+LFY+  +
Sbjct: 627  TAYLLFYKETN 637

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 52/141 (36%), Gaps = 34/141 (24%)

Query: 693 QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGI 752
            QD  EFL  LL+ + D L                 A  L V N               I
Sbjct: 402 HQDAHEFLNFLLNEVSDYLGAHSEQI----------AQGLDVKN------------PGDI 439

Query: 753 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDC 812
           + ++ +FQG + N  +C  C  TT+    F   ++ + + S         T+ +  L D 
Sbjct: 440 NFVNRLFQGTLTNRTKCLTCDNTTYRNEPFLDFAIEVQQDS--------ETDIQTTLAD- 490

Query: 813 INMFTDDEVLSGENAWDCPRC 833
              F   E+L+G N + C  C
Sbjct: 491 ---FHQKELLNGANKFYCDVC 508

>TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {ON}
           Anc_3.270 YBR058C
          Length = 780

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 12/140 (8%)

Query: 575 LQPQPQRAYNIPTIEQSSNVYVSLSI-----TGLRNLGNTCYINSMIQCLFAAKI--FRT 627
           LQ +    ++   ++   N  V L+       GL NLGN+CY+NS+I+ L    I  +  
Sbjct: 299 LQVEQNMNWDFKMMDSQGNDLVKLNSNKDLGCGLINLGNSCYMNSVIKVLLNGGIPGWSL 358

Query: 628 LFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDL 687
             I +++   +  P  +      KL+ ++ +   + Y +G   + PT F K + +   + 
Sbjct: 359 DSIGSSFPMDVVYPSNNLLCQLIKLNIAMKIEPER-YPDG---IKPTSFKKCITRGNAEF 414

Query: 688 KIPDDQQDTQEFLMILLDRL 707
                QQD+ EF   L ++L
Sbjct: 415 S-SGKQQDSMEFFTFLTNQL 433

>KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} similar
            to uniprot|P43589 Saccharomyces cerevisiae YFR005C SAD1
            Conserved zinc-finger domain protein involved in pre-mRNA
            splicing required for assembly of U4 snRNA into the U4/U6
            particle
          Length = 477

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 19/129 (14%)

Query: 940  TVKTINFVTLPKILVIHLSRF---YYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVV 996
            ++KT   +  PK L++H +RF   +  +  +N T++ +   L         + Y+L   +
Sbjct: 361  SIKTYRILKHPKFLILHFNRFDKGFTSIKDRNKTLVEFSEKLEF-----SGVHYKLLVNI 415

Query: 997  NHTGTL---VSGHYTSLVNKDLEHSVDIGRSKWYYFDD-EVVKADNKHGSDKNLKISSSD 1052
             H   +   +S     L ++   H  D  R +WY FDD EV K + +        +   +
Sbjct: 416  THDCVIQMKISDTEDLLASRWKVHLADTLRDQWYEFDDIEVNKVEKEF-------LFLKE 468

Query: 1053 VYVLFYERV 1061
             Y+  ++RV
Sbjct: 469  CYIQIWQRV 477

>KNAG0G01670 Chr7 complement(366899..369592) [2694 bp, 897 aa] {ON}
           Anc_8.202 YER151C
          Length = 897

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 63/143 (44%), Gaps = 33/143 (23%)

Query: 587 TIEQSSNVYV-SLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSR 645
           +I+  +N+ V S+   G+ N  N C+++S++Q L   K F  +    + +N    P    
Sbjct: 430 SIDMRTNLPVKSIIPRGIVNTANICFMSSVLQVLLHCKPFVDILNVLSTRN----PNSKT 485

Query: 646 SAHSSKLSNSLNMLFN----------KMYLNGGCS-VVPTG----FLKVVNQLRPDL--- 687
            A S KL+++L  L++          K  +       VPTG    +  V + ++PD    
Sbjct: 486 GAMSCKLTDALTTLYSEFDRENFEEEKREIEAKTKPAVPTGGKIPYAAVSDAIKPDSFYM 545

Query: 688 ---KIP-------DDQQDTQEFL 700
              KIP         Q+D +EFL
Sbjct: 546 ILSKIPKFKDLQWGHQEDAEEFL 568

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 38/77 (49%), Gaps = 16/77 (20%)

Query: 990  YRLFGVVNHTGTLVS-GHYTSLVNKDLEHSVDIGRSKWYYFDD----EVVKADN-KHGSD 1043
            YRL GVV H G   S GHYT+    D+ H     + KWY  DD    E+ + D  K G +
Sbjct: 723  YRLTGVVYHHGLSPSGGHYTA----DVLHQT---QDKWYRIDDNNVTEIRQEDVFKRGDE 775

