Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_8.1782.152ON63863831390.0
YHR117W (TOM71)2.152ON63964025860.0
Smik_8.1952.152ON63563825610.0
Suva_15.3142.152ON64464425440.0
Kpol_1048.212.152ON59753915730.0
CAGL0L12936g2.152ON60053815690.0
NCAS0B070102.152ON62554015710.0
SAKL0E10956g2.152ON60053915680.0
TDEL0B051402.152ON59953915610.0
Kwal_33.147672.152ON59453915460.0
KLTH0B05170g2.152ON59353915360.0
KNAG0H035302.152ON61454715000.0
Skud_14.2112.152ON61755614900.0
Smik_14.2072.152ON61755614790.0
KAFR0F007202.152ON60854014730.0
TBLA0C055302.152ON61053614720.0
Ecym_82042.152ON59753914650.0
YNL121C (TOM70)2.152ON61755614670.0
Suva_14.2192.152ON61755614660.0
TPHA0I015102.152ON60353914500.0
ABR131W2.152ON59453914110.0
KLLA0F24046g2.152ON60453814020.0
NCAS0G024802.152ON59653613890.0
NDAI0B043402.152ON66454813531e-179
CAGL0L04048g2.152ON58753913071e-173
NDAI0F028102.152ON60953612901e-170
Ecym_30256.21ON3181271605e-11
Kpol_505.413.481ON5131031502e-09
NDAI0B057903.481ON5231031502e-09
NCAS0G008105.617ON584901502e-09
SAKL0G07084g5.617ON585901493e-09
TBLA0E033005.617ON582901474e-09
ACR005W6.21ON3271201437e-09
Ecym_44133.481ON5101681458e-09
Kpol_1032.86.21ON3431051421e-08
KAFR0L004106.21ON3311011402e-08
SAKL0E01210g6.21ON3231011392e-08
NDAI0F009105.617ON583891412e-08
Smik_16.4537.546ON14173671423e-08
KLLA0D01155g6.21ON3351311383e-08
AEL224W5.617ON580901394e-08
KLTH0F14542g3.481ON513951385e-08
KAFR0B066103.481ON511971377e-08
Kwal_55.199355.617ON593901378e-08
KLLA0A07062g5.617ON581901369e-08
Suva_8.805.617ON586901332e-07
YOR027W (STI1)5.617ON589901332e-07
SAKL0F03102g3.481ON513951322e-07
KNAG0A079003.481ON512971313e-07
Smik_15.2055.617ON589901314e-07
Skud_15.1925.617ON589921314e-07
TPHA0J003406.21ON3381061285e-07
KNAG0B032005.617ON579901305e-07
TDEL0G044806.21ON3431011277e-07
NCAS0F034903.481ON512981288e-07
Suva_16.5217.546ON14243641291e-06
CAGL0D05060g3.481ON510951271e-06
Suva_7.4083.481ON5131031261e-06
Ecym_20906.328ON172801191e-06
Kpol_1037.266.21ON3421461251e-06
CAGL0H08195g5.617ON583901261e-06
TDEL0D055003.481ON5121031252e-06
AAR083C3.481ON5381581262e-06
YGR123C (PPT1)3.481ON5131031252e-06
TBLA0A072706.21ON373921232e-06
TPHA0D028805.617ON585891242e-06
KNAG0M011706.21ON3391011232e-06
Kwal_55.211753.481ON511951233e-06
TPHA0D032203.481ON513951224e-06
Smik_6.2153.481ON513951224e-06
KLLA0B10912g3.481ON512971225e-06
NCAS0H008306.21ON3381321205e-06
TBLA0C039503.481ON512951216e-06
SAKL0A01672g6.328ON128681119e-06
TPHA0D038606.328ON120731101e-05
Kpol_1018.695.617ON590901191e-05
TPHA0E007407.412ON7461501191e-05
CAGL0E02739g6.21ON343711161e-05
Ecym_55825.617ON584901181e-05
YPR189W (SKI3)7.546ON14323681182e-05
Kwal_56.224336.21ON322891152e-05
KNAG0I025206.328ON117891072e-05
Kpol_1018.1067.412ON7532061163e-05
ZYRO0B04224g3.481ON513951153e-05
ZYRO0A05676g5.617ON572961153e-05
KLTH0E02178g5.617ON593901144e-05
Skud_7.4323.481ON513951134e-05
NDAI0D008106.21ON3491011125e-05
KLLA0B09966g8.506ON370961125e-05
NDAI0J001307.546ON14033661145e-05
NDAI0I004406.328ON128671048e-05
TDEL0A048405.617ON576901128e-05
ZYRO0F08624g8.506ON3791291109e-05
YDR244W (PEX5)8.470ON612881119e-05
Smik_4.4918.470ON612891111e-04
TBLA0G010506.21ON350741091e-04
KAFR0C058905.617ON575901101e-04
Smik_2.2958.506ON385951082e-04
TBLA0I023106.328ON116621012e-04
KAFR0B002507.546ON1420641092e-04
ZYRO0C07788g6.21ON3341411072e-04
YBR155W (CNS1)8.506ON3851171063e-04
NDAI0E040407.412ON7831711073e-04
Suva_3.956.328ON11170983e-04
NCAS0A153007.546ON1398711073e-04
KAFR0J025706.328ON12144984e-04
Suva_2.4108.470ON611891064e-04
Skud_4.5068.470ON611891064e-04
KLTH0C11220g6.21ON327861044e-04
Suva_15.1826.21ON3461011045e-04
KLLA0C08910g6.328ON11544975e-04
TBLA0D004607.412ON8352631056e-04
KLTH0A00638g7.546ON14111121057e-04
Skud_2.2828.506ON385951038e-04
ZYRO0B03828g7.412ON7271821038e-04
Kwal_27.118908.506ON3341471028e-04
Kwal_27.107407.412ON6282451039e-04
Kpol_513.28.506ON374951020.001
NCAS0D026706.21ON3511391010.001
NDAI0I022406.21ON350911010.001
TBLA0H033808.506ON375951010.001
TDEL0C027207.412ON7001651020.001
Ecym_71427.412ON6752471020.001
TBLA0A016908.470ON6621251020.001
Skud_15.1686.21ON348101990.002
ZYRO0C16522g3.367ON974711010.002
TDEL0B013108.506ON380205990.002
YOR007C (SGT2)6.21ON346101990.002
Kpol_1028.516.328ON11761920.002
AAR054C6.328ON13362930.002
CAGL0K11209g8.470ON59096990.002
Suva_4.4058.506ON38581980.003
NCAS0A112003.367ON907116990.003
TDEL0A074306.328ON12444920.003
Suva_2.347.412ON763184980.003
TPHA0M002706.21ON37793970.003
TBLA0B049907.546ON141082990.004
NDAI0C052908.506ON37996960.004
KNAG0A039508.506ON38695960.004
Kpol_1050.1127.546ON136071980.004
Skud_16.4937.546ON142571980.005
Smik_15.1766.21ON345101960.005
YBL084C (CDC27)7.412ON758182960.006
YCR060W (TAH1)6.328ON11158890.006
TPHA0A052905.72ON66690960.006
NCAS0B024008.506ON38095950.007
CAGL0C01903g7.412ON769224950.007
CAGL0G10087g7.546ON141171950.008
KLTH0C06204g7.412ON627225950.008
AGL268C8.506ON379115940.009
CAGL0K09240g6.328ON14244890.009
KLLA0C15455g8.470ON56692940.009
CAGL0D01364g3.367ON114868950.009
CAGL0H07425g8.506ON38096930.010
NDAI0C033505.72ON64993940.010
TDEL0H002507.546ON139782940.011
NCAS0B025608.470ON57882930.013
TDEL0B016608.470ON54996930.015
KNAG0H006103.367ON97371930.015
Kpol_1031.648.470ON60788930.015
NCAS0E024907.412ON809145920.017
TPHA0M016303.367ON1043115920.020
KAFR0H008703.367ON88773920.022
KAFR0E029808.506ON38095900.022
Kwal_23.54087.546ON141098920.023
AFR453W8.470ON56999910.023
SAKL0F12936g7.412ON632134910.024
Smik_2.367.412ON751182910.025
NDAI0C051308.470ON59077910.025
KLTH0E10934g8.470ON56889910.025
Kpol_1050.825.72ON63991910.027
KNAG0B022407.412ON739175900.029
Kwal_56.247505.72ON61993900.029
CAGL0I02288g5.72ON639108900.030
Skud_3.1356.328ON11869840.030
Ecym_28207.546ON1398194900.034
TDEL0C050903.367ON75973900.035
ABR206W5.72ON61477890.036
SAKL0F16236g7.546ON1408361900.038
NCAS0A00490singletonON62072890.040
Ecym_50925.72ON62667890.043
KLTH0E11748g8.506ON37895880.043
Skud_2.247.412ON769244880.055
KNAG0A041208.470ON60282880.058
NDAI0J007107.458ON33554860.064
Suva_4.3613.367ON96371880.065
KAFR0L018707.412ON712189870.065
YBR112C (CYC8)3.367ON96671870.068
Smik_2.2543.367ON102071870.069
SAKL0H02244g5.72ON62893870.071
TDEL0G009605.72ON62293870.071
Kwal_27.117378.470ON57589860.082
NDAI0A051003.367ON1007125860.094
Skud_2.2403.367ON98471860.100
Kpol_1006.43.367ON73290860.11
Ecym_13968.470ON57378850.13
AGL294W7.412ON656206850.13
Smik_3.1596.328ON11567790.14
SAKL0H11946g8.470ON57389840.16
ZYRO0A02926g8.470ON577101840.17
TPHA0L014208.506ON374110830.18
Skud_8.2305.72ON62669830.20
KLLA0B09262g3.367ON941116830.20
Smik_8.2505.72ON62669830.23
Ecym_25598.506ON370126820.24
Suva_15.3665.72ON62669820.25
YHR166C (CDC23)5.72ON62696820.26
KAFR0D023405.689ON697195820.27
KLLA0A05258g5.72ON63265820.29
KLTH0H00704g5.72ON62193820.31
TDEL0E027505.352ON564174820.31
TPHA0E011105.352ON69372820.32
TBLA0B079705.72ON68765810.33
NCAS0D013905.72ON63194810.36
TPHA0L012108.470ON58878810.39
NDAI0G037103.5ON112199810.39
ZYRO0C11594g5.72ON62893810.41
Kwal_33.134281.88ON105282800.53
Kwal_23.56685.298ON1689151800.53
Suva_9.2027.134ON700164800.56
AEL281C7.546ON139082800.59
TDEL0B023305.689ON70235790.59
KAFR0C018505.352ON646177790.60
Kpol_172.23.367ON41877790.61
NDAI0C001602.665ON77886790.65
Kwal_23.36703.367ON80273790.65
KLLA0E20857g7.412ON71096790.74
KNAG0F040107.546ON141871780.84
ZYRO0D00836g7.546ON140178780.95
TBLA0F012303.367ON118970781.0
Ecym_34593.367ON1115116771.1
ZYRO0E01254g2.627ON65259771.2
TPHA0B044301.88ON1070139771.3
KLTH0F10428g3.367ON79590761.6
TPHA0G002407.546ON143070761.6
Kpol_1028.1017.469ON38752751.7
KNAG0C055005.352ON585122751.9
SAKL0C02816g1.88ON1118101751.9
TDEL0A002403.5ON1059145752.0
ZYRO0D00572g2.665ON78556752.1
Kpol_1057.142.665ON72448752.2
SAKL0B07986g3.367ON88073752.2
NCAS0D045006.328ON12171692.5
ABL100W3.265ON90583742.6
TBLA0H015203.367ON68959742.7
ACR168W2.665ON707153742.7
ADL344W3.367ON91090733.1
CAGL0L09823g2.665ON74364733.2
KLLA0B03520g7.546ON140169733.6
CAGL0J09570g8.470ON54954724.3
NOTE: 1 genes in the same pillar as Skud_8.178 were not hit in these BLAST results
LIST: ZYRO0G06512g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_8.178
         (638 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...  1213   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...  1000   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   991   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   984   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   610   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   608   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   609   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   608   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   605   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   600   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   596   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   582   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   578   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   574   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   572   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   571   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   568   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   569   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   569   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   563   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   548   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   544   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   539   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   525   e-179
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   508   e-173
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   501   e-170
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    66   5e-11
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    62   2e-09
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    62   2e-09
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    62   2e-09
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    62   3e-09
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    61   4e-09
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    60   7e-09
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    60   8e-09
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    59   1e-08
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    59   2e-08
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    58   2e-08
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     59   2e-08
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    59   3e-08
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    58   3e-08
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    58   4e-08
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    58   5e-08
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    57   7e-08
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    57   8e-08
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    57   9e-08
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    56   2e-07
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    56   2e-07
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    55   2e-07
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    55   3e-07
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    55   4e-07
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    55   4e-07
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    54   5e-07
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    55   5e-07
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    54   7e-07
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    54   8e-07
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    54   1e-06
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    54   1e-06
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    53   1e-06
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    50   1e-06
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    53   1e-06
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    53   1e-06
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    53   2e-06
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    53   2e-06
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    53   2e-06
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    52   2e-06
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    52   2e-06
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    52   2e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    52   3e-06
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    52   4e-06
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    52   4e-06
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    52   5e-06
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    51   5e-06
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    51   6e-06
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    47   9e-06
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    47   1e-05
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    50   1e-05
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    50   1e-05
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    49   1e-05
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    50   1e-05
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    50   2e-05
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    49   2e-05
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    46   2e-05
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    49   3e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    49   3e-05
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    49   3e-05
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    49   4e-05
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    48   4e-05
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    48   5e-05
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    48   5e-05
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    49   5e-05
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    45   8e-05
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    48   8e-05
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    47   9e-05
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    47   9e-05
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    47   1e-04
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    47   1e-04
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    47   1e-04
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    46   2e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    44   2e-04
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    47   2e-04
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    46   2e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    45   3e-04
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    46   3e-04
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    42   3e-04
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            46   3e-04
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    42   4e-04
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    45   4e-04
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    45   4e-04
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    45   4e-04
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    45   5e-04
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    42   5e-04
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    45   6e-04
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    45   7e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    44   8e-04
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    44   8e-04
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    44   8e-04
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    44   9e-04
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    44   0.001
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    44   0.001
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    44   0.001
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    44   0.001
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    44   0.001
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    44   0.001
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    44   0.001
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    43   0.002
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    44   0.002
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    43   0.002
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    43   0.002
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    40   0.002
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    40   0.002
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    43   0.002
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.003
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    43   0.003
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    40   0.003
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    42   0.003
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    42   0.003
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    43   0.004
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    42   0.004
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    42   0.004
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    42   0.004
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    42   0.005
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    42   0.005
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    42   0.006
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    39   0.006
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    42   0.006
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    41   0.007
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    41   0.007
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    41   0.008
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    41   0.008
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    41   0.009
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    39   0.009
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    41   0.009
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    41   0.009
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    40   0.010
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    41   0.010
TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON...    41   0.011
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    40   0.013
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    40   0.015
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    40   0.015
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    40   0.015
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    40   0.017
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    40   0.020
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    40   0.022
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    39   0.022
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    40   0.023
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    40   0.023
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    40   0.024
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    40   0.025
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    40   0.025
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    40   0.025
Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa] ...    40   0.027
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    39   0.029
Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]...    39   0.029
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    39   0.030
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    37   0.030
Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} simila...    39   0.034
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    39   0.035
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    39   0.036
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    39   0.038
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       39   0.040
Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}...    39   0.043
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    39   0.043
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    39   0.055
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    39   0.058
NDAI0J00710 Chr10 (150941..151948) [1008 bp, 335 aa] {ON} Anc_7....    38   0.064
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    39   0.065
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    38   0.065
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    38   0.068
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    38   0.069
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    38   0.071
TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.7...    38   0.071
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    38   0.082
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    38   0.094
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    38   0.100
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    38   0.11 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    37   0.13 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    37   0.13 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    35   0.14 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    37   0.16 
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    37   0.17 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    37   0.18 
Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON...    37   0.20 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    37   0.20 
Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON...    37   0.23 
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    36   0.24 
Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {...    36   0.25 
YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}  ...    36   0.26 
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    36   0.27 
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    36   0.29 
KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar ...    36   0.31 
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    36   0.31 
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    36   0.32 
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    36   0.33 
NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72      36   0.36 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    36   0.39 
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    36   0.39 
ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {...    36   0.41 
Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa] ...    35   0.53 
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    35   0.53 
Suva_9.202 Chr9 (332519..334621) [2103 bp, 700 aa] {ON} YIL005W ...    35   0.56 
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    35   0.59 
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    35   0.59 
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    35   0.60 
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    35   0.61 
NDAI0C00160 Chr3 complement(21850..24186) [2337 bp, 778 aa] {ON}...    35   0.65 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    35   0.65 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    35   0.74 
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    35   0.84 
ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {O...    35   0.95 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    35   1.0  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    34   1.1  
ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON...    34   1.2  
TPHA0B04430 Chr2 (1036315..1039527) [3213 bp, 1070 aa] {ON} Anc_...    34   1.3  
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    34   1.6  
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    34   1.6  
Kpol_1028.101 s1028 complement(221597..222760) [1164 bp, 387 aa]...    33   1.7  
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    33   1.9  
SAKL0C02816g Chr3 complement(264072..267428) [3357 bp, 1118 aa] ...    33   1.9  
TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON...    33   2.0  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    33   2.1  
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    33   2.2  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    33   2.2  
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    31   2.5  
ABL100W Chr2 (209847..212564) [2718 bp, 905 aa] {ON} Syntenic ho...    33   2.6  
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    33   2.7  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    33   2.7  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    33   3.1  
CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} som...    33   3.2  
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    33   3.6  
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    32   4.3  
AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic...    32   4.3  
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    32   4.6  
CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa] ...    32   5.1  
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    32   5.5  
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    32   6.2  
KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {O...    32   6.3  
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    32   7.4  
Kwal_14.874 s14 complement(90148..92316) [2169 bp, 722 aa] {ON} ...    32   8.0  
Suva_13.185 Chr13 (300940..302481) [1542 bp, 513 aa] {ON} YMR018...    31   8.2  
KAFR0E02240 Chr5 complement(451940..453811) [1872 bp, 623 aa] {O...    32   8.5  
TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.6...    31   9.6  

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 1213 bits (3139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/638 (93%), Positives = 598/638 (93%)

Query: 1   MAENSLLKFIAKNKVAILXXXXXXXXXXXXXXXYXXXXXXXXXXXXGTKNRRRPGETFTS 60
           MAENSLLKFIAKNKVAIL               Y            GTKNRRRPGETFTS
Sbjct: 1   MAENSLLKFIAKNKVAILATVSAGTAAVGAYAYYKQLKQREQQQLKGTKNRRRPGETFTS 60

Query: 61  QNEDEVSLKDDGSITSGSXXXXXXXXXXXXXPKLAESFEYPLLSDGEPDMAQLRGLPLSQ 120
           QNEDEVSLKDDGSITSGS             PKLAESFEYPLLSDGEPDMAQLRGLPLSQ
Sbjct: 61  QNEDEVSLKDDGSITSGSRKRKKNKRKRKNKPKLAESFEYPLLSDGEPDMAQLRGLPLSQ 120

Query: 121 RQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVE 180
           RQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVE
Sbjct: 121 RQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVE 180

Query: 181 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 240
           YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK
Sbjct: 181 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 240

Query: 241 QAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEA 300
           QAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEA
Sbjct: 241 QAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEA 300

Query: 301 LQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDL 360
           LQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDL
Sbjct: 301 LQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDL 360

Query: 361 LDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQM 420
           LDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQM
Sbjct: 361 LDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQM 420

Query: 421 YFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPE 480
           YFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPE
Sbjct: 421 YFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPE 480

Query: 481 VPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQL 540
           VPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQL
Sbjct: 481 VPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQL 540

Query: 541 DEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKL 600
           DEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKL
Sbjct: 541 DEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKL 600

Query: 601 QATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           QATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI
Sbjct: 601 QATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 1000 bits (2586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/640 (77%), Positives = 542/640 (84%), Gaps = 3/640 (0%)

Query: 1   MAENSLLKFIAKNKVAILXXXXXXXXXXXXXXXYXXXXXXXXXXXXGTKNRRRPGETFTS 60
           MAENSLL+FI KNKVAIL               Y            GTK+ RR  E F  
Sbjct: 1   MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLKGTKDNRRQSEAFAG 60

Query: 61  QNEDEVSLKDDGSITSGSXXXXXXXXXXXXX--PKLAESFEYPLLSDGEPDMAQLRGLPL 118
           QNEDE  LKDDGS+ SGS                K  E F+YP L +GEPD+AQL+GL  
Sbjct: 61  QNEDEADLKDDGSVVSGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLKGLSP 120

Query: 119 SQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKV 178
           SQRQ YAVQLK++GNHFFT+KNF++AIKYYQ+AIELDPN+PVFYSN+SACYISTGDL KV
Sbjct: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180

Query: 179 VEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 238
           +E+TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
Sbjct: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 240

Query: 239 NKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLL 298
           NKQAMKVLN NLSK+ G RGS++LPSNTSLASFFGIFD  LE+S V++ S  DTA+ +L 
Sbjct: 241 NKQAMKVLNENLSKDEG-RGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLS 299

Query: 299 EALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKN 358
           +ALQRLYSAT EGYL+AN L TK+TD YHSLLSA+ VD  +R NAALA CY GIF FLKN
Sbjct: 300 DALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKN 359

Query: 359 DLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRG 418
           +LLDAQ LLQESINLHPTPNSYIF+ALTLADKENSQEFF FFQKA+DL+PEY PTYYHRG
Sbjct: 360 NLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRG 419

Query: 419 QMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTL 478
           QMYFILQDY NAK DFQKAQSLNP N+YPYIQLACLLYKQGKF+ESE  FNETKLKFPTL
Sbjct: 420 QMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTL 479

Query: 479 PEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPT 538
           PEVPTFFAEILTD+GD++TAIKQYDIAKRL+EVQ KIHVGIGPLIGKATILARQS+QDPT
Sbjct: 480 PEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPT 539

Query: 539 QLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDE 598
           QLDEEKFN AI+LLT+AC+LDPRSEQAKIGLAQLKLQMEKID+AIELF+DSA LARTMDE
Sbjct: 540 QLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDE 599

Query: 599 KLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           KLQATTFAEAAKIQKRLRADPIISAKME TLA YRA GM+
Sbjct: 600 KLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/638 (78%), Positives = 540/638 (84%), Gaps = 3/638 (0%)

Query: 1   MAENSLLKFIAKNKVAILXXXXXXXXXXXXXXXYXXXXXXXXXXXXGTKNRRRPGETFTS 60
           MAENSL +FIA+NKVAIL               Y            G+K+ RR  E  T+
Sbjct: 1   MAENSLFRFIARNKVAILATVSAGTAAVGAYVYYQQLKQQQQQHLKGSKDHRRQSEASTN 60

Query: 61  QNEDEVSLKDDGSITSGSXXXXXXXXXXXXXPKLAESFEYPLLSDGEPDMAQLRGLPLSQ 120
             EDEV LK+  SI +                K AE F+   L +GEPD++QL+GL LSQ
Sbjct: 61  LKEDEVGLKNKSSI-ANENKKKKNKRKRKNRAKSAEDFQCTFLPNGEPDISQLKGLTLSQ 119

Query: 121 RQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVE 180
           +Q YAVQLK+KGNHFFT+KNF +AIKYYQ AIELDPNDPVFYSN+SACYISTGDLNKV+E
Sbjct: 120 KQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLE 179

Query: 181 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 240
           YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK
Sbjct: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 239

Query: 241 QAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEA 300
           QAMKVLN NLSK  G RGS++LPSNTSL SFFGIFDPDLEISRV++ S  DTA+ +L +A
Sbjct: 240 QAMKVLNENLSKGDG-RGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSDA 298

Query: 301 LQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDL 360
           LQ+LYSAT+EGYL A+ LFT ATDAYHSLL AS+VDG ++ NAALAFCY GIF FLKN+L
Sbjct: 299 LQKLYSATNEGYLTADKLFTSATDAYHSLL-ASQVDGPLKENAALAFCYTGIFHFLKNNL 357

Query: 361 LDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQM 420
           L AQALLQESINLHPTPNSYIF+ALTLADKENSQEFF +FQKAIDLD EY PTYYHRGQM
Sbjct: 358 LGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQM 417

Query: 421 YFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPE 480
           YFILQDYVNAK DFQKAQ+L P NIYPYIQLACLLYKQGKF+ESE LFNETKLKFPTLPE
Sbjct: 418 YFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPE 477

Query: 481 VPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQL 540
           VP FFAEILTDKGD++TAIKQYDIAKRL+EVQ KIHVGIGPLIGKATILARQS+QDPTQL
Sbjct: 478 VPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQL 537

Query: 541 DEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKL 600
           DEEKFN AI LLT+AC+LDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSA LARTMDEKL
Sbjct: 538 DEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILARTMDEKL 597

Query: 601 QATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           QATTFAEAAKIQKRLRADPIISAKME TLASYRA GMI
Sbjct: 598 QATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/644 (77%), Positives = 540/644 (83%), Gaps = 6/644 (0%)

Query: 1   MAENSLLKFIAKNKVAILXXXXXXXXXXXXXXXYXXXXXXXXXXXX---GTKNRRRPGET 57
           MAENS  KF A+NK+AI+               Y               GTK+R+R GE 
Sbjct: 1   MAENSFSKFFARNKLAIVATVSAGAAAVGAYVYYHQLKQQQQHHQQQLKGTKDRQRQGEA 60

Query: 58  FTSQN-EDEVSLKDDGSITSGSXXXXXXXXXXXXX--PKLAESFEYPLLSDGEPDMAQLR 114
              Q+ E+E+ LK+DGS  + S               PK AE  EYPLL  GEPDM +LR
Sbjct: 61  LPGQDGEEELGLKEDGSAAADSNKKKKKKNRRKKKSKPKSAEDVEYPLLPHGEPDMDRLR 120

Query: 115 GLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGD 174
           GL   QRQ +AVQLKDKGNHFFT+K+F DAIKYYQ+AIELDPNDPVFYSN+SACYISTGD
Sbjct: 121 GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD 180

Query: 175 LNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 234
           L+KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDG SIEPML
Sbjct: 181 LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240

Query: 235 ERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAH 294
           ERNLNKQAMKVLN +L KN  D+ S+ILPSNTSLASFFGIFDPDLE SRV++ S  D+A 
Sbjct: 241 ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS 300

Query: 295 DMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQ 354
             L EALQ LYSATSEGYLIA+ L TKATD YHSLL A++ D  IR NAALAFCY GIFQ
Sbjct: 301 ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ 360

Query: 355 FLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTY 414
           FLKNDLLDAQALLQESINLHPTPNSY+FMALT+ADKENSQEFF FFQ AIDLDPEY PTY
Sbjct: 361 FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY 420

Query: 415 YHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLK 474
           YHRGQMYFILQDY+NAK DFQKAQSLNPGN+YPYIQLACLLYKQ KFSE+E LFNE KLK
Sbjct: 421 YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK 480

Query: 475 FPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQST 534
           FP LPEVPTF+AEILTDKGD+N AIKQYDIAKRL+EVQ+KIHVGIGPLIGKATILARQS+
Sbjct: 481 FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS 540

Query: 535 QDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLAR 594
           QDPTQLDEEKFNMAIELLT+AC+LDPRSEQAKIGLAQL+LQMEKID AI+LFQ+SATLAR
Sbjct: 541 QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR 600

Query: 595 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLA+YRA GMI
Sbjct: 601 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/539 (56%), Positives = 391/539 (72%), Gaps = 15/539 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ S+GEPD+         Q++ Y+V LKDKGN FF  + ++DA+KYY +A++L   DP
Sbjct: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDP 132

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN+SACY+S G+L KVVE +TKALE+KPD+SKALLRRASANE+L NF +AMFDLSVL
Sbjct: 133 VFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVL 192

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SLNGDF+ ASIEPMLERNLNKQAM+VL   +S ++  +    LPSNT LASFFGIF P+ 
Sbjct: 193 SLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQ----LPSNTFLASFFGIFTPET 248

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
            +      +  D     LL AL  LY   SE YLIA+  F+KA ++Y   L A+  D  +
Sbjct: 249 TLKNFDESNEADVE---LLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVL 305

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +   A A  Y GIF+FLKND L +   +Q SI LHP  N+YI+ AL +ADK  S+ +F F
Sbjct: 306 KEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDF 365

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F KA+D+DP  +P YYHRGQM+F+ Q Y  A  DF+KA+  +  NI+PYIQLACL Y +G
Sbjct: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEG 425

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KF + E LF+E K KFPT PEVP F+AE+LTDKGD++ A KQYDIAKRL+E    IHVG+
Sbjct: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGV 485

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            PL+GKAT+LARQ T        E    +  LL EAC +D RSEQAKIGLAQLKLQ E+I
Sbjct: 486 SPLVGKATLLARQPTV-------ENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEI 538

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           D+AI LF++++ LAR M+EKLQATTFAEA+K+QK++RADP+++AK++ TLA+YR  G+I
Sbjct: 539 DEAITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/538 (56%), Positives = 397/538 (73%), Gaps = 18/538 (3%)

Query: 107 EPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMS 166
           +PDMA +      Q++ YA  LKDKGN  F  K F+DAI++Y HAI+L   DPVF+SN+S
Sbjct: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNIS 133

Query: 167 ACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFD 226
           ACY+S GDL+KVVE +T+ALE+KPD+SKALLRRASA E++G + DAMFD+SVLSLNGDF+
Sbjct: 134 ACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFN 193

Query: 227 GASIEPMLERNLNKQAMKVL------NANLSKNSGDRGSEILPSNTSLASFFGIFDPDLE 280
           G+SIEPMLERNLNKQA++VL      +A++ +    R  + LPSNTSL+SFFGIF P+ E
Sbjct: 194 GSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETE 253

Query: 281 ISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIR 340
           I      +  D     L+  L+ LY ATS+GY +A+  F KA   Y   L A+  D A +
Sbjct: 254 IPAYDESNEADVT---LVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNNDAAFK 309

Query: 341 GNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFF 400
             AA A  Y GIF FLKNDL +++  L+E++ LHP  N+YI++ALT+AD+  S+++FS+F
Sbjct: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYF 369

Query: 401 QKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGK 460
           +KAI LDP  +  YYHRGQMYFI Q+Y  A  DF+K++  +P NI+PYIQLACL Y++ K
Sbjct: 370 EKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENK 429

Query: 461 FSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIG 520
            +E EKLF E +  FPT PEVP F+AEIL DKGD + A+KQY+IA RL+ +Q++IHVGI 
Sbjct: 430 MAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIA 489

Query: 521 PLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKID 580
           PL+GKATILARQ T        E F    +LL +AC  DPRSEQAK+GLAQL+LQ EK+D
Sbjct: 490 PLVGKATILARQPTP-------ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVD 542

Query: 581 DAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           +AIELF+++A +ART+DEKLQA TFAEA K+QKR+RADP++S K+E+TLA+Y+A  M 
Sbjct: 543 EAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/540 (56%), Positives = 405/540 (75%), Gaps = 12/540 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP     +PDM Q+  LPL ++++ ++QLKDKGN +F +K++ +AIKYY  A++L+  DP
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDP 155

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           +FYSN+SACY+S G L+KV+E +TKALE+ P++SKALLRRASANESL N++DA+FDLSVL
Sbjct: 156 IFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVL 215

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSG-DRGSEILPSNTSLASFFGIFDPD 278
           SLNGD+ GASIEP+LERNLNKQA+KVLN  ++K +G ++  ++LPS TSL SFFGIFDP+
Sbjct: 216 SLNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPE 275

Query: 279 LEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGA 338
           L     +     D A   LL  L  L+  T +GYL A+  F KA+  +   L+ +  D  
Sbjct: 276 LTFQNYNE---NDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKH 332

Query: 339 IRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFS 398
           +    A+A  Y GIF+FLKNDLL AQ  ++++I   P  NSY+++AL  ADK  SQE+  
Sbjct: 333 LLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSK 392

Query: 399 FFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQ 458
           +F KA++L+P+    YYHRGQ+YFI QDY  AK++F+KA+ L+  NI+PYIQLACL Y++
Sbjct: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452

Query: 459 GKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVG 518
             F   +KLF+ET+ KFPT PEVPTF+AEIL DKGD+  AIKQYDIA RL++ Q+ IHVG
Sbjct: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVG 512

Query: 519 IGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEK 578
           I PL+GKAT+LARQ    P  L+      A +L+ +AC++DPRSEQA +GLAQLKLQ E+
Sbjct: 513 IAPLVGKATVLARQ----PNLLN---LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEE 565

Query: 579 IDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           +D AIELF+ +A L+RTMDEK+QA TFAEAAKIQKR+RADP+ISAK+++ LASYR+ G+I
Sbjct: 566 VDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/539 (58%), Positives = 385/539 (71%), Gaps = 15/539 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+  +GEP +  +  L   Q+++YA+ LKDKGN FF  K FDDAIKYY  A+EL   DP
Sbjct: 77  YPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALEL-KKDP 135

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN SACY+S G L KVVE TT AL++K D+SK LLRRASANESLGN+ DAMFDLS L
Sbjct: 136 VFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSAL 195

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SL GDF+GASIEPMLERN+NKQAM VL   L +    R    LPSNTSLASFFGIF+P+ 
Sbjct: 196 SLYGDFNGASIEPMLERNMNKQAMLVLKEKLEEKKDHR----LPSNTSLASFFGIFEPET 251

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
                      D    +LL+ L  LY  TSEGY  A+  FTKA  AY +LL  S  +  +
Sbjct: 252 SFENYDESVEADR---LLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEIL 308

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +  AA+A  + GIF+FLKND L A   L++++  HP  NSYI++AL +ADK  + E+F  
Sbjct: 309 KQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFEN 368

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F KA++LDP  +  YYHRGQMYFI Q Y NA  DF KA+  N  NI+PYIQLACL Y++ 
Sbjct: 369 FDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYREN 428

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KF + E LF+E + KFPT PEVP F+AEIL+DKGD   A KQY+IA++L++    IHVGI
Sbjct: 429 KFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGI 488

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            PL+GKAT+LAR+ T        E F  A +   EAC+ DPRSEQAKIGLAQLKLQ E++
Sbjct: 489 APLVGKATLLAREPTV-------ENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEV 541

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           D+AI LF+++A LAR+ DEKLQATTFAEA KIQK++RADPIISAK+E+TLA+YRA GMI
Sbjct: 542 DEAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/539 (56%), Positives = 393/539 (72%), Gaps = 15/539 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+  +GEP +  +  L    R+ YA  LKD+GN FF  K++D+A+KYY +A+ +   DP
Sbjct: 76  YPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVV-KKDP 134

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN+SACY+S G L+KVVE +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVL
Sbjct: 135 VFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSVL 194

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SLNGDF+G+SIEPMLERNLNKQAM VL   L    G+  S+ LPSNT+LASFFGIF P+ 
Sbjct: 195 SLNGDFNGSSIEPMLERNLNKQAMFVLKDKL----GNNVSQQLPSNTALASFFGIFPPE- 249

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
             +  ++ +  D A   L   L+ LY  +SEGY +A+  F K+   + + LS    D  +
Sbjct: 250 --TTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVL 307

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +   A+A  + GIF+FLKND L+A   ++++I LHP  NSYI+MAL +ADK  ++E++ +
Sbjct: 308 KEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQY 367

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F KAI LDP Y P YYHRGQMY+I   Y  A  DF KA+  +  NI+PYIQLACL Y++ 
Sbjct: 368 FDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYRED 427

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KF + E LF+E K KFPT PEVP F+AEIL DKGD   A+KQY+IAKRL+E    IHVG+
Sbjct: 428 KFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALDGIHVGV 487

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            PL+GKAT+LARQ +        E F  A  LL EAC  DP SEQAK+GLAQLKLQ E++
Sbjct: 488 APLVGKATLLARQPSV-------ENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEV 540

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           D+AI LF+++A LART+DEKLQATTFAEAAK+QKR++ADP++SAK+E+TLA+YRA GM+
Sbjct: 541 DEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/539 (56%), Positives = 387/539 (71%), Gaps = 15/539 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           +P+   GEPD+ ++  L   ++ ++A+ LKDKGN FF +K F+DA+KYY  AIE+   DP
Sbjct: 71  FPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDP 129

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN SACY+S G   KVVE TT AL++KPD+SK LLRRASANESLG F DAMFDLS +
Sbjct: 130 VFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAV 189

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SL GDF+G+SIEP+LERN+NKQAM VL   L K    +    LPSNTSLASFFGIF P+ 
Sbjct: 190 SLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYK----LPSNTSLASFFGIFQPET 245

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
                   S  D A   LL+ L  LY  TS GY  A+A F+KA D Y +LL  +  D ++
Sbjct: 246 SFENYDENSEADKA---LLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASL 302

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +  AA+A  + GIF+FLKND + A   L++++   P PN+YI+MAL +ADK  + E+F  
Sbjct: 303 KQKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDN 362

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F+KA++LDP  +  YYHRGQM+FI Q +  A  DF+KA+ LN  NI+PYIQLACL Y++G
Sbjct: 363 FEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREG 422

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KFS+SE LF+E + KFPT PEVP F+AE L+DKGD   A K+YDIA +L+     IHVG+
Sbjct: 423 KFSDSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGV 482

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            PLIGKAT+L+R+ +        E F  A  L  +AC+ DPRSEQAKIGLAQLKLQ E I
Sbjct: 483 SPLIGKATLLSREPSV-------ENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDI 535

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           D+AI LF+++A LAR+ DEKLQATTFAEA KIQK++RADPI+SAK+E+TLA+YRA GMI
Sbjct: 536 DEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/539 (56%), Positives = 383/539 (71%), Gaps = 15/539 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+   GEPD++ L  L   Q+ +YA+ LKDKGN FF +K +D+AI+YY  AIE+   DP
Sbjct: 70  YPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVK-EDP 128

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN SACY+S G   KVVE TT AL++KPD+SK LLRRASANESLGNF DAMFDLS +
Sbjct: 129 VFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAV 188

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SL GDF GASIEP+LERN+NKQ+M VL   L K    +    LPSNTSLASFFGIF P+ 
Sbjct: 189 SLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQEYK----LPSNTSLASFFGIFQPET 244

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
                   S  D     LLE L  LY  T++GY  A+  F KA DA+  LL  +  D  +
Sbjct: 245 TFENYDDNSEADK---YLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADL 301

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +  AA+A  + GIF+FLKND + A   L++++   P PN+YI+MAL +ADK  + E+F  
Sbjct: 302 KRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDN 361

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F+KA+ LDP  +  YYHRGQMYFI Q +  A  DF+KA+ L+  NI+PYIQLACL Y++G
Sbjct: 362 FEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREG 421

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KF +SE LF+E + KFPT PEVP F+AE L+DKGD   A KQYDIA +L++    IHVG+
Sbjct: 422 KFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGV 481

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            PLIGKAT+L+R+ +        E F  A +L  +AC  DPRSEQAKIGLAQLKLQ E I
Sbjct: 482 SPLIGKATLLSREPSV-------ENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDI 534

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           D+AI LF+++A LAR+ DEKLQATTFAEA KIQK++RADP++SAK+E+TLA+YRA GMI
Sbjct: 535 DEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/547 (55%), Positives = 381/547 (69%), Gaps = 21/547 (3%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ + GEPD++QL      QR+ YA+ LKDKGN  F  K  ++AIKYYQ A+E    DP
Sbjct: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDP 139

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFY+N+SACY+S  D  KV+E   KALE+KPD+SK LLRRA+  E++ NF DAMFDLSVL
Sbjct: 140 VFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SLN DF GASIEPMLERNLNKQAMK+L   L +N+ D+  + LPS+TS+ASFFGIF P+ 
Sbjct: 200 SLNNDFSGASIEPMLERNLNKQAMKMLKERL-ENTQDKFEQPLPSDTSMASFFGIFKPET 258

Query: 280 EISRVSSISPPD-TAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGA 338
           E          D T    LLE    L++AT  G++ A+  F +A + Y  L S +  +  
Sbjct: 259 EFKGYDETCEADRTLQTGLLE----LFAATHVGFVKADTCFNEAVNQYRELFSKASDEEK 314

Query: 339 IRGNA----ALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQ 394
           +  N     A+A  Y GIF+FLKND++ AQA + E+I L P  NSYI++ALT AD   S 
Sbjct: 315 LAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESS 374

Query: 395 EFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACL 454
           E+ + F KA++L+P  S TYYHRGQ+YFI QDY  AK DF KA+ L+  NI+ YIQLACL
Sbjct: 375 EYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACL 434

Query: 455 LYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQE---V 511
            Y++G   E +KLF+E + KFP  PEVPTF+AEIL DKGD++ A KQYD+AKRL+E    
Sbjct: 435 CYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISA 494

Query: 512 QRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQ 571
           +  I VG+ PL+GKAT+LARQ +        E F  A  L  EAC  DPRSEQAK+GLAQ
Sbjct: 495 KTGIRVGVAPLVGKATVLARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQ 547

Query: 572 LKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLAS 631
           L LQ E +D AI++F+++A LART DEKLQA TFAEAAK+QK++RADPII AK+E+ LA 
Sbjct: 548 LLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAE 607

Query: 632 YRANGMI 638
           YRA GMI
Sbjct: 608 YRAQGMI 614

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/556 (53%), Positives = 382/556 (68%), Gaps = 29/556 (5%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ S+GEPD ++       ++ +YA+ LKDKGN +F +K +DDAIKYY  A+EL   DP
Sbjct: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN+SACY+S GDL KVVE +TKALEIKPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLS-----------------KNSGDRGSEIL 262
           SLNGDF+ ASIEPMLERNLNKQAM  L                      K   D+  E L
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDK-QENL 251

Query: 263 PSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKA 322
           PS TS+ASFFGIF P+L  +     +  D     L++ L  LY  + E Y  A+  FTKA
Sbjct: 252 PSITSMASFFGIFKPELTFANYDEFNKADKE---LMDGLANLYKRSPESYDRADESFTKA 308

Query: 323 TDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIF 382
              +   L  S  D  ++   A++  + GIF+FLKND L A   ++++I L P  NSYI+
Sbjct: 309 AKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368

Query: 383 MALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442
           MAL +AD+ +S E++++F KA+ L+P  S  YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 443 GNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQY 502
            NI+PYIQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK D++ A+KQY
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488

Query: 503 DIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRS 562
           D+A  L+    +I+VGI PL+GKAT+L R  T        E F  A  LL +A  LDPRS
Sbjct: 489 DLAIELENKLDRIYVGIAPLVGKATLLTRNPTV-------ENFVEATNLLEKASKLDPRS 541

Query: 563 EQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 622
           EQAKIGLAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+++R+DPI++
Sbjct: 542 EQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILA 601

Query: 623 AKMEQTLASYRANGMI 638
           AK+++TLA  R  G++
Sbjct: 602 AKIQETLAKLREQGLM 617

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/556 (54%), Positives = 377/556 (67%), Gaps = 29/556 (5%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ S+G+PD +        ++  YA+ LKDKGN FF +K +DDAIKYY  A+EL  +DP
Sbjct: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDP 132

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLS-----------------KNSGDRGSEIL 262
           SLNGDF+ ASIEPMLERNLNKQAM  L                      K   D+ +E L
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDK-TENL 251

Query: 263 PSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKA 322
           PS TS+ASFFGIF P+L  +     +  D     L+  L  LY  + E Y  A+  FTKA
Sbjct: 252 PSITSMASFFGIFKPELTFANYDESNEADKD---LMNGLTNLYKRSPESYDKADESFTKA 308

Query: 323 TDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIF 382
              +   L  +  D   +   A++  + GIF+FLKND L A   ++++I L P  NSYI+
Sbjct: 309 VKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368

Query: 383 MALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442
           MAL +AD+ +S E++++F KA+ LD   S  YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 443 GNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQY 502
            NI+PYIQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK D+  A+KQY
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQY 488

Query: 503 DIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRS 562
           D+A  L+     I+VGI PL+GKAT+L R  T        E F  A  LL EA  LDPRS
Sbjct: 489 DLAIELENKLDGIYVGIAPLVGKATLLTRNPTV-------ENFIEATNLLEEASKLDPRS 541

Query: 563 EQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 622
           EQAKIGLAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+QKR+R+DPI++
Sbjct: 542 EQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILA 601

Query: 623 AKMEQTLASYRANGMI 638
           AK+++TLA  R  G++
Sbjct: 602 AKIQETLAKLREQGLM 617

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/540 (54%), Positives = 377/540 (69%), Gaps = 13/540 (2%)

Query: 99  EYPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND 158
           ++P   +GEPD   +  L   Q+ ++A++LKDKGN +F  K++++A+K+Y  A+ L   D
Sbjct: 82  QFPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKD 140

Query: 159 PVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 218
           PVFYSNMSACY+S  +L+KV+E +TKALE+KPD+SKALLRRA+ANE L N++DAMFDLSV
Sbjct: 141 PVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSV 200

Query: 219 LSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPD 278
           LSLN DF+GA+IEPMLERNLNKQA+KVL+   SKN     SE LPSNTS+ASFF IF P+
Sbjct: 201 LSLNNDFNGATIEPMLERNLNKQAIKVLDQK-SKNPSKNESE-LPSNTSMASFFSIFTPE 258

Query: 279 LEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGA 338
           +        S  D     LL  L+ LYSA +  Y IA + F K+ + Y  LL ++     
Sbjct: 259 ISFDSYDEESDADKE---LLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKET 315

Query: 339 IRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFS 398
           I    A+A  Y GIF FL+NDL+ AQ L  +SI+  P  NSYI++AL  ADK    E   
Sbjct: 316 ISKKFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNK 375

Query: 399 FFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQ 458
           +F +A+ LDP  SP YYHRGQ+ F+ QDYVNAK DF KA+ L+  NI+PYIQLACL Y++
Sbjct: 376 YFDEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYRE 435

Query: 459 GKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVG 518
           G F + +  F   + KFP  PE+PTF  EIL DKGD + A KQY+   RL+  Q+ IHVG
Sbjct: 436 GDFEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVG 495

Query: 519 IGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEK 578
           I PLIGKAT LARQ T        E F+ A +LL +A + DPRSEQA +GLAQLKLQ E 
Sbjct: 496 IAPLIGKATALARQPTP-------ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEED 548

Query: 579 IDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           +D AIELF+ ++  +R+MDEKLQATTFAEAAK+QKR+RADP+I AK+E+TLA Y A G +
Sbjct: 549 VDTAIELFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/536 (54%), Positives = 381/536 (71%), Gaps = 16/536 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+  +GEP++         ++++Y++ LKDKGN  F +  F++AIKYY  AIEL  N P
Sbjct: 86  YPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKEN-P 144

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           +FYSN+SACY+S   L ++++Y  KALE+KPD+SK LLRRA+ANE L N+ DAMFDLSVL
Sbjct: 145 IFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVL 204

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SLNGD++GASIEP+LERNLNKQAM VL   L KNS D   + LPS+TSL++FFGIF P+L
Sbjct: 205 SLNGDYNGASIEPILERNLNKQAMSVLKDKL-KNSKD---DQLPSDTSLSAFFGIFKPEL 260

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
                   +  D     LL  L  L+   SE YLIA+  F  A + Y   L  +  D  +
Sbjct: 261 SFENYDETNDADKE---LLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDL 317

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +  A++A+ Y GIF FLKNDL  A   + +SI L+P  NSYI+ AL +ADK  SQ++  +
Sbjct: 318 KVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDY 377

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F KA+ LD +    YYHR Q+ F+ QD+  A +DF+KA+  +P NI+PYIQLACL Y++ 
Sbjct: 378 FDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYREN 437

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRK-IHVG 518
           KF + E LF+E K KFPTLPEVP F+AE+LTDKGD++ A+K Y+ A+RL+E  +  IHVG
Sbjct: 438 KFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVG 497

Query: 519 IGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEK 578
           + PLIGKAT+LAR+ T        E    A +LL EA  +DPRSEQAKIGLAQLKLQ E+
Sbjct: 498 VAPLIGKATLLAREPTL-------ENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEE 550

Query: 579 IDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRA 634
           ID++I LF++SA LARTM+EKLQATTFAEAAK+QK +RADPIIS K+E+TLA+YRA
Sbjct: 551 IDESIRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRA 606

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/539 (52%), Positives = 376/539 (69%), Gaps = 15/539 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ S+GEPD++ +      Q++ Y++ +KDKGN  F  K +++AIKYY  A+ L   DP
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLK-KDP 131

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN SAC++    L KVVE TT ALE+KPD+SK LLRRA+ANESLGNF DAM DLS +
Sbjct: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SL G ++  SIEP+LERN+NKQAM+VL   L+  S  +    LPSNTSLASFFGIF  + 
Sbjct: 192 SLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQ----LPSNTSLASFFGIFPSET 247

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
             +     S  D   + LL+ L+ L    +  Y +++  F KA D       A   D A+
Sbjct: 248 SFANYDEQSEAD---NFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPAL 304

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           R   A+A  + GIF+FLKN+ L+A  LLQ++++LHP PNSYI+MAL +ADK  + E+  +
Sbjct: 305 RMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQY 364

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F KA++L P  S  YYHRGQMYF+ Q +  +  DF KA+  NP NI+PYIQLACL Y++ 
Sbjct: 365 FDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYREN 424

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KF + E LF+E + KFPT PEVP F+AEIL+DKGD  +A+K+Y+ A++L++ Q  IHVG+
Sbjct: 425 KFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGV 484

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            PL+GKAT+LARQS           F  A  L  EAC  DPRSEQAKIGLAQLKLQ E++
Sbjct: 485 APLVGKATVLARQSHSG-------DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQV 537

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           D+AI+LF+++  LAR  +EKLQATTFAEAAKIQKR+RADPI+SAK+++TL +YR  G++
Sbjct: 538 DEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/556 (53%), Positives = 377/556 (67%), Gaps = 29/556 (5%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ S+GEPD +        ++ +YA+ LKDKGN FF +K +DDAIKYY  A+EL   DP
Sbjct: 74  YPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LG F DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVL 192

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANL-----------------SKNSGDRGSEIL 262
           SLNGDF+ ASIEPMLERNLNKQAM  L                     +K   D+  E L
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDK-QENL 251

Query: 263 PSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKA 322
           PS TS+ASFFGIF P+L  +     +  D     L+  L  LY  + E Y  A+  FTKA
Sbjct: 252 PSVTSMASFFGIFKPELTFANYDESNEADKE---LMNGLSNLYKRSPESYDKADESFTKA 308

Query: 323 TDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIF 382
              +   L  +  D  ++   A++  + GIF+FLKND L A   ++++I L P  NSYI+
Sbjct: 309 ARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368

Query: 383 MALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442
           MAL +AD+ +S E++++F KA+ LD   S  YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 443 GNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQY 502
            NI+PYIQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK D++ A+KQY
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488

Query: 503 DIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRS 562
           D+A  L+     I+VGI PL+GKAT+L R  T        E F  A  LL +A  LDPRS
Sbjct: 489 DLAIELENKLDGIYVGIAPLVGKATLLTRNPTV-------ENFIEATNLLEKASKLDPRS 541

Query: 563 EQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 622
           EQAKIGLAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++
Sbjct: 542 EQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLA 601

Query: 623 AKMEQTLASYRANGMI 638
            K+++TLA  R  G++
Sbjct: 602 KKIQETLAKLREQGLM 617

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/556 (53%), Positives = 377/556 (67%), Gaps = 29/556 (5%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ ++GEPD ++       ++ +YA+ LKDKGN +F +K +DDAIKYY  A+EL   DP
Sbjct: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDP 132

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN+SACY+S GDL KVVE +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLS-----------------KNSGDRGSEIL 262
           SLNGDF+ ASIEPMLERNLNKQAM  L                      K   D+  E L
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDK-QESL 251

Query: 263 PSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKA 322
           PS TS+ASFFGIF P+L  +     +  D     L+  L  LY  + + Y  A+  FTKA
Sbjct: 252 PSVTSMASFFGIFKPELTFANCDESNEADKE---LMNGLANLYKRSPDSYDRADESFTKA 308

Query: 323 TDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIF 382
              +   L     D  ++   A++  + GIF+FLKND L A   + ++I+L P  NSYI+
Sbjct: 309 VKLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIY 368

Query: 383 MALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442
           MAL +AD+ +S E++++F KA+ LD   S  YYHRGQM FILQ+Y  A  DF KA+ L+P
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 443 GNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQY 502
            NI+PYIQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK D++ A+KQY
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488

Query: 503 DIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRS 562
           D+A  L+     I+VGI PL+GKAT+L R  T        E F  A  LL +A  LDPRS
Sbjct: 489 DLAIELENKLEGIYVGIAPLVGKATLLTRNPTV-------ENFIEATNLLEKASKLDPRS 541

Query: 563 EQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIIS 622
           EQAKIGLAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++
Sbjct: 542 EQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLA 601

Query: 623 AKMEQTLASYRANGMI 638
            K+++TLA  R  G++
Sbjct: 602 TKIQETLAKLREQGLM 617

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/539 (52%), Positives = 389/539 (72%), Gaps = 15/539 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ S+GEPD++         +++YA+ LKDKGN +F  ++F++A+KYY +A+ L   DP
Sbjct: 80  YPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTL-KQDP 138

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN+SACY+S G L KVVE +T+AL++K D+SKALLRRASA ESL N+ DAM DLSVL
Sbjct: 139 VFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVL 198

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SLNGDF+GASIEPMLERNLNKQAM+VL   +++N      ++LPSNTSLASFFG+F P++
Sbjct: 199 SLNGDFNGASIEPMLERNLNKQAMQVLKEKIAENK----PQLLPSNTSLASFFGVFKPEV 254

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
            ++  +  S  +     LL  L  LYS T++GYL+A+  F KA          ++ +  I
Sbjct: 255 SLNNFNENSESEKE---LLNGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDI 311

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +   A+A  Y GI +FLKND LDA   +Q++I + P  NSYI+ +L LADK  ++E    
Sbjct: 312 KEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKN 371

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F  AI+LD   + TYYHRGQ+YF+ Q Y  A +DF KA+ L+  NI PYIQLACL YK+ 
Sbjct: 372 FDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKEN 431

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KF++ E LF+E + KFPT PEVP F+A++L ++ +++ A+KQYDI+K+L+E    IHVGI
Sbjct: 432 KFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGI 491

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            P+IGKAT+LAR    +P     E    + EL  EAC LDPRSEQAKIGLAQLKLQ E++
Sbjct: 492 APMIGKATLLAR----NPIV---ENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEV 544

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           D+AI LF+++A LAR MDEKLQATTFAEA+K+QK++R+DP+I+ K+++TLA+Y+  G++
Sbjct: 545 DEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM 603

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/539 (50%), Positives = 378/539 (70%), Gaps = 15/539 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+  +GEPD++ +      Q+++YA+ LKDKGN  F  + +++AIK+Y  A++L   DP
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDP 128

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN SACY+    L KVVE TT AL++KPD+SK LLRRA+ANESLGN+ DAM DLS +
Sbjct: 129 VFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SL G +   +IEP+LERN+NKQAM+VL   LS   G++    LPSNTSLASFF IF  + 
Sbjct: 189 SLYGGYSSQTIEPVLERNMNKQAMQVLKQKLS--GGEKHE--LPSNTSLASFFRIFPSET 244

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
            +      S  D    +LL+ L  L++  +  Y IA+  FT A + + +   A+  + A+
Sbjct: 245 SLENYDETSEADR---ILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAAL 301

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +   A+A  + GI +FLKN+ L+A  LLQ++I+L P PNSYI+M L +ADK  + E+   
Sbjct: 302 KQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQN 361

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F+KA++LDP+ S  YYHR QM F++Q +  A  DF KA+  +P  +YPYIQLACL Y++ 
Sbjct: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KF + E LF+E + +FPT PEVP F+AEIL+DKGD+  A+K+YD A++L++ Q  IHVG+
Sbjct: 422 KFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGV 481

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            PL+GKA +LARQ +          F  A +L   AC+ DPRSEQAKIGLAQLKLQ E++
Sbjct: 482 APLVGKAALLARQPSAS-------NFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEV 534

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638
           D+AI+LF+ +A L+R  +EKLQATTFAEAAKIQKR+RADP++SAK+++TL +YRA GM+
Sbjct: 535 DEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/538 (51%), Positives = 372/538 (69%), Gaps = 13/538 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ ++G+PD+++       Q  +YA+ LKDKGN FF +K+F+ AI+YY  AI L   DP
Sbjct: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDP 137

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           VFYSN SA Y+S  +  KVVE TT AL++KPD+SK  LRRASA E+LG F+DAMFDLS +
Sbjct: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SL G++ G S+E +LERN+NKQA KVL   L +N G      LPSNTSLASFFGIF+P+ 
Sbjct: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESP--LPSNTSLASFFGIFNPET 255

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
                   +  D     L + L+ LY   +  Y +A+  FTKA + Y   L +S  + ++
Sbjct: 256 SFDDYDGENEADVE---LKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESL 312

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +  AA+AF + GIF+F KND + A   L+ES++L+P P++YI+MAL +ADK  + ++  +
Sbjct: 313 KKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEY 372

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F KA++LDP  S  YYHRGQM+F+++++  A  DF KA+ LNP NI+ YIQ ACL ++  
Sbjct: 373 FDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDD 432

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           +F + E LF+E + KFPT PEVP F+AEIL  K   + AIKQYDIA +L++    IHVGI
Sbjct: 433 RFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGI 492

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            P+IGKAT L R  T        E F  A EL  EAC +DPRSEQAKIGLAQLKLQ E+I
Sbjct: 493 APMIGKATALIRNPTV-------ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEI 545

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGM 637
           DDAI+LF+D+A L+R+ DEKLQATTFAEA K+QK++RADP I  K+++ +A+YRA G+
Sbjct: 546 DDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/536 (52%), Positives = 373/536 (69%), Gaps = 14/536 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           YP+ ++GEP +  +  L    ++E+A  LK+KGN  F  K+F++AIKYY  A+ L   DP
Sbjct: 70  YPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSL-KEDP 128

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           V+YSN+SACY S  +  KV+E  TKAL ++PD+SK L+RRA+A E LGNF DAMFDLSV 
Sbjct: 129 VYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVC 188

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SLN D   ASIEP+LERNLN+QAM VLN  L     D+ S+ LPSNT+L SFFGIF P+L
Sbjct: 189 SLNTDMSDASIEPILERNLNQQAMFVLNTKLG--VTDKKSQ-LPSNTALTSFFGIFKPEL 245

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
             +        D     LL  L+ LY  T+EGY  A+  FTKAT+ +   LS +  D  +
Sbjct: 246 SFANYDDTCEGDKE---LLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETV 302

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +   A+A  ++GIF+FLKN+ L+A   +++++ LHP  NSYI+MAL LADK ++  +F+ 
Sbjct: 303 KEKTAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFAN 362

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           ++KA+ LD + +  YYHRGQMYFI Q Y  A  DF KA+ L+P NI+PYIQLACL Y++ 
Sbjct: 363 YEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYREN 422

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
           KF + E LF+E + KFP   EVP F+AEIL DKGD++ A+K+Y+ A  L++ Q  +HVGI
Sbjct: 423 KFDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGI 482

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            PL+GKAT+L R  T        E F  A  LL EA   DPRSEQAKI L QLKLQ E I
Sbjct: 483 APLVGKATLLVRTPTV-------ENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDI 535

Query: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRAN 635
           D+AIELF+ +ATLART +EKLQATTFAEAAKIQKR+RADP +SAK+++T+A+ RA+
Sbjct: 536 DEAIELFESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRAS 591

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  525 bits (1353), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 277/548 (50%), Positives = 383/548 (69%), Gaps = 22/548 (4%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQ---RQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDP 156
           YPL S  +PD  ++  L  +    + ++A +LK+KGN +F SK+ ++AIKYY++A+ LD 
Sbjct: 130 YPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLD- 188

Query: 157 NDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
            DPVFYSN+SACY +   L+KV+E + KALE+KPD+SKALLRRA+A E+LGN  +A++D 
Sbjct: 189 QDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDF 248

Query: 217 SVLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFD 276
           S+LSL G++ G  +EP+L R L+K +  VL A L     D    IL S+++L SFFGIF 
Sbjct: 249 SILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNF--ILLSDSALVSFFGIFP 306

Query: 277 PDLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAY-HSLLSASRV 335
           P+   + +++ +P D A   L++ L+ L   TSEG+L A+  F KA + +   LLS+   
Sbjct: 307 PE---TTITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDN 363

Query: 336 D--GAIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENS 393
           D    +    A+A  Y G+F+FLK DLL ++  LQ++I+L+P PNSYI+MA+ +ADK N 
Sbjct: 364 DENSGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNND 423

Query: 394 Q---EFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQ 450
           +   ++F +F KA  L+P ++PTYYHRGQ+  + Q +  A+  F KA+ L+  N+YPYIQ
Sbjct: 424 KNDLDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQ 483

Query: 451 LACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQE 510
           LAC+ Y    F + ++LF+E + KFPTLPEVPTF+AEIL DKG+   A+KQYDIA RL+ 
Sbjct: 484 LACVAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLET 543

Query: 511 VQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLA 570
             + IHVGI PLIGKA  LAR  TQ       E F+   ELL +AC+LDPRSEQAKI LA
Sbjct: 544 AYKYIHVGIAPLIGKAAALARIPTQ-------ENFDTMTELLEKACELDPRSEQAKISLA 596

Query: 571 QLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLA 630
           QLKLQ E ID AI LF+++A LART  +KLQATTFAEAAKIQKR++ +PI +AK+E+TLA
Sbjct: 597 QLKLQTEDIDTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLA 656

Query: 631 SYRANGMI 638
           +YRA+G+I
Sbjct: 657 TYRADGII 664

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  508 bits (1307), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 261/539 (48%), Positives = 361/539 (66%), Gaps = 15/539 (2%)

Query: 98  FEYPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPN 157
           ++Y +++D EPD+  ++    +++ EYA +LK +GN +F  K++++AI YY+ A++L  N
Sbjct: 60  YKYLMIND-EPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KN 117

Query: 158 DPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS 217
           DPVFYSNM+ACYIS     + +E  +KALE+ PD+SK LL+RA+  E++G F DA+ DL+
Sbjct: 118 DPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLT 177

Query: 218 VLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDP 277
            +SLNGD++ A+I+P++ER LNKQAM  L  +L  +  ++   +LPS TS+A+FFG+FD 
Sbjct: 178 AVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNK---VLPSYTSMAAFFGVFDA 234

Query: 278 DLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDG 337
           + +I    +    D    +L +AL  LYS T EGY   ++ FTKAT+ Y + L   R + 
Sbjct: 235 ETDIPGHDATEESDK---ILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNS 291

Query: 338 AIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFF 397
                AA+AF +  I  FLKND L A+ L+ E+I LHP P SYI++ L +ADK   +E++
Sbjct: 292 VTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYY 351

Query: 398 SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYK 457
           S FQKAIDLDP  +  YYHRGQM FI+Q Y  A  DF KA+  +P NI+PYIQLAC+ Y+
Sbjct: 352 SNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYR 411

Query: 458 QGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHV 517
           +G F + E LF+E + KFP  PEVP FFAEIL+DKG+   A  +YD A  L+     IHV
Sbjct: 412 EGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHV 471

Query: 518 GIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQME 577
           GI PL+GKAT L +  T        E F  A +L  +A + DPRSE+AK+GLAQ KLQ E
Sbjct: 472 GIAPLVGKATTLLKYPTV-------ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQE 524

Query: 578 KIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANG 636
            +DDAI LF+++A L RT+DEKLQATTFAEA K+Q R+RAD  + AK  + L   R NG
Sbjct: 525 DLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  501 bits (1290), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 260/536 (48%), Positives = 357/536 (66%), Gaps = 16/536 (2%)

Query: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159
           Y + S+GEP+++ +  L    + E+A+ LKDKGN  F +  F+DAIKYY +A++L  +DP
Sbjct: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-DDP 143

Query: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           ++YSN+SACY S     KV+EY TKAL+++P  SK L+RRA A E++GNF DAMFD+S  
Sbjct: 144 IYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISAC 203

Query: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279
           SLNGD + ASIEP+LER LNKQA  VL   +S N      + LPS+T LASFF +F P+ 
Sbjct: 204 SLNGDMNDASIEPILERILNKQAEFVLKEKISANK----EQNLPSSTPLASFFRVFKPE- 258

Query: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339
             +  ++    + A   L+  L  LY  + EG+ IA+  F KA + +   LS ++ + AI
Sbjct: 259 --TSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAI 316

Query: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399
           +   A+A  Y GI  ++KN+ L A   ++ +I LHP  NSYI+ +L  +D   + E+   
Sbjct: 317 KEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQN 376

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F KA++L+P     YYHRGQ YFI Q Y  A  DF K + L+  NI+ YIQLACL Y++ 
Sbjct: 377 FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRES 436

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQ-EVQRKIHVG 518
           KF + E LF+E + KFPT PEVP FFAE+L D+G+   A+K++D A  L+ +   +IHVG
Sbjct: 437 KFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVG 496

Query: 519 IGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEK 578
           I PLIGKAT+L  + T        E F   I+LL EACD DPRSEQA++GLAQLKLQ E 
Sbjct: 497 IAPLIGKATLLISKPTV-------ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQED 549

Query: 579 IDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRA 634
           ID+AI+LF+++A LA++ +EKLQATTFAEAAKIQKR+RADP + AK+ QT+   R+
Sbjct: 550 IDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRS 605

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 63/127 (49%), Gaps = 6/127 (4%)

Query: 101 PLLSDGEP--DMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND 158
           P LS  EP  +        +++R E    LK +GN  F +K+F+ A+K Y  AIEL PN+
Sbjct: 73  PTLSSSEPTGNNTDAHAPEVAERAE---NLKLEGNKAFAAKDFEGAVKKYTEAIELMPNN 129

Query: 159 PVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-S 217
            VFY N +A Y S     + V     A+ I P +S+   R   A  +LG   +AM     
Sbjct: 130 AVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKK 189

Query: 218 VLSLNGD 224
           VL + GD
Sbjct: 190 VLDIEGD 196

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 53/103 (51%)

Query: 117 PLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLN 176
           P ++    AV+ K++GN F   +N+  AI+ Y  AIELDPN  +FYSN +   +   +  
Sbjct: 4   PTAEDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQ 63

Query: 177 KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
                  +AL +   + KA  RR  AN  L  F  A  DL+V+
Sbjct: 64  SAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%)

Query: 117 PLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLN 176
           P ++  + A+ LK++GN +   K +  A++YY  AIELD    +F+SN +   +   +  
Sbjct: 5   PTTEAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQ 64

Query: 177 KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
             ++    ALE+ P + KA  RR  +   L +F  A  DLS++
Sbjct: 65  SCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAI--ELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           A +LK KGN  F SK+F  AI+Y+  AI     PN  V YSN SACY S     + +   
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNH-VLYSNRSACYTSLKQFQEALNDA 62

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I PD SK   R  +A+  LG+  DA
Sbjct: 63  QQCVKINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 49/94 (52%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P D   YSN +A         + ++  
Sbjct: 388 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDC 447

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
            KA+E  P+  +A LR+A+A  ++ +F  A+  L
Sbjct: 448 EKAIEKDPNFVRAYLRKATAQIAIKDFVKALETL 481

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 131 KGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGD----LNKVVEYTTKAL 186
           +GN  + S  FD+AI  Y  A +L   D  + +N SA     GD    +N + E   +  
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWDLH-KDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 187 EIKPDH---SKALLRRASANESLGNFTDAM 213
           E++ D+   +K+  R  +A     N   A+
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAI 350

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K+F+ AI+ +  AIE+   PN  V YSN SACY ST   NK +E  
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNH-VLYSNRSACYTSTKQFNKALEDA 61

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + + I P  SK   R  +A+  LG+  +A
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187
           K +GN F+ ++ FD+AI++Y  A EL   D  + +N +A     G+    ++  T+A+E
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKTLTEAVE 320

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 45/94 (47%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P D   YSN +A         + ++  
Sbjct: 391 EKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDC 450

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
             A+   P+  +A +R+A+A  ++  F   +  L
Sbjct: 451 NVAISKDPNFIRAYIRKATAQIAVREFVSVIETL 484

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + KD+GN  F +KN+D+AI+ +  AIE+   PN  V YSN SACY S     K +E  
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNH-VLYSNRSACYTSKKQFVKGLEDA 63

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  SK   R  +A+  +G+  +A
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 48/94 (51%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I  DP+D   YSN +A         + +   
Sbjct: 387 EKAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDC 446

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
             A+E  P+  +A +R+A+A  ++ +F  A+  L
Sbjct: 447 NTAIEKDPNFIRAYIRKATAQIAIKDFVPAIETL 480

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 99  EYPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND 158
           E P  S+  P+  +    P  + +  A   K +GN  + +  FD+AI++Y  A EL  ND
Sbjct: 229 ETPKKSETVPEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELH-ND 287

Query: 159 PVFYSNMSACYISTGDLNKVVEYTTKALE 187
             + +N SA     GD    +E   +A+E
Sbjct: 288 ITYLNNRSAAEFEKGDYQTAIETLHEAVE 316

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (50%), Gaps = 7/120 (5%)

Query: 106 GEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNM 165
           GEP +A        + ++ A  LK +GN    +K+++ AI+ Y  AIE+ P D V+Y+N 
Sbjct: 77  GEPKVAA------EELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 166 SACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLNGD 224
           +A Y S     K VE   KA ++   +SK   R   A  +LG   +A+     VL + GD
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 79/168 (47%), Gaps = 11/168 (6%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A++ KD+GN F  SK++  AI+ Y  AIELD    +F+SN +   +        +E ++K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGA------SIEPMLERNL 238
           A+E+   + K   RR  A   L +F  A  DL V+      +        + E M+ R  
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEATAKRTLLACERMIRRER 128

Query: 239 NKQAMKVLNANLSKNSGDR--GSEILPSNTSLASFFGIFDPDLEISRV 284
            ++A++    N  +    +    E+   NT +  + GI   +LE+ +V
Sbjct: 129 FEKAIRASGGNEEQQRLCKTLSLEMFAGNTDVGKYGGI---ELELEQV 173

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 402 KAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPG 443
           KAI+LD      Y+ RG  Y  LQD+++AK D +    + PG
Sbjct: 68  KAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPG 109

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 121 RQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVE 180
           +++ A  LK +GN   + KN+  AI  Y  AIE+ P++P +YSN +A Y    D    V 
Sbjct: 94  KKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVL 153

Query: 181 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
               A+++ P +SKA  R  +A  + GN  DA+     VL L GD
Sbjct: 154 DANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 400 FQKAIDLDPEYSPTYY-HRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQ 458
           + KAI++ P  +P YY +R   Y +++D+ NA +D   A  L+P     Y +L      +
Sbjct: 121 YSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAE 179

Query: 459 G 459
           G
Sbjct: 180 G 180

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A +LK +GN     K+FD AI  Y  AI + PN+ ++Y+N +A Y S  D  K  E    
Sbjct: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAES 158

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           A+ + P++SK   R   A  +L    +A+     VL L GD
Sbjct: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN    SK+F+ AIK Y  AIE+ P++ V+Y+N +A Y S     + V+    
Sbjct: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAES 156

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           A+++ P +SK   R   A  +LG   +A+    +VL + GD
Sbjct: 157 AIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPN-DPVFYSNMSACYISTGDLNKVVEYTT 183
           A + K +GN  FTSK+F+ AI+ +  AIE+ P  + V YSN SA Y S     + +   T
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 184 KALEIKPDHSKALLRRASANESLGNFTDA 212
           + ++I P  SK   R  +A   LGN  +A
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 47/91 (51%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P D   YSN +A         + ++  
Sbjct: 387 EKAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDC 446

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAM 213
             A++  P+  +A +R+A+A  ++  + +A+
Sbjct: 447 DNAIKKDPNFVRAYIRKATAQIAIKEYANAL 477

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 347 FCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLA--DKENSQEFFSFFQKAI 404
           +  +G   F   D   A  L  ++I + PTPN  ++   + A    +  QE  +   + +
Sbjct: 8   YKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECV 67

Query: 405 DLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGN 444
            ++P +S  Y   G   F L +   A+ ++++A  L+  N
Sbjct: 68  KINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVV----E 180
           A + K +GN  + +  FD+AI+ Y  A  L+  D  + +N SA     GD    +    E
Sbjct: 255 ADEAKVEGNKLYKAHKFDEAIEQYNKAWALN-KDITYLNNRSAAEFEKGDFETAIATLNE 313

Query: 181 YTTKALEIKPDH---SKALLRRASANESLGNFTDAM 213
              +  E++ D+   +K+  R  +A    G+   ++
Sbjct: 314 AVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSI 349

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
            (REAL)
          Length = 1417

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 79/367 (21%), Positives = 154/367 (41%), Gaps = 51/367 (13%)

Query: 143  DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
            D+I+++Q A+ +DPND   +  +   Y + G +   ++   KA++++P H+ A   +A +
Sbjct: 705  DSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTYAQYFKAVS 764

Query: 203  NESLGNFTDAMFDLSVL----SLNGDFDGASIEPMLERNLN--KQAMKVLNANLSKNSGD 256
               +G + +++  L  +    S    F  A +E +++ +L+   Q   + + +++ ++ +
Sbjct: 765  LCDIGEYLESLEILKKVCQEDSTEESFQSALVEVLMKYSLDLYSQGFLLKSVSIANDTIE 824

Query: 257  RGSEILPS---------------------------NTSLASFFGIFDPDLEISRVSSISP 289
            R   I+                                + S   IF    E S +S    
Sbjct: 825  RIKVIITELKCINQRVWICLSQVLRLFIWIESKVDTLPVESLVSIF----ETSELSGSKE 880

Query: 290  PDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCY 349
             D+  D+ +E L  L S   +   IA      A+    S  + S + G +R +       
Sbjct: 881  IDSIDDIKIETL--LDSTIDDNVSIACKFLILASKYSVSNENFSDIAGIVRASYWYNIGI 938

Query: 350  KGIFQFL-------KNDLLDAQALLQESINLHPTPN-SYIFMALTLADKENSQEFFSFFQ 401
              +  F+       KN  + A    ++SI L    + ++I + +   D  N +     F 
Sbjct: 939  SELTAFITLKEPQYKNAAVFA---FKKSIQLQSNASETWIGLGIATMDI-NFRVSQHCFI 994

Query: 402  KAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKF 461
            KA  L+P+ + T+++   +     D   A+    K QSL P +  P++ +A +L KQG  
Sbjct: 995  KATALEPKATDTWFNLAMLGLKKNDAEFAQQVLNKLQSLAPQDSSPWLGMALILEKQGNV 1054

Query: 462  SESEKLF 468
             ES KLF
Sbjct: 1055 IESSKLF 1061

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 65/131 (49%), Gaps = 4/131 (3%)

Query: 131 KGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKP 190
           +GN    +K FD+AI+ Y  AIE+ P++ V+YSN +A Y S     + V+   +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 191 DHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKV-LNAN 249
            +SK   R   A  +L    +A   L       D +G     +++R+      KV  + N
Sbjct: 161 TYSKGFSRLGFAKYALNKPEEA---LDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMN 217

Query: 250 LSKNSGDRGSE 260
           L K+S    SE
Sbjct: 218 LEKSSTSASSE 228

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIEL--DPNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K+F+ AI+ +  AIE+   PN  V YSN SACY S     + +   
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNH-VLYSNRSACYASMRKFREALADA 62

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + + IKPD SK   R  +A+  LG+  +A
Sbjct: 63  QECVRIKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 62/134 (46%), Gaps = 10/134 (7%)

Query: 93  KLAESFEYPLLSDGEPD-MAQLRGLPLSQRQ---------EYAVQLKDKGNHFFTSKNFD 142
           K  E +E  L     P+ + +LR L   Q++         E A + + +G  +FT+ ++ 
Sbjct: 346 KAIEYYEKSLTEHRTPEVLNKLRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWP 405

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           +A+K Y   I+  P D   YSN +A           ++    A++  P+  +A +R+A+A
Sbjct: 406 NAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATA 465

Query: 203 NESLGNFTDAMFDL 216
             ++  +  A+  L
Sbjct: 466 QIAVQEYAAAIETL 479

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A + K KGN  +  + FD+AI  Y+ A +L   D  + +N +A     GD    ++   K
Sbjct: 254 AEEAKAKGNELYKKRQFDEAIANYEKAWDLH-KDITYLNNRAAAEYEKGDYESAIKTLEK 312

Query: 185 AL----EIKPDH---SKALLRRASANESLGNFTDAM 213
           A+    E++ D+   +K+  R  +A+  L +   A+
Sbjct: 313 AVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAI 348

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A++ K++GN F   K + +A++YY  AIELD    +F+SN +   +   +    +E   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           ++E+ P + KA+ RR  +   L  F+ A  DL  +
Sbjct: 72  SIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A   KD+GN F   ++F  A + Y  AIE DP   +FYSN +   +   +    +   
Sbjct: 7   ELATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           T A+E+   + KA  RR  AN  L NF  A  D +++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K+F+ A + +  AIE    PN  V YSN SACY S     + +E  
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNH-VLYSNRSACYTSLKKFKEALEDA 61

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  SK   R  +A   LGN  DA
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 5/114 (4%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  FFT  ++  A+  Y   I+  P D   YSN +A           ++  
Sbjct: 399 EKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDC 458

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV-----LSLNGDFDGASIE 231
             A+   P+  +A +R+ASA  ++  F  AM  L       L +N   +   IE
Sbjct: 459 DVAISKDPNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187
           K +GN ++ ++ FD+AI++Y  A +L   D  + +N SA     GD  + ++  T+A++
Sbjct: 271 KAEGNKYYKARKFDEAIEHYNKAWDLH-RDVTYLNNRSAAEYEKGDYEQAIKTLTEAVD 328

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A Q K +GN  F SK++  AI+ +  AIE+   PN  V +SN SACY S  D  K ++  
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNH-VLFSNRSACYASNKDFVKALDDA 61

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  +K   R  +A+  LG+  +A
Sbjct: 62  NECVKINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 47/94 (50%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++  A++ Y   I+ +PND   YSN +A           +   
Sbjct: 387 EKAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDC 446

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
            KA+E  P+  +A +R+A+   ++ ++  A+  L
Sbjct: 447 DKAIEKDPNFVRAYIