Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_8.492.530ON44744720010.0
Suva_8.582.530ON45245216470.0
YHR004C (NEM1)2.530ON44644815900.0
Smik_8.532.530ON44644815640.0
NCAS0F009302.530ON42245310071e-133
NDAI0H014202.530ON4484679531e-125
KNAG0C058502.530ON4434689531e-125
KAFR0A018302.530ON4424569381e-123
SAKL0A09416g2.530ON3854479211e-121
TDEL0A030502.530ON3553808921e-117
Kwal_26.80012.530ON4134208911e-116
CAGL0K02959g2.530ON4643588911e-115
TPHA0G035002.530ON3923438731e-113
KLTH0D06776g2.530ON4094138671e-112
Kpol_348.82.530ON4224838591e-111
TBLA0I014602.530ON3933677821e-100
AGL070W2.530ON3433497621e-97
ZYRO0B01958g2.530ON3363397567e-97
Ecym_72572.530ON3523517571e-96
KLLA0E18613g2.530ON3743656276e-77
Suva_10.995.202ON3851692112e-17
YLR019W (PSR2)5.202ON3971692102e-17
Smik_12.535.202ON4141812093e-17
Skud_12.875.202ON3921692084e-17
Smik_12.825.202ON3921692051e-16
TPHA0E030705.202ON4941712061e-16
SAKL0G12870g5.202ON3991692032e-16
NDAI0D018605.202ON5141742052e-16
Kpol_2002.1005.202ON4771602042e-16
TBLA0C060905.202ON4841692032e-16
YLL010C (PSR1)5.202ON4271812005e-16
Skud_12.575.202ON4151691989e-16
KLTH0B03388g5.202ON4091691961e-15
NDAI0I021705.202ON3911711961e-15
CAGL0D05610g5.202ON4471611971e-15
NCAS0D027405.202ON3981581952e-15
KLLA0F15620g5.202ON4141691942e-15
Kwal_33.151405.202ON4101581933e-15
KAFR0J009905.202ON4831691934e-15
CAGL0D03234g5.202ON4101741925e-15
TDEL0E042705.202ON4531741926e-15
KNAG0M017405.202ON4811741926e-15
ZYRO0B10428g5.202ON4821691918e-15
Ecym_71045.202ON4921761918e-15
Kpol_478.165.202ON3501691871e-14
TBLA0H019905.202ON6881631892e-14
Suva_10.655.202ON4151691862e-14
AAL158W5.202ON4781741838e-14
TPHA0N006705.202ON4521591811e-13
NCAS0A068005.202ON4731741774e-13
YPL063W (TIM50)8.527ON4761091571e-10
TDEL0B031908.527ON4771091501e-09
Smik_16.1728.527ON4771091491e-09
Suva_16.2498.527ON4801091482e-09
Skud_16.2188.527ON4801091482e-09
ZYRO0F09130g8.527ON4891091454e-09
SAKL0H10296g8.527ON4781091454e-09
NDAI0E029108.527ON4411091445e-09
TBLA0A005408.527ON4851091445e-09
NCAS0C022108.527ON4911091436e-09
TPHA0I020008.527ON4781091428e-09
Kpol_457.58.527ON4891091428e-09
CAGL0H05159g8.527ON4851091392e-08
Kwal_27.119908.527ON4741091373e-08
KLTH0E12254g8.527ON4761091364e-08
KLLA0E23101g8.527ON4801091347e-08
Ecym_11778.527ON4901091269e-07
KAFR0E010208.527ON4481091186e-06
ADR045W8.527ON4761081161e-05
KNAG0A020608.527ON4501091124e-05
KAFR0B009107.336ON51252810.24
Kpol_2001.677.336ON48452770.58
NCAS0A140607.336ON51046770.65
NDAI0A019607.336ON53470770.67
TBLA0F023607.336ON58576770.67
TDEL0C021007.336ON47976770.70
TPHA0D045207.336ON50252751.0
CAGL0I03476g7.336ON50752751.2
Ecym_46467.336ON49063722.4
ACR197W7.336ON48452722.9
ZYRO0F11440g7.336ON52352722.9
Kpol_1038.173.19ON93094723.1
KNAG0C038207.336ON51352713.2
Smik_4.777.336ON50676713.3
Skud_4.967.336ON50776714.0
YDL160C (DHH1)7.336ON50676704.1
Suva_4.867.336ON50876704.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_8.49
         (447 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   775   0.0  
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   639   0.0  
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   617   0.0  
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   607   0.0  
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   392   e-133
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    371   e-125
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   371   e-125
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   365   e-123
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   359   e-121
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   348   e-117
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   347   e-116
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   347   e-115
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   340   e-113
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   338   e-112
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   335   e-111
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   305   e-100
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   298   1e-97
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   295   7e-97
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   296   1e-96
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   246   6e-77
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    86   2e-17
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    86   2e-17
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    85   3e-17
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    85   4e-17
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    84   1e-16
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    84   1e-16
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    83   2e-16
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     84   2e-16
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    83   2e-16
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    83   2e-16
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    82   5e-16
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    81   9e-16
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    80   1e-15
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     80   1e-15
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    80   1e-15
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    80   2e-15
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    79   2e-15
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    79   3e-15
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    79   4e-15
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    79   5e-15
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    79   6e-15
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    79   6e-15
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    78   8e-15
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    78   8e-15
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    77   1e-14
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    77   2e-14
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    76   2e-14
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    75   8e-14
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    74   1e-13
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    73   4e-13
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    65   1e-10
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    62   1e-09
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    62   1e-09
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    62   2e-09
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    62   2e-09
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    60   4e-09
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    60   4e-09
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    60   5e-09
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    60   5e-09
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     60   6e-09
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    59   8e-09
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    59   8e-09
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    58   2e-08
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    57   3e-08
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    57   4e-08
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    56   7e-08
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    53   9e-07
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    50   6e-06
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    49   1e-05
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    48   4e-05
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...    36   0.24 
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...    34   0.58 
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...    34   0.65 
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...    34   0.67 
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...    34   0.67 
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...    34   0.70 
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...    33   1.0  
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...    33   1.2  
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...    32   2.4  
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...    32   2.9  
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...    32   2.9  
Kpol_1038.17 s1038 (38305..41097) [2793 bp, 930 aa] {ON} (38305....    32   3.1  
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...    32   3.2  
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...    32   3.3  
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...    32   4.0  
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...    32   4.1  
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...    32   4.6  

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/447 (86%), Positives = 387/447 (86%)

Query: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNHQHNHS 60
           MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNHQHNHS
Sbjct: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNHQHNHS 60

Query: 61  TDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFT 120
           TDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFT
Sbjct: 61  TDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFT 120

Query: 121 FPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTIPETVDDDLN 180
           FPLSVIERRVKHTDKRHKEP                  EKAGSKNGNLNTIPETVDDDLN
Sbjct: 121 FPLSVIERRVKHTDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTIPETVDDDLN 180

Query: 181 ASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTVFGTKRMGRFLFPKKL 240
           ASDEIILQRDNVKGSLLKAQ               LTNHSNTNTVFGTKRMGRFLFPKKL
Sbjct: 181 ASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVFGTKRMGRFLFPKKL 240

Query: 241 IPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKRP 300
           IPKSILNTQKKKKLVIDLDETLI             QGHLVEVKFGISGIPTLYFIHKRP
Sbjct: 241 IPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIPTLYFIHKRP 300

Query: 301 YCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIK 360
           YCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIK
Sbjct: 301 YCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIK 360

Query: 361 DLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXXX 420
           DLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS            
Sbjct: 361 DLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLP 420

Query: 421 XXEAMRYSTDVRNILALKHGEKAFNIN 447
             EAMRYSTDVRNILALKHGEKAFNIN
Sbjct: 421 FLEAMRYSTDVRNILALKHGEKAFNIN 447

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/452 (73%), Positives = 347/452 (76%), Gaps = 5/452 (1%)

Query: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTEND-IIGGNHQHNH 59
           MNALKYFSNHLITT KPKKTINVE+TKSQD ++ASNET  TGA +TE D  +  NHQHN 
Sbjct: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60

Query: 60  STDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVF 119
           ST+     KQ+E+   SV  K KAL SIL+ KI SILW ILLFLPYYLIIKPLMSLWFVF
Sbjct: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120

Query: 120 TFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTIPETVDDDL 179
           TFPL+VIERRVKHTDKRHKE                   EK  +KN NLNTI E V+DDL
Sbjct: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180

Query: 180 NASDEIILQRDNVKGSLLKA----QXXXXXXXXXXXXXXXLTNHSNTNTVFGTKRMGRFL 235
           NASDEIILQRDNVKGSLL+A                    LTNHS  NTVFGTKRMGRFL
Sbjct: 181 NASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFL 240

Query: 236 FPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYF 295
           FPKKLIPKSILNTQKKKKLVIDLDETLI             QGHLVEVKFGISGI TLYF
Sbjct: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300

Query: 296 IHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDG 355
           IHKRPYCD FLTK S+WYDLIIFTASMKEYADPVIDWLE SF A+FSKRYYRSDCVLRDG
Sbjct: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360

Query: 356 VGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISXXXXXXX 415
           VGYIKDLSI+KSSEENGKGSS SSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS       
Sbjct: 361 VGYIKDLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 420

Query: 416 XXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 447
                  EAMRYSTDVRNILALKHGEKAFN+N
Sbjct: 421 LNLLPFLEAMRYSTDVRNILALKHGEKAFNMN 452

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/448 (72%), Positives = 350/448 (78%), Gaps = 3/448 (0%)

Query: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGG-NHQHNH 59
           MNALKYFSNHLITTKK KK INVE+TK+QDL+  S E S     H+END +   + Q++H
Sbjct: 1   MNALKYFSNHLITTKKQKK-INVEVTKNQDLLGPSKEVSNKYTSHSENDCVSEVDQQYDH 59

Query: 60  STDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVF 119
           S+ +L+ S QN++   SV  KPKALRSIL  KIASILW +LLFLPYYLIIKPLMSLWFVF
Sbjct: 60  SSSHLKESDQNQERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSLWFVF 119

Query: 120 TFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTIPETVDDDL 179
           TFPLSVIERRVKHTDKR++                    EK   KN NLNTIPE V+DDL
Sbjct: 120 TFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAVEDDL 179

Query: 180 NASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTVFGTKRMGRFLFPKK 239
           NASDEIILQRDNVKGSLL+AQ               L+NHS++NTVFGTKRMGRFLFPKK
Sbjct: 180 NASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFLFPKK 239

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           LIPKS+LNTQKKKKLVIDLDETLI             QGHLVEVKFG+SGI TLYFIHKR
Sbjct: 240 LIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKR 299

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           PYCD FLTKVS+WYDLIIFTASMKEYADPVIDWLESSFP++FSKRYYRSDCVLRDGVGYI
Sbjct: 300 PYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYI 359

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXX 419
           KDLSI+K SEENGKGSS SSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS           
Sbjct: 360 KDLSIVKDSEENGKGSS-SSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLL 418

Query: 420 XXXEAMRYSTDVRNILALKHGEKAFNIN 447
              EAMRYSTDVRNILALKHGEKAFNIN
Sbjct: 419 PFLEAMRYSTDVRNILALKHGEKAFNIN 446

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/448 (71%), Positives = 351/448 (78%), Gaps = 3/448 (0%)

Query: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDI-IGGNHQHNH 59
           MNALKYFSNHLITTKKP+K  +VE+T +QD+++ SNE S T A H EN+  I  N   +H
Sbjct: 1   MNALKYFSNHLITTKKPRKN-HVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDH 59

Query: 60  STDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVF 119
           S+D+L+   QNE+    +  KPK+LRSIL+ KI SILW +LLFLPYYL+IKPLMSLW+VF
Sbjct: 60  SSDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSILWALLLFLPYYLVIKPLMSLWYVF 119

Query: 120 TFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTIPETVDDDL 179
           TFPLSVIERRVKHTDKR+KE                   EK  SKN NLNTI ETV+DDL
Sbjct: 120 TFPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISETVEDDL 179

Query: 180 NASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTVFGTKRMGRFLFPKK 239
           NASDEIILQRDNVKGSLL+AQ               LTNHS+TNTVFGTKRMGRFLFPKK
Sbjct: 180 NASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKK 239

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           LIPKS+LNTQKKKKLVIDLDETLI             QGHLVEVKFGISGI TLYFIHKR
Sbjct: 240 LIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRTLYFIHKR 299

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           PYCD FLTKVS+WY+LIIFTASMKEYADPVIDWLESSFP++FS+RYYRSDCVLRDGVGYI
Sbjct: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLRDGVGYI 359

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXX 419
           KDLSIIK+SEEN KGSS SSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS           
Sbjct: 360 KDLSIIKNSEENEKGSS-SSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLL 418

Query: 420 XXXEAMRYSTDVRNILALKHGEKAFNIN 447
              EAMRYSTDVRNILALKHGEKAFNIN
Sbjct: 419 PFLEAMRYSTDVRNILALKHGEKAFNIN 446

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  392 bits (1007), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 219/453 (48%), Positives = 282/453 (62%), Gaps = 43/453 (9%)

Query: 1   MNALKYFSNHLITT-----KKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNH 55
           MNAL Y S+HL +      KK    + VE    Q+  N +NE  K+ ++ T N+      
Sbjct: 1   MNALSYISSHLASPIHYLKKKEPTIVPVE----QEPTN-NNEKIKSHSKATTNN------ 49

Query: 56  QHNHSTDNLEGSKQNE-DNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMS 114
             ++ST   + S  N  + + +VY   +ALR       + + WT +LF P +LI+KPL+ 
Sbjct: 50  DEDYSTPMADSSSSNTIEKSIAVYGSDRALR------FSVLFWTFVLFFPKFLIVKPLLF 103

Query: 115 LWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTIPET 174
           LWF+ TFPL ++ER +KH                          E+  + +  L  I ET
Sbjct: 104 LWFIVTFPLYLLERGMKH----------RTLLKNKLDENSQKNAERVPTTSPELTVIDET 153

Query: 175 VDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTVFGTKRMGRF 234
            +DDL   DEI LQRD +KGSLLKA                + + S+ NT F +KRMG+F
Sbjct: 154 TEDDLAGGDEIYLQRDTIKGSLLKA-----TSAKQLSSSKTVKSISSNNTSFSSKRMGKF 208

Query: 235 LFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLY 294
           LFPKKLIP+SI+ T ++KKLV+DLDETLI             QGH+VEVKF +SG+ TLY
Sbjct: 209 LFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLY 268

Query: 295 FIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRD 354
           ++HKRPYCDFFL+KVS+WYDLIIFTASMKEYADPVIDWLE S P  FS+R YR+DC+LRD
Sbjct: 269 YVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRD 328

Query: 355 GVGYIKDLSIIKSSEENGK---GSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISXXX 411
           GVGYIKDLS+I  SE +G     + P SL ++IIIDNSP+SYAMNV+NAIQVEGWIS   
Sbjct: 329 GVGYIKDLSVI--SEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPT 386

Query: 412 XXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 444
                      EA+R++TDVRN+LALK+GEKAF
Sbjct: 387 DNALLNLLPLLEALRFTTDVRNVLALKNGEKAF 419

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  371 bits (953), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/467 (46%), Positives = 273/467 (58%), Gaps = 40/467 (8%)

Query: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDI---------I 51
           MNAL Y S+ L+        + ++L K +D  +A N   K  A     +I         I
Sbjct: 1   MNALSYVSDSLV--------LPLQLFKKKDKKDARNVIEKKVAAGAATEINLEQPYVDRI 52

Query: 52  G---GNHQHNHSTDNLEGSKQNEDNNQSVYIKPKALRSIL--------RRKIASILWTIL 100
           G   G  +   S        +  DNN   +I  +   S L        +  + SILW+ L
Sbjct: 53  GKQVGTKKAEESLKKPTPGLEFTDNN---FIVEEEGHSSLNVTDDRKTKNNVTSILWSFL 109

Query: 101 LFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEK 160
           LF P  LIIKP++ LW++ TFPLS+IER  K+  +   +                    +
Sbjct: 110 LFFPKILIIKPILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPEKDETLVHNNSFLPE 169

Query: 161 AGSKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHS 220
             SK   L+ I E  +DDL + D I LQRDNVKGSLLKA                +    
Sbjct: 170 EPSK---LDAINELTEDDLVSGDGIYLQRDNVKGSLLKASSVRQPSLSRS-----MKTMV 221

Query: 221 NTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHL 280
           + NT F +KRMG+FLFPKKLIPKSI  T+++KKLV+DLDETLI             QGH+
Sbjct: 222 SNNTSFSSKRMGKFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHI 281

Query: 281 VEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPAN 340
           VEVKF  SG+  LY++HKRPYCDFFL+KV +WYDLIIFTASMKEYADPVIDWLE+SF   
Sbjct: 282 VEVKFSSSGVSMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGT 341

Query: 341 FSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNA 400
           F++RYYR+DC+ RDGVGYIKDL+IIK  + N      S+L +VII+DNSP+SYAMN DNA
Sbjct: 342 FTERYYRTDCIRRDGVGYIKDLTIIK-DDSNVSVPQTSTLSEVIILDNSPISYAMNADNA 400

Query: 401 IQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 447
           IQVEGWIS              EA+RY+TDVR+ILALK+GE+AF  N
Sbjct: 401 IQVEGWISDPTDTALLNLLPLLEALRYTTDVRSILALKNGERAFYAN 447

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  371 bits (953), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 218/468 (46%), Positives = 282/468 (60%), Gaps = 46/468 (9%)

Query: 1   MNALKYFSNHLITTKKPK-KTINVELTKSQDLVNASNETSKTGARHTENDIIGGNHQHNH 59
           MN + Y + HLI   +P+ K+++ E+   +  V+        G   TEND+  G  +   
Sbjct: 1   MNTISYITQHLIYPLRPRAKSLHNEVKSGEGKVD-------DGVGVTENDVADGKLKTTA 53

Query: 60  STDNLEGS--------KQNEDNNQSVYIKPKAL--------RSILRRKIASILWTILLFL 103
           + +  E S        +Q  D  ++   KP  +         +IL +K+ ++L  ++ FL
Sbjct: 54  NVEKQENSTLKEELLDRQGSDAEKAS--KPIIVINDGDILNENILHQKVWNVLVFVIFFL 111

Query: 104 PYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGS 163
           P YLI KPL+ LWF+ T PL+++ER +K  ++                       E   S
Sbjct: 112 PTYLIYKPLLLLWFLVTLPLALVERGIKLRNR--------------PKMKTEKVSELVLS 157

Query: 164 KNGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSN-- 221
               L +I E V++DL A DE  LQRD VKGSLLKA                   H N  
Sbjct: 158 DPSKLGSINEEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNET 217

Query: 222 --TNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGH 279
              +TVFGTK+MGRFLFPKKLIPKSILN +KKK LV+DLDETLI             QGH
Sbjct: 218 HPNSTVFGTKKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGH 277

Query: 280 LVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPA 339
           +VEVKF ISG+ TLY++ KRPYCD FLTKVS+WYD++IFTASMKEYADPVIDWLESSF  
Sbjct: 278 IVEVKFSISGVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAG 337

Query: 340 NFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDN 399
            FS+R YR+DC+LRDGVGYIKDL ++  +  +  G+SP  L+DVII+DNSPVSYA+NVDN
Sbjct: 338 KFSRRLYRNDCILRDGVGYIKDLKMV--TRGSNLGTSPDRLEDVIIVDNSPVSYALNVDN 395

Query: 400 AIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 447
           AIQVEGWI+              EA+  +TDVRNIL+LK+GEKAFNI+
Sbjct: 396 AIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFNID 443

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  365 bits (938), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/456 (44%), Positives = 271/456 (59%), Gaps = 29/456 (6%)

Query: 1   MNALKYFSNH-------LITTKKPKKTINVE-LTKSQDLVNASNETSKTGARHTENDIIG 52
           MNAL Y +NH       L    K K  I  E +   +D  + SN+   T  R   +   G
Sbjct: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60

Query: 53  GNHQHNHSTDNLEGSKQNEDNNQSVYIKPKALRSILRR-KIASILWTILLFLPYYLIIKP 111
            +   +    N+EG+   +   Q +  K   + S+  +  + S+L  I+LF+P YL + P
Sbjct: 61  LSSVKDAHNQNVEGAIHIK---QQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNP 117

Query: 112 LMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTI 171
           L+ +WF+ T PL+++ER +K  D++ K                        S+   L +I
Sbjct: 118 LIYVWFILTLPLTLVERGIKLRDRKKKAELRGNF--------------GESSELSPLRSI 163

Query: 172 PETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTVFGTKRM 231
            E  ++DL+ SDE  LQRD +KGSLL+A                  + +    +FGTK+M
Sbjct: 164 SEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKM 223

Query: 232 GRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIP 291
           GRFLFPKKLIP+SIL  ++KK LV+DLDETLI             QGHLVEVKF I+GI 
Sbjct: 224 GRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGIS 283

Query: 292 TLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCV 351
           TLY++HKRP+CD FL+KVS+WY+++IFTASMKEYADPVIDWLE SF  NF+KR YR +C+
Sbjct: 284 TLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCL 343

Query: 352 LRDGVGYIKDLSII---KSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           LRDGVGYIKDLS++     +++N        L +VIIIDNSPVSYA+NVDNAIQVEGWIS
Sbjct: 344 LRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403

Query: 409 XXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 444
                         EA+RY+TDVRN+LALK+GEK F
Sbjct: 404 DPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMF 439

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  359 bits (921), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/447 (45%), Positives = 261/447 (58%), Gaps = 63/447 (14%)

Query: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNHQHNHS 60
           MNA+ Y +NH+     PK      + K Q    A    SK+     E+D           
Sbjct: 1   MNAISYITNHV---TPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDD----------- 46

Query: 61  TDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFT 120
                     ED NQ+     KA +        S+LW+I+LFLP + IIKP++  W++ T
Sbjct: 47  ----------EDKNQT----KKATK-------LSLLWSIILFLPNFFIIKPVLFFWYIIT 85

Query: 121 FPLSVIERR-VKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTIPETVDDDL 179
           FPL++IE       D+R+ E                        K  ++N I E  ++DL
Sbjct: 86  FPLNLIEHSPADDEDERNGEEGNSTGDE---------------EKTPSINIIVEEDEEDL 130

Query: 180 NASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTVFGTKRMGRFLFPKK 239
            A DEIILQ D VKGSL                   + + S T T  G++RMGRFLFPKK
Sbjct: 131 -AGDEIILQTDAVKGSLSTISESQQVKTIKASTRSSIRSGS-TGTALGSRRMGRFLFPKK 188

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           LIP+S+LN +KKK LV+DLDETLI             QGH+VEVKF +SGI +LYF+HKR
Sbjct: 189 LIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGISSLYFVHKR 248

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           PYCD FL+KV++WY L++FTASMKEYADPVIDWLESSF  +FS+R YR DC+LRDGVGYI
Sbjct: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXX 419
           KDLS+I          S  SL+++II+DNSP+SYAMNVDNAIQVEGWIS           
Sbjct: 309 KDLSLI----------SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLL 358

Query: 420 XXXEAMRYSTDVRNILALKHGEKAFNI 446
              EA+R++TD+RN+L+LK GE+AFNI
Sbjct: 359 PLLEALRFTTDIRNVLSLKSGEQAFNI 385

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  348 bits (892), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 178/380 (46%), Positives = 237/380 (62%), Gaps = 45/380 (11%)

Query: 66  GSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSV 125
           G  ++ ++  +V  + K +R   R K  S  W ++LF P +LIIKP   +W++ + PL +
Sbjct: 18  GKTEDVEDKVAVQKREKIVRR--RSKFTSYAWAVILFFPQWLIIKPTQLIWWIISLPLLL 75

Query: 126 IERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTIPETVDDDLNASDEI 185
           IE  +K   +R                      +      G L +I E  +DDL   DEI
Sbjct: 76  IEYGLKSRLQR----------------------KSTKRSTGTLQSISELEEDDLAGGDEI 113

Query: 186 ILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTVFGTKRMGRFLFPKKLIPKSI 245
            LQRD VKGSL  A+                +   ++  + GTKRMGRFLFPKKLIP+S+
Sbjct: 114 FLQRDAVKGSLAPAKYRRSR-----------SGSRSSTVMLGTKRMGRFLFPKKLIPRSV 162

Query: 246 LNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKRPYCDFF 305
           L+ +K+K+LV+DLDETLI             QGH+VE++F ISG+ TLY++HKRP+CD F
Sbjct: 163 LHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLF 222

Query: 306 LTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSII 365
           L+KVS+WYDL++FTASM+EYADPVIDWLE SF   FSKR YR++C+LRDGVGYIKDLSI+
Sbjct: 223 LSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIV 282

Query: 366 KSSEENGKGSSPS-SLDDVIIIDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEA 424
                      P+ +L +VI++DNSP+SYAMNVDNAIQVEGWIS              EA
Sbjct: 283 ---------CGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEA 333

Query: 425 MRYSTDVRNILALKHGEKAF 444
           +RY+TDVR+ILALK+ E+AF
Sbjct: 334 LRYTTDVRDILALKNSEQAF 353

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  347 bits (891), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/420 (47%), Positives = 243/420 (57%), Gaps = 36/420 (8%)

Query: 46  TENDIIGGNHQHNHSTDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASI----LWTILL 101
           T N +       + S +N+EGS    D N S   K   L+    RK   I    LW+IL+
Sbjct: 8   TNNALTPKPEGPSSSPENIEGSA---DVNVSGNGKNPQLKVKKTRKSRGIRWAFLWSILV 64

Query: 102 FLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKA 161
           FLP  L++KP++ +WFV TFPLS+IER          E                   +  
Sbjct: 65  FLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSV 124

Query: 162 GSKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLL---------------KAQXXXXXX 206
           GSK   +NTI E  DDDL   DEI LQ D VKGSL                + Q      
Sbjct: 125 GSKP-RINTIQEE-DDDLGG-DEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGSR 181

Query: 207 XXXXXXXXXLTNHSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXX 266
                        S+  T  G++RMGRFLFPKKLIP+S+LN +K + LV+DLDETLI   
Sbjct: 182 QSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHSM 241

Query: 267 XXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYA 326
                     QGH+VEVKF ISGI TLY +HKRPYCD FLT ++ WY+L++FTASMKEYA
Sbjct: 242 SRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYA 301

Query: 327 DPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSS-LDDVII 385
           DPVIDWLESSFP  FS+R YR DC+LRDGVGYIKDLS +          +P++ L D+ I
Sbjct: 302 DPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAV----------APNTLLSDIFI 351

Query: 386 IDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFN 445
           IDNSPVSYAM+VDNAIQVEGWIS              EA+R++TDVRNILALK GE AF+
Sbjct: 352 IDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAFS 411

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  347 bits (891), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 229/358 (63%), Gaps = 22/358 (6%)

Query: 95  ILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIE----RRVKHTDKRHKEPXXXXXXXXXX 150
           ++W+I+ F P Y++IKP + +WF+ TFPLS+IE    RR K T+  H             
Sbjct: 124 VVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEH------------- 170

Query: 151 XXXXXXXXEKAGSKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXX 210
                    K  S +  LN I E ++DDL + + + LQ+D +KGSLL             
Sbjct: 171 -LSQSPATNKDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQK 229

Query: 211 XXXXXLTNH-SNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXX 269
                 T+  S+T+ + GTK MGRF FPKKLIP+SIL ++KKK LVIDLDETLI      
Sbjct: 230 DRGKKTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRG 289

Query: 270 XXXXXXXQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPV 329
                  Q H++EV+F ISG+ TLY++HKRPYCD FL+KV +WY+LIIFTASMKEYADPV
Sbjct: 290 TTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPV 349

Query: 330 IDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNS 389
           IDWLESSF  +F++R YR+ C+ RDGVGYIKDL  IK        + P  L DV+IIDNS
Sbjct: 350 IDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN-ATIP--LTDVVIIDNS 406

Query: 390 PVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 447
           PVSYAM+VDNAIQVEGWIS              EA+RY+TDVRN+LALK+ EKAF ++
Sbjct: 407 PVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAFQLS 464

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  340 bits (873), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 223/343 (65%), Gaps = 6/343 (1%)

Query: 110 KPLMSLWFVFTFPLSVIERRVKHTDK-RHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNL 168
           KPL+  W++ TFPL++ E+   +  + R  +                    K   +   L
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 169 NTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTV-FG 227
             +   ++DD+    E+ILQRD VKGSLL A                    S +++V FG
Sbjct: 111 QNLDSVLEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFG 169

Query: 228 TKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           TK+MGRFLFPKKLIP+SIL++ +KKKLV+DLDETLI             Q HLVEVKF I
Sbjct: 170 TKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQI 229

Query: 288 SGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYR 347
           SGI TLY++HKRPYCD FL+ VS+WYDLIIFTASMKEYADPVIDWLESSF  NFSKRYYR
Sbjct: 230 SGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYR 289

Query: 348 SDCVLRDGVGYIKDLSIIKSSEE---NGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVE 404
           + C+LRDGVGYIKDLSII  + +   N    + S L ++I+IDNSPVSYAMNVDNAIQVE
Sbjct: 290 NHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVE 349

Query: 405 GWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 447
           GWIS              E++RY+TDVRNIL+LK+GE+AF+IN
Sbjct: 350 GWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  338 bits (867), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/413 (45%), Positives = 244/413 (59%), Gaps = 43/413 (10%)

Query: 56  QHNHSTDNLEGSKQNEDNNQSVYIKPKALRSILRRKIA--SILWTILLFLPYYLIIKPLM 113
           +H  ST      + +E  N  + + PK  +   +RK A  ++LW++L FLP  +++KP++
Sbjct: 15  KHEESTATPHRVEDSEKANARIDVAPKEAQ---KRKRARWTLLWSMLAFLPNLIVVKPVL 71

Query: 114 SLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGN-LNTIP 172
            +WFV TFPLS+IER          E                        KN + ++TI 
Sbjct: 72  FVWFVITFPLSLIER------ASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRISTIT 125

Query: 173 ETVDDDLNASDEIILQRDNVKGSLL-------KAQXXXXXXXXXXXXXXXLTNHSN---- 221
           E  +DDL A +E+ILQ D VKGSL        + Q                T+  +    
Sbjct: 126 EE-EDDL-AGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQQQPKTSRQSLKTS 183

Query: 222 ---------TNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXX 272
                      T  G++RMGRFLFPKKLIP+S+LN +K++ LV+DLDETLI         
Sbjct: 184 SVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTSS 243

Query: 273 XXXXQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDW 332
               QGH+VEVKF  SGI TLY +HKRPYCD FLTK+++WY+L++FTASMKEYADPVIDW
Sbjct: 244 SNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDW 303

Query: 333 LESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVS 392
           LESSFP  FS+R YR DC+LRDGVGYIKDLS++  +         +SL D+ IIDNSPVS
Sbjct: 304 LESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPN---------ASLSDIFIIDNSPVS 354

Query: 393 YAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFN 445
           YAM+VDNAIQVEGWIS              EA+R++TD+RN+LALK GE AF 
Sbjct: 355 YAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAFT 407

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  335 bits (859), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/483 (42%), Positives = 274/483 (56%), Gaps = 98/483 (20%)

Query: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNHQHNHS 60
           MNAL Y S++LIT  + ++  +   ++S+D+   +N+ S T    ++  II         
Sbjct: 1   MNALSYISSNLITPIEEEELPSG--SQSEDVQTYTNDVSDTCVS-SQTQIIS------KV 51

Query: 61  TDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFT 120
            D L     NEDN +S  +                   +LLF P YL++KP+  LWF+ T
Sbjct: 52  EDVL-----NEDNQRSTLV------------------LVLLFFPKYLLVKPIFFLWFLIT 88

Query: 121 FPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNGNLNTIPETVDDDLN 180
           FP+++ E++ K   K                           SK+ NLN +   V++DL+
Sbjct: 89  FPITLFEQKNKKLPKSSANLDTM-------------------SKSKNLNIL---VEEDLS 126

Query: 181 ASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTV---FGTKRMGRFLFP 237
              EIILQRD + GSLLK++                + H+ +++      +K++GRFLFP
Sbjct: 127 GGGEIILQRDTLNGSLLKSRANQQHSHQ--------SRHAKSSSSSVGLISKKIGRFLFP 178

Query: 238 KKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIH 297
           KKLIP+SIL++ +KKKLV+DLDETLI             Q HLVEVKF ISGI TLY++H
Sbjct: 179 KKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVH 238

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRPYCD FL+KV RWYDLIIFTASMKEYADPVIDWLE+SF  +FSKR+YR+DC+LRDGVG
Sbjct: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298

Query: 358 YIKDLSIIKSSEENGKGSSPSS---------------------------------LDDVI 384
           YIKDLSI+ +   +   S+ S                                  L +VI
Sbjct: 299 YIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQNNLLSEVI 358

Query: 385 IIDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 444
           +IDNSPVSYAMNVDNAIQV+GWIS              E++R +TDVRNIL+LK+GE+AF
Sbjct: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAF 418

Query: 445 NIN 447
           N+N
Sbjct: 419 NVN 421

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  305 bits (782), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/367 (45%), Positives = 223/367 (60%), Gaps = 56/367 (15%)

Query: 105 YYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSK 164
           + ++IKPL+ LW++FTFPL +IE+   HT++++K+                   + A S 
Sbjct: 55  FAILIKPLIFLWYIFTFPLLLIEQ---HTNRKYKD------------TPPLIDPKIASSS 99

Query: 165 NGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTN------ 218
             +L        DDLN++DEIILQ D++KGSLL+ +                 +      
Sbjct: 100 ATDL--------DDLNSNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQ 151

Query: 219 --------HSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXX 270
                   +S T+   G+K MGRFLFPKKLIP SIL T K+KKL++DLDETLI       
Sbjct: 152 KKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNI 211

Query: 271 XXXXXXQGHLVEVKFGI-SGIPT-----------LYFIHKRPYCDFFLTKVSRWYDLIIF 318
                   HL+EVKF   +  PT           LY+++KRPYCD FL  VS WYDLIIF
Sbjct: 212 SSSTISNYHLIEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIF 271

Query: 319 TASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPS 378
           TASMKEYADPVIDWLE SF  NF KR YR+ C+LRDG+GYIKDLS++ +  +       S
Sbjct: 272 TASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQ-------S 324

Query: 379 SLDDVIIIDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALK 438
           +L+++I+IDNSP+S+AMNVDNAIQV+GWIS              E++R++TDVRNILALK
Sbjct: 325 TLNELILIDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALK 384

Query: 439 HGEKAFN 445
           +GE+AF+
Sbjct: 385 NGERAFH 391

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  298 bits (762), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 207/349 (59%), Gaps = 56/349 (16%)

Query: 96  LWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXX 155
           +W +L FLP +L++KP++ +WFV TFPLS+IE+           P               
Sbjct: 50  VWRVLFFLPKWLVVKPVVLVWFVLTFPLSLIEQTSSKEADGAPGP--------------- 94

Query: 156 XXXEKAGSKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXX 215
                               DDDL A + ++LQ D+VK                      
Sbjct: 95  -------EAAEEEQLAEAVEDDDL-AGESMVLQEDSVK---------------------- 124

Query: 216 LTNHSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXX 275
            +  S + + + + R+G+FLFPKKLIP+SIL T +KK LV+DLDETLI            
Sbjct: 125 SSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTSSVSN 184

Query: 276 XQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLES 335
            QGH+VEV F  SG+ TLY++HKRPYCD FL++VS+WYDL+IFTASMKEYADPVIDWLES
Sbjct: 185 SQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLES 244

Query: 336 SFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAM 395
                FS+R YRSDC+LRDGVGY+KDLSII             +L D+II+DNSP+SYAM
Sbjct: 245 GISVRFSQRRYRSDCLLRDGVGYVKDLSIIS-----------KNLQDIIIVDNSPISYAM 293

Query: 396 NVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 444
           NVDNAIQVEGWIS              E +R++TD RNIL+LK+GE+AF
Sbjct: 294 NVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  295 bits (756), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 165/339 (48%), Positives = 200/339 (58%), Gaps = 61/339 (17%)

Query: 107 LIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXXXXXXXEKAGSKNG 166
           + +KP   +WFV T PL +IE  +K   K                        ++ S+ G
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKV-----------------------ESTSRKG 95

Query: 167 NLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXXXXLTNHSNTNTVF 226
            +    E VDDDL A DE+ LQRD VKG L                             F
Sbjct: 96  EIIRKKE-VDDDL-AEDEMFLQRDTVKGGL-------------------------RGKAF 128

Query: 227 GTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFG 286
           GTK+MGRFLFPKKL+P+SIL  ++KK+LV+DLDETLI             QGH+VEV+F 
Sbjct: 129 GTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFP 188

Query: 287 ISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYY 346
            S I TLY++HKRP+CD FL+KVS+WYDLIIFTASMKEYADPVIDWLESSF   F KR Y
Sbjct: 189 PSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLY 248

Query: 347 RSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           R +CV+R+GVGYIKDLS++              LD+V++IDNSP SYA N DNAIQVEGW
Sbjct: 249 RHNCVVREGVGYIKDLSVV-----------TEVLDEVVLIDNSPTSYARNEDNAIQVEGW 297

Query: 407 ISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFN 445
           IS              EA+RY TDVR+IL LK+GEKA  
Sbjct: 298 ISDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKALG 336

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  296 bits (757), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 209/351 (59%), Gaps = 53/351 (15%)

Query: 94  SILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXXXXXX 153
           S +W ++ FLP +LIIKP+  +WFV TFPL++IE    HT  +                 
Sbjct: 54  SWVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIE----HTSSKDGS----------VEEE 99

Query: 154 XXXXXEKAGSKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXXXXXX 213
                   GS  G      E ++DD    + ++L  D++K                    
Sbjct: 100 EVIPTNSQGSGGG------EVIEDDDLVGESMVLHEDSIK-------------------- 133

Query: 214 XXLTNHSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXX 273
              +  S + + + + R+G+FLFPKKLIP+SIL T +KK LV+DLDETLI          
Sbjct: 134 --SSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSS 191

Query: 274 XXXQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWL 333
              QGH+VEV F +SG+ +LY++HKRPYCD FL++V +WYDL+IFTASM+EYADPVIDWL
Sbjct: 192 NTSQGHMVEVTFSVSGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWL 251

Query: 334 ESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSY 393
           ES   A F+KR YRSDC+LRDG+GY+KDL++I             +L D II+DNSPVSY
Sbjct: 252 ESGISARFTKRKYRSDCILRDGIGYVKDLTMIS-----------KNLQDTIIVDNSPVSY 300

Query: 394 AMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 444
           AMNVDNAIQVEGWIS              E +R++TD RNIL+LK+GE AF
Sbjct: 301 AMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  246 bits (627), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 138/365 (37%), Positives = 193/365 (52%), Gaps = 64/365 (17%)

Query: 90  RKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPXXXXXXXXX 149
           R     +W IL+FLP YL+IKP++++W+V TFPL+++E   +                  
Sbjct: 64  RPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKG-------------- 109

Query: 150 XXXXXXXXXEKAGSKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQXXXXXXXXX 209
                     +  S+   L+     V++DL+ +DEII+ +D +K   +            
Sbjct: 110 ----LIQVGSETDSRTEKLSKY--VVEEDLSPTDEIIINQDKMKPRPI------------ 151

Query: 210 XXXXXXLTNHSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIXXXXXX 269
                             T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLI      
Sbjct: 152 ------------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNS 193

Query: 270 XXXXXXXQG---------HLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTA 320
                             HLVEV+F  + I TLY + KRPYCD FL + S+WYD+ IFTA
Sbjct: 194 RSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTA 253

Query: 321 SMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSL 380
           SMKEYADPVIDWL+ +    F  R+YR DC LR GVGY+KD+  + +  E  +      L
Sbjct: 254 SMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSR-----DL 308

Query: 381 DDVIIIDNSPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHG 440
             +IIIDNSP+SYAM++DNAIQV GWI+              +AMR+ TD R ILALK G
Sbjct: 309 SQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSG 368

Query: 441 EKAFN 445
             + +
Sbjct: 369 RASIS 373

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 89/169 (52%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P  +L  Q+KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 204 LLPPKLLPFQQKKCLILDLDETLVHSSFKYLHTADFVLP--VEIDDQVHNV----YVIKR 257

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL +VS+ Y++++FTAS+  YA+P++D L+ +       R +R  C   +G  YI
Sbjct: 258 PGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPN--RTIHHRLFREACYNYEG-NYI 314

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L + II+DNSP SY  +  +A+ +  W S
Sbjct: 315 KNLSQI------GR-----PLSETIILDNSPASYIFHPQHAVPISSWFS 352

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 88/169 (52%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P  +   Q+KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMHSADFVLP--VEIDDQVHNV----YVIKR 269

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL +VS+ Y++++FTAS+  YA+P++D L+ +       R +R  C   +G  YI
Sbjct: 270 PGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 326

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L + II+DNSP SY  +  +A+ +  W S
Sbjct: 327 KNLSQI------GR-----PLSETIILDNSPASYIFHPQHAVPISSWFS 364

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 93/181 (51%), Gaps = 22/181 (12%)

Query: 230 RMGRFLFP--KKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           + G++  P  K L+P    NT+ KK L++DLDETL+                 VE+   +
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQV 278

Query: 288 SGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYR 347
             +    ++ KRP  + FL +V + +++++FTAS+  Y DP++D L++        R +R
Sbjct: 279 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD--KVIHHRLFR 332

Query: 348 SDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWI 407
             C   +G  YIK+LS I      G+      L D+II+DNSP SY  +  +AI +  W 
Sbjct: 333 EACYNYEG-NYIKNLSQI------GR-----PLSDIIILDNSPASYIFHPQHAIPISSWF 380

Query: 408 S 408
           S
Sbjct: 381 S 381

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 88/169 (52%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P  +   Q+KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL +VS+ Y++++FTAS+  YA+P++D L+ +       R +R  C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L + II+DNSP SY  +  +A+ +  W S
Sbjct: 322 KNLSQI------GR-----PLSETIILDNSPASYIFHPQHAVPISSWFS 359

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 88/169 (52%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P  +   Q+KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYMHTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL++V + Y++++FTAS+  YA+P++D L+ +       R +R  C   +G  YI
Sbjct: 265 PGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L + II+DNSP SY  +  +A+ +  W S
Sbjct: 322 KNLSQI------GR-----PLSETIILDNSPASYIFHPQHAVPISSWFS 359

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 86/171 (50%), Gaps = 23/171 (13%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L PK I    +KK L++DLDETL+                   +   I       ++ KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVDSADFV------IPVTIDNQTHHVYVIKR 365

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPAN--FSKRYYRSDCVLRDGVG 357
           P  D FL +VS  Y++++FTAS+  Y DP+++ L+   PAN     R +R  C   +G  
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILD---PANTIIHHRLFRESCYTYEG-N 421

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           Y+K+LS +      G+      L+++II+DNSP SY  +  +AI +  W S
Sbjct: 422 YVKNLSQL------GR-----PLNEIIILDNSPASYIFHPQHAIPISSWFS 461

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 85/169 (50%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P      + KK LV+DLDETL+                 VE+   +  +    ++ KR
Sbjct: 218 LLPPKDPVFEGKKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDDQVHNV----YVIKR 271

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL +V + Y++++FTAS+  Y DP++D L+         R +R  C   DG  YI
Sbjct: 272 PGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPR--GAVHHRLFRDSCYNYDG-NYI 328

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L D+II+DNSP SY ++  +AI +  W S
Sbjct: 329 KNLSQI------GR-----PLSDLIILDNSPASYILHPQHAIPISSWFS 366

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 87/174 (50%), Gaps = 29/174 (16%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIPTLY 294
           L PK  +  + KK LV+DLDETL+               +L    F +       I  +Y
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFK----------YLPNADFNLPVNIDDQIHNVY 381

Query: 295 FIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRD 354
            I KRP  D FL KV + ++++IFTAS+  Y DP++D L+    +    R +R  C   +
Sbjct: 382 VI-KRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKS-IHHRLFREACYNYE 439

Query: 355 GVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           G  YIK+LS +      G+      L ++II+DNSP SY  +  +AI +  W S
Sbjct: 440 G-NYIKNLSQM------GR-----PLSEIIILDNSPASYIFHPQHAIPISSWFS 481

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 82/160 (51%), Gaps = 20/160 (12%)

Query: 249 QKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTK 308
           + KK LV+DLDETL+                   +   I       ++ KRP  D FL +
Sbjct: 305 KNKKCLVLDLDETLVHSSFKYIDTADFV------LPVTIDDQTHQVYVIKRPGVDEFLKR 358

Query: 309 VSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSS 368
           V + +++++FTAS+  Y DP++D L+SS   +   R +R  C + DG  Y+K+LS I   
Sbjct: 359 VGKIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NYVKNLSQI--- 412

Query: 369 EENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
              G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 413 ---GR-----PLSDIIILDNSPASYIFHPQHAIPISSWFS 444

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 87/169 (51%), Gaps = 18/169 (10%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P      + KK L++DLDETL+                ++ ++     I  +Y I KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINN----PDFILPIEIEDGQIHNVYVI-KR 355

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL +V +WY+++IFTAS+  YA+P++D L+       + R +R  C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNL-INHRLFRDACYNYEN-NFI 413

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 414 KNLSQI------GR-----PLHDIIILDNSPASYIFHPQHAIPISSWFS 451

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 92/181 (50%), Gaps = 22/181 (12%)

Query: 230 RMGRFLFP--KKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           + G++  P    L+P    +T+ KK L++DLDETL+                 VE+   +
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQV 291

Query: 288 SGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYR 347
             +    ++ KRP  + FL +V + +++++FTAS+  Y DP++D L++        R +R
Sbjct: 292 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFR 345

Query: 348 SDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWI 407
             C   +G  YIK+LS I      G+      L D+II+DNSP SY  +  +AI +  W 
Sbjct: 346 EACYNYEG-NYIKNLSQI------GR-----PLSDIIILDNSPASYIFHPQHAIPISSWF 393

Query: 408 S 408
           S
Sbjct: 394 S 394

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 88/169 (52%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P    +T+ KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  + FL +V + +++++FTAS+  Y DP++D L+++       R +R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTN--KVIHHRLFREACYNYEG-NYI 344

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 345 KNLSQI------GR-----PLSDIIILDNSPASYIFHPQHAIPISSWFS 382

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P        KK LV+DLDETL+                ++ V+   + +  +Y I KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADF----VIPVEID-NQVHNVYVI-KR 281

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL  V + Y++++FTAS+  Y DP++D L+ +       R +R  C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNH--CIHHRLFRDSCYNYDG-NYI 338

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 339 KNLSQI------GR-----PLSDLIILDNSPASYIFHPQHAIPISSWFS 376

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 88/171 (51%), Gaps = 20/171 (11%)

Query: 238 KKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIH 297
           + L+P        KK LV+DLDETL+                 V++   I  +    ++ 
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYLHTADFVLP--VDIDDQIHNV----YVI 261

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D FL +V++ Y++++FTAS+  Y DP++D L+SS   +   R +R  C   +G  
Sbjct: 262 KRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRLFREACYNYEG-N 318

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           Y+K+L+ I      G+      L +++I+DNSP SY  +  +AI +  W S
Sbjct: 319 YVKNLAQI------GR-----PLSEIVILDNSPASYMFHPQHAIPISSWFS 358

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 26/161 (16%)

Query: 251 KKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS---GIPTLYFIHKRPYCDFFLT 307
           KK LV+DLDETL+               H  +    +     I  +Y I KRP  D FL 
Sbjct: 277 KKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVI-KRPGVDEFLQ 327

Query: 308 KVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKS 367
           +V   Y++++FTAS+  Y DP++D L+ S   N   R +R  C   +G  YIK+LS I  
Sbjct: 328 RVGELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-NYIKNLSQI-- 382

Query: 368 SEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
               G+      L ++II+DNSP SY  +  +AI +  W S
Sbjct: 383 ----GR-----PLSEIIILDNSPPSYIFHPQHAIPISSWFS 414

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 82/158 (51%), Gaps = 20/158 (12%)

Query: 251 KKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVS 310
           KK LV+DLDETL+                 VE++  I  +    ++ KRP  D FL +V 
Sbjct: 228 KKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----YVIKRPGVDEFLKRVG 281

Query: 311 RWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEE 370
             Y++++FTAS+  Y DP+++ L+ S   +   R +R  C   +G  YIK+L+ I     
Sbjct: 282 ELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG-NYIKNLAQI----- 333

Query: 371 NGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
            G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 334 -GR-----PLSDIIILDNSPASYMFHPQHAIPISSWFS 365

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 87/169 (51%), Gaps = 21/169 (12%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+PK+ +  + KK LV+DLDETL+                 VE+   +  +    ++ KR
Sbjct: 234 LLPKADM-FKGKKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDNQVHNV----YVIKR 286

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL +++  Y++++FTAS+  Y DP++D L+         R +R  C   +G  YI
Sbjct: 287 PGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKD--KTIHHRLFRDSCYNYEG-NYI 343

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 344 KNLSQI------GR-----PLSDMIILDNSPASYIFHPQHAIPISSWFS 381

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 82/158 (51%), Gaps = 20/158 (12%)

Query: 251 KKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVS 310
           KK LV+DLDETL+                ++ V+   + I  +Y I KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADF----VIPVEID-NQIHNVYVI-KRPGVDEFLKLVG 293

Query: 311 RWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEE 370
           + Y++++FTAS+  Y DP++D L+ +       R +R  C   DG  YIK+LS I     
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG-NYIKNLSQI----- 345

Query: 371 NGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
            G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 346 -GR-----PLSDLIILDNSPASYIFHPQHAIPISSWFS 377

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 85/169 (50%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P    +  +KK LV+DLDETL+                 V++   I  +    ++ KR
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 355

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL +V   +++++FTAS+  Y DP++D L+     +   R +R  C   +G  YI
Sbjct: 356 PGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKG--KSIHHRLFREACYNYEG-NYI 412

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS +      G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 413 KNLSQL------GR-----PLSDIIILDNSPASYIFHPQHAIPISSWFS 450

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 85/174 (48%), Gaps = 30/174 (17%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIPTLY 294
           L+P      + KK LV+DLDETL+               +L    F +       +  +Y
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVNIDDQVHNVY 278

Query: 295 FIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRD 354
            I KRP  D FL +V   Y++++FTAS+  Y DP++D L+     +   R +R  C   +
Sbjct: 279 VI-KRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQH--KSIHHRLFREACYNYE 335

Query: 355 GVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           G  YIK+LS I      G+      L ++II+DNSP SY  +  +AI V  W S
Sbjct: 336 G-NYIKNLSQI------GR-----PLSEIIILDNSPASYIFHPQHAIPVSSWFS 377

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 83/174 (47%), Gaps = 30/174 (17%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIPTLY 294
           L+P        KK LV+DLDETL+               +L    F +       I  +Y
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVDIDDQIHNVY 321

Query: 295 FIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRD 354
            I KRP  D FL +V   Y++++FTAS+  Y DP++D L+         R +R  C   +
Sbjct: 322 VI-KRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKH--KTIHHRLFRESCYNYE 378

Query: 355 GVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           G  YIK+LS I      G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 379 G-NYIKNLSQI------GR-----PLSDIIILDNSPASYIFHPQHAIPISSWFS 420

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 85/174 (48%), Gaps = 30/174 (17%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIPTLY 294
           L+P        +K LV+DLDETL+               +L    F +       I  +Y
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVY 349

Query: 295 FIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRD 354
            I KRP  D FL +V + Y++++FTAS+  Y DP++D L+     +   R +R  C   +
Sbjct: 350 VI-KRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKD--KSIHHRLFREACYNYE 406

Query: 355 GVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           G  YIK+LS I      G+      L ++II+DNSP SY  +  +AI +  W S
Sbjct: 407 G-NYIKNLSQI------GR-----PLSNIIILDNSPASYIFHPQHAIPISSWFS 448

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 83/169 (49%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P    +   KK LV+DLDETL+             +G    +   I       ++ KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYL------KGADFVLPVDIDDQIHNVYVMKR 354

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL KV   ++++IFTAS+  Y DP++D L+     +   R +R  C   +G  YI
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKH--KSVHHRLFREACYNYEG-NYI 411

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L ++II+DNSP SY  +  +AI +  W S
Sbjct: 412 KNLSQI------GR-----PLSEIIILDNSPASYIFHPQHAIPISSWFS 449

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 87/176 (49%), Gaps = 30/176 (17%)

Query: 238 KKLIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIPT 292
           + L+P       ++K LV+DLDETL+               +L    F I     + +  
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFK----------YLHTADFVIPVEIDNQVHN 358

Query: 293 LYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVL 352
           +Y I KRP  D FL +V   Y++++FTAS+  Y DP++D L+     +   R +R  C  
Sbjct: 359 VYVI-KRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKHNVVHH--RLFRDSCYN 415

Query: 353 RDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
            +G  YIK+LS I      G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 416 YEG-NYIKNLSQI------GR-----PLSDLIILDNSPASYIFHPHHAIPISSWFS 459

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 89/169 (52%), Gaps = 19/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P    + Q +K LV+DLDETL+                 ++ +F       +Y I KR
Sbjct: 168 LLPPIQQSLQNRKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQFQ-----NVYVI-KR 221

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  D FL   S+ ++++IFTAS+++Y +P++D L+S+       R +R  C   +G  YI
Sbjct: 222 PGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDL-VHHRLFRDACYNYNG-NYI 279

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+L+      + G+      L D+II+DNSP SY  + ++AI +  W S
Sbjct: 280 KNLA------QLGR-----PLSDIIILDNSPTSYLFHPNHAIPISSWFS 317

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 81/163 (49%), Gaps = 30/163 (18%)

Query: 251 KKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIPTLYFIHKRPYCDFF 305
           KK L++DLDETL+               +L    F I       I  +Y I KRP  D F
Sbjct: 518 KKCLILDLDETLVHSSFK----------YLTSADFVIPVDIDEQIHNVYVI-KRPGVDQF 566

Query: 306 LTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSII 365
           L  VS+ +++++FTAS+  Y DP++D L+         R +R  C   +G  YIK+LS I
Sbjct: 567 LETVSKIFEVVVFTASVSRYGDPLLDVLDKH--RCIHHRLFREACYDYEG-NYIKNLSQI 623

Query: 366 KSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
                 G+      L ++II+DNSP SY  +  +AI +  W S
Sbjct: 624 ------GR-----PLSELIILDNSPASYIFHPQHAIPISSWFS 655

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 86/169 (50%), Gaps = 20/169 (11%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKR 299
           L+P    + + KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359
           P  + FL +V + +++++FTAS+  Y DP++D L++        R +R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFREACYNYEG-NYI 344

Query: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           K+LS I      G+      L ++II+DNSP SY  +  +AI +  W S
Sbjct: 345 KNLSQI------GR-----PLSEIIILDNSPASYIFHPQHAIPISSWFS 382

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 87/174 (50%), Gaps = 30/174 (17%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIPTLY 294
           L+P      + +K LV+DLDETL+               +L    F I     + +  +Y
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFK----------YLHTADFVIPVEIDNQVHNVY 346

Query: 295 FIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRD 354
            I KRP  D FL +V   +++++FTAS+  Y DP++D L+  + A    R +R  C   +
Sbjct: 347 VI-KRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD-QYKA-VHHRLFRDSCYNYE 403

Query: 355 GVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           G  YIK+LS I      G+      L D+II+DNSP SY  +  +A+ +  W S
Sbjct: 404 G-NYIKNLSQI------GR-----PLSDLIILDNSPASYIFHPQHAVPISSWFS 445

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 81/159 (50%), Gaps = 22/159 (13%)

Query: 251 KKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVS 310
           +K LV+DLDETL+                 V++   +  +    ++ KRP  D FL  V 
Sbjct: 282 RKCLVLDLDETLVHSSFKYLNIADFVLP--VDIDNQVQNV----YVSKRPGVDEFLKIVG 335

Query: 311 RWYDLIIFTASMKEYADPVIDWLESSFPANF-SKRYYRSDCVLRDGVGYIKDLSIIKSSE 369
             Y++I+FTAS+  Y +P++D L+   P  +   R +R  C + +G  Y+K+LS I    
Sbjct: 336 DLYEVIVFTASVSRYGNPLMDILD---PHKYIHHRLFRDSCYVYEG-NYVKNLSQI---- 387

Query: 370 ENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
             G+      L D+II+DNSP SY  +  +AI +  W S
Sbjct: 388 --GR-----PLGDIIILDNSPASYIFHPQHAIPISSWFS 419

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 84/174 (48%), Gaps = 29/174 (16%)

Query: 240 LIPKSILNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIPTLY 294
           L PK+      KK LV+DLDETL+               +L    F +       I  +Y
Sbjct: 291 LPPKTEKKLIGKKCLVLDLDETLVHSSFK----------YLQTADFVLPVNIDEQIHNVY 340

Query: 295 FIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRD 354
            I KRP  + FL +V   +++++FTAS+  Y DP++D L+         R +R  C   +
Sbjct: 341 VI-KRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQL-IHHRLFREACYNYE 398

Query: 355 GVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408
           G  YIK+LS +      G+      L ++II+DNSP SY  +  +AI +  W S
Sbjct: 399 G-NYIKNLSQM------GR-----PLSEIIILDNSPASYIFHPQHAIPISSWFS 440

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y+D + + L+    A  S   ++  CV +DGV 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L  VIIID  P SY +  +NAI +E W
Sbjct: 275 HIKDLSKLN-----------RDLSKVIIIDTDPNSYKLQPENAIPMEPW 312

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP CD+FL  +S++Y++++F+++   YA+ + + L+    A  S   ++  CV +DGV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 265

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKD+S +              L  V+ ID  P +Y +  +NAI ++ W
Sbjct: 266 HIKDISKLN-----------RDLGKVVTIDTDPNTYKLQPENAIPMDPW 303

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S+++++++F+++   Y+D + + L+    A  S   ++  CV +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L  VIIID  P SY +  +NAI ++ W
Sbjct: 275 HIKDLSKLN-----------RDLSKVIIIDTEPNSYKLQPENAIPMDPW 312

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S+++++++F+++   Y++ + + L+    A  S   ++  CV +DGV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 279

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L  VIIID  P SY +  +NAI +E W
Sbjct: 280 HIKDLSKLN-----------RDLSKVIIIDTDPNSYKLQPENAIPMEPW 317

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  ++FL  +S++Y++++F+++   Y++   + L+    A  S   ++  CV +DGV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLD-PIHAFVSYNLFKEHCVYKDGV- 277

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +K             L  VIIID  P SY +  +NAI ++ W
Sbjct: 278 HIKDLSKLK-----------RDLSKVIIIDTDPNSYKLQPENAIPMDPW 315

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 62/109 (56%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP CD+FL  +S++Y++++F+++   Y+D + + L+    A  S   ++  CV +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKD+S  K + + GK         V++ID  P  Y    +NAI  + W
Sbjct: 279 HIKDIS--KMNRDVGK---------VVMIDTDPNCYKSQPENAIPAKPW 316

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   YA+ V + ++    A  +   Y+  C+ +DGV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYKDGV- 273

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L   +IID  P SY +  +NAI V+ W
Sbjct: 274 HIKDLSKLN-----------RDLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y + + + L+    A  S   ++  CV +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYSLFKEHCVYKDGV- 293

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              ++ V+IID  P +Y +  +NAI +E W
Sbjct: 294 HIKDLSKLN-----------RDVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 62/109 (56%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y+D + + L+    A  S   ++  C+ +DGV 
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYKDGV- 278

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +   E+            V+IID  P SY +  +NAI ++ W
Sbjct: 279 HIKDLSKLNRDEKK-----------VLIIDVDPNSYKLQPENAIPMKPW 316

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y + + + L+    A  S   ++  CV +DGV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYNLFKEHCVYKDGV- 285

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              ++ V+IID  P +Y +  +NAI V+ W
Sbjct: 286 HIKDLSKLN-----------RDVNKVLIIDTEPNNYKLQPENAIPVKPW 323

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y++ + + L+    A  S   Y+  CV ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT- 274

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              LD V+IID  P +Y    +NAI V+ W
Sbjct: 275 HIKDLSKLN-----------RDLDKVLIIDCDPNNYKFQPENAIPVKPW 312

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 60/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y++ + + L+    A  S   Y+  CV ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLD-PIHAFISYNLYKEHCVYKEG-D 283

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L  VII+D  P SY +  +NAI ++ W
Sbjct: 284 HIKDLSKLN-----------RDLGKVIIVDTDPASYKLQPENAIPMQPW 321

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 60/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   YA+ + + ++    A  S   ++  CV +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV- 280

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L  V+IID    SY +  +NAI ++ W
Sbjct: 281 HIKDLSKLN-----------RDLKKVMIIDTDENSYKLQPENAIPMDPW 318

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 60/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y+D V + L+    A  +   ++  C+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L   +IID  P +Y +  +NAI ++ W
Sbjct: 270 HIKDLSKLN-----------RDLGKTVIIDCDPNAYKLQPENAIPMKPW 307

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y+D V + L+    A  +   ++  C+ +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 270

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L   II+D  P +Y +  +NAI +  W
Sbjct: 271 HIKDLSKLN-----------RDLGKTIIVDCDPNAYKLQPENAIPMRPW 308

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 60/109 (55%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   YA+ + + L+    A  +   ++  C+ +DGV 
Sbjct: 220 KRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYKDGV- 277

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L  V+IID    S+ +  +NAI +E W
Sbjct: 278 HIKDLSKLN-----------RDLGKVLIIDTDENSFKLQPENAIYLEPW 315

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 58/109 (53%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   +++ + + L+    A  +   ++  CV +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              L   IIID    ++ +  +NAI  E W
Sbjct: 285 HIKDLSHLN-----------RDLGKTIIIDTDANAFKLQPENAIHAEPW 322

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y++ + + L+    A  S   ++  CV + G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-K 248

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              ++ VIIID    +Y +  +NAI ++ W
Sbjct: 249 HIKDLSKLN-----------RDVNKVIIIDTDKNNYKLQPENAIPMKPW 286

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 13/108 (12%)

Query: 299 RPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGY 358
           RP  D+ L  +S +Y+ ++F ++   Y+  V++ L+    A  +   ++  CV +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLD-PIRAFITYNLFKDHCVYKDGI-H 274

Query: 359 IKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           IKDLS +              L   +IID  P S  + ++NAI  E W
Sbjct: 275 IKDLSHLN-----------RDLGKTLIIDTDPNSVKLQMENAILAEPW 311

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 58/109 (53%), Gaps = 13/109 (11%)

Query: 298 KRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVG 357
           KRP  D+FL  +S++Y++++F+++   Y++ + + L+    A  S   ++  CV +D V 
Sbjct: 211 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLD-PLHAFISYNLFKEHCVYKDHV- 268

Query: 358 YIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406
           +IKDLS +              +  V+I+D    SY +  +NA+ +  W
Sbjct: 269 HIKDLSKLN-----------RDVRKVVIMDTDANSYKLQPENALPMAPW 306

>KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {ON}
           Anc_7.336 YDL160C
          Length = 512

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 5/52 (9%)

Query: 87  ILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHK 138
           +L R   +I+  IL+FLP     K   SL F  TFPL+V E  VKH +K ++
Sbjct: 199 MLSRDFKTIIEQILIFLP-----KNHQSLLFSATFPLTVKEFMVKHLNKPYE 245

>Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON}
           (185153..186607) [1455 nt, 485 aa]
          Length = 484

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 87  ILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHK 138
           +L R   SI+  IL+FLP     K   SL F  TFPLSV E  V H  K ++
Sbjct: 188 MLSRDFKSIIEQILVFLP-----KNHQSLLFSATFPLSVKEFMVNHLHKPYE 234

>NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON}
           Anc_7.336
          Length = 510

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 87  ILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKH 132
           +L R   +I+  IL+FLP     K   SL F  TFPL+V E  VKH
Sbjct: 197 MLSRDFKTIIEQILIFLP-----KKHQSLLFSATFPLTVKEFMVKH 237

>NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {ON}
           Anc_7.336
          Length = 534

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 6/70 (8%)

Query: 63  NLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFP 122
           +L   K  + ++ S++I  +A + +L R   +I+  IL+FLP     K   SL F  TFP
Sbjct: 168 DLASRKVADLSDCSLFIMDEADK-MLSRDFKTIIEQILIFLP-----KKHQSLLFSATFP 221

Query: 123 LSVIERRVKH 132
           L+V E  VKH
Sbjct: 222 LTVKEFMVKH 231

>TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.336
           YDL160C
          Length = 585

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 63  NLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFP 122
           +L   K  + +  S++I  +A   +L R   +I+  IL+FLP     K   SL F  TFP
Sbjct: 168 DLASRKVADLSECSLFIMDEA-DKMLSRDFKTIIEQILIFLP-----KHHQSLLFSATFP 221

Query: 123 LSVIERRVKHTDKRHK 138
           L+V E  VKH  K ++
Sbjct: 222 LTVKEFMVKHLTKPYE 237

>TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {ON}
           Anc_7.336 YDL160C
          Length = 479

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 6/76 (7%)

Query: 63  NLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFP 122
           +L   K  + +  S++I  +A + +L R   +I+  IL+FLP     +   SL F  TFP
Sbjct: 162 DLASRKLADLSECSLFIMDEADK-MLSRDFKTIIEQILIFLP-----QSHQSLLFSATFP 215

Query: 123 LSVIERRVKHTDKRHK 138
           L+V E  VKH  K ++
Sbjct: 216 LTVKEFMVKHLHKPYE 231

>TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.336
           YDL160C
          Length = 502

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 87  ILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHK 138
           +L R   SI+  IL FLP     +   SL F  TFPL+V E  VKH  K ++
Sbjct: 186 MLSRDFKSIIEQILTFLP-----EQHQSLLFSATFPLTVKEFMVKHLHKPYE 232

>CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160c DHH1
          Length = 507

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 87  ILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHK 138
           +L R   +I+  +L FLP     K   SL F  TFPL+V E  VKH  K ++
Sbjct: 185 MLSRDFKTIIEQVLTFLP-----KAHQSLLFSATFPLTVKEFMVKHLHKPYE 231

>Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {ON}
           similar to Ashbya gossypii ACR197W
          Length = 490

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 6/63 (9%)

Query: 76  SVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDK 135
           S++I  +A + +L R   S++  IL FLP         SL F  TFPL+V E  VKH +K
Sbjct: 174 SLFIMDEADK-MLSRDFKSLIEQILSFLP-----SSHQSLLFSATFPLTVKEFMVKHLNK 227

Query: 136 RHK 138
            ++
Sbjct: 228 PYE 230

>ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL160C (DHH1)
          Length = 484

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 87  ILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHK 138
           +L R   S++  IL FLP     +   SL F  TFPL+V E  VKH +K ++
Sbjct: 183 MLSRDFKSLVEQILSFLP-----QNHQSLLFSATFPLTVKEFMVKHLNKPYE 229

>ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q75BS4 Ashbya gossypii ACR197W DHH1
           ATP-dependent RNA helicase DHH1 and similar to YDL160C
           uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 523

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 87  ILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHK 138
           +L R   +I+  IL+FLP         SL F  TFP++V E  VKH  K ++
Sbjct: 184 MLSRDFKTIIEQILIFLP-----PQHQSLLFSATFPITVKEFMVKHLHKPYE 230

>Kpol_1038.17 s1038 (38305..41097) [2793 bp, 930 aa] {ON}
           (38305..41097) [2793 nt, 931 aa]
          Length = 930

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 12/94 (12%)

Query: 56  QHNHSTDNL-EGSKQNEDNNQSVYIKPKALRSIL--RRKIASILWTI---LLFLPYYLII 109
           Q+N+S D + EG+ + + N   +  +       +  RR      WTI     ++ +Y+I+
Sbjct: 343 QNNNSIDAVTEGNNRQQSNGSGLDREASVTDGHINHRRYFGRGEWTIGRLAFYVLFYIIL 402

Query: 110 KPLMSL-----W-FVFTFPLSVIERRVKHTDKRH 137
           +P++ L     W FVFT P+S I  ++ +  +RH
Sbjct: 403 QPIVLLLSLITWLFVFTIPMSNILWKLSYHLRRH 436

>KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {ON}
           Anc_7.336 YDL160C
          Length = 513

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 87  ILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHK 138
           +L R   +I+  IL FLP     K   SL F  TFPL+V E   KH +K ++
Sbjct: 188 MLSRDFKTIIEQILAFLP-----KNHQSLLFSATFPLTVKEFMEKHLNKPYE 234

>Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}
           YDL160C (REAL)
          Length = 506

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 63  NLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFP 122
           +L   K  + ++ S++I  +A + +L R   +I+  IL FLP         SL F  TFP
Sbjct: 177 DLASRKVADLSDCSLFIMDEADK-MLSRDFKTIIEQILSFLP-----SSHQSLLFSATFP 230

Query: 123 LSVIERRVKHTDKRHK 138
           L+V E  VKH  K ++
Sbjct: 231 LTVKEFMVKHLHKPYE 246

>Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}
           YDL160C (REAL)
          Length = 507

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 63  NLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFP 122
           +L   K  + ++ S++I  +A + +L R   +I+  IL FLP         SL F  TFP
Sbjct: 177 DLASRKVADLSDCSLFIMDEADK-MLSRDFKTIIEQILSFLP-----TTHQSLLFSATFP 230

Query: 123 LSVIERRVKHTDKRHK 138
           L+V E  VKH  K ++
Sbjct: 231 LTVKEFMVKHLHKPYE 246

>YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}
           DHH1Cytoplasmic DExD/H-box helicase, stimulates mRNA
           decapping; coordinates distinct steps in mRNA function
           and decay, interacts with both the decapping and
           deadenylase complexes, may have a role in mRNA export
           and translation; C-terminus of Dhh1p interacts with
           Ngr1p and promotes POR1, but not EDC1 mRNA decay
          Length = 506

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 63  NLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFP 122
           +L   K  + ++ S++I  +A + +L R   +I+  IL FLP         SL F  TFP
Sbjct: 177 DLASRKVADLSDCSLFIMDEADK-MLSRDFKTIIEQILSFLP-----PTHQSLLFSATFP 230

Query: 123 LSVIERRVKHTDKRHK 138
           L+V E  VKH  K ++
Sbjct: 231 LTVKEFMVKHLHKPYE 246

>Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}
           YDL160C (REAL)
          Length = 508

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 63  NLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFP 122
           +L   K  + ++ S++I  +A   +L R   +I+  IL FLP         SL F  TFP
Sbjct: 177 DLASRKVADLSDCSLFIMDEA-DKMLSRDFKTIIEQILSFLP-----PTHQSLLFSATFP 230

Query: 123 LSVIERRVKHTDKRHK 138
           L+V E  VKH  K ++
Sbjct: 231 LTVKEFMVKHLHKPYE 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,033,208
Number of extensions: 1771454
Number of successful extensions: 8650
Number of sequences better than 10.0: 142
Number of HSP's gapped: 8758
Number of HSP's successfully gapped: 146
Length of query: 447
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 334
Effective length of database: 40,524,141
Effective search space: 13535063094
Effective search space used: 13535063094
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)