Query: 1044 KNLKISSSDVYVLFYER 1060
             +    S   Y+L Y+R
Sbjct: 776  AS---DSKTAYILIYQR 789

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 55/131 (41%), Gaps = 22/131 (16%)

Query: 602 GLRNLGNTCYINSMIQCLFAAKIF----RTLFISANYKNY-LQPP---------KGSRSA 647
           G+ N GN C+++S++Q L   + F      +      K++ L PP         K     
Sbjct: 350 GIMNKGNICFMSSVLQVLLFCEPFIEMLNVVHARTGVKSWTLLPPLLGSCLEFYKEFEKL 409

Query: 648 HSSKLSNSLNMLFNKMYLNGGCS-----VVPTGFLKVVNQLR--PDLKIPDDQQDTQEFL 700
           H+ K  N      N        S     + P  F K +++L    DL+    Q+D +EFL
Sbjct: 410 HADKDKNDKQSNGNGKSAKANRSSQPDAIDPEHFYKCISKLPMFKDLQW-GHQEDAEEFL 468

Query: 701 MILLDRLHDEL 711
              LD+LH+E 
Sbjct: 469 THFLDQLHEEF 479

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 106/290 (36%), Gaps = 75/290 (25%)

Query: 600 ITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSN----- 654
           I GL N GNTC++NS++Q L ++K     F+    K   +  +        K  +     
Sbjct: 127 IAGLLNDGNTCFMNSVLQSLASSKELMD-FLDTTIKQEQEQEQEQEQVGDEKKEDVDIGF 185

Query: 655 --SLNML---FNKMYLNGGCSVVPTGFLKVV-NQLRPDLKIPDDQQDTQEFLMILLDRLH 708
             SLN L    N  Y            LK + N    ++ +  DQ+D QEF   +L  L 
Sbjct: 186 TLSLNELLSQLNAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQNILSELE 245

Query: 709 DEL---------------------SNQ--QHVANDYPNLLLYNAD--------------- 730
             L                     SN+  + +  D P   +   +               
Sbjct: 246 KNLKSISSQNNKEEEEEKKEQEKNSNECVKILKKDLPKDAIIGQEQLGKVGTVYIPTEQI 305

Query: 731 ------ALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYV 784
                 AL  SN + K +    +I    +P+D I   ++   LQC   G     YS F  
Sbjct: 306 EPNTSTALPSSNPQEKLYTPFKLI----TPLDGISAERI-GCLQCGENG--GIRYSVFSG 358

Query: 785 LSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834
           LSL +P  ++ ++         +KL + +N +   E++ G    +C RC 
Sbjct: 359 LSLNLPNENIGMT---------LKLSNLLNEWIKPEIIDG---VECNRCA 396

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
            YPL072W
          Length = 495

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 16/78 (20%)

Query: 946  FVTLPKILVIHLSRFYYDLTK--KNSTVITYPLILNI--------------ILKNNETMK 989
             +  PK+L+IHLSR  Y+     +N   + +  IL +               + +N  ++
Sbjct: 326  LLQCPKVLLIHLSRSMYNGMAYTRNPCNVEFENILELEEEQMLQSSPGEKTFINSNSKIR 385

Query: 990  YRLFGVVNHTGTLVSGHY 1007
            Y L  +V HTG+   GHY
Sbjct: 386  YELKSLVKHTGSHYQGHY 403

>TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {ON}
            Anc_8.540 YPL072W
          Length = 524

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 950  PKILVIHLSRFYYD--LTKKNSTVITYPLILNI--------ILKNNETMKYRLFGVVNHT 999
            P  L++HLSR  Y+  ++ +NS  I Y   L +        I  +    KY L  +V HT
Sbjct: 357  PLALILHLSRSSYNGMISVRNSCNIAYDSKLELQSQSITDNICSDIVNNKYSLQAMVKHT 416

Query: 1000 GTLVSGHY 1007
            GT + GHY
Sbjct: 417  GTHMEGHY 424

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626
            G+ N+GNTCY+NS++Q  F+    R
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLR 738

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 107,940,342
Number of extensions: 4834027
Number of successful extensions: 16841
Number of sequences better than 10.0: 274
Number of HSP's gapped: 16692
Number of HSP's successfully gapped: 538
Length of query: 1064
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 944
Effective length of database: 39,721,479
Effective search space: 37497076176
Effective search space used: 37497076176
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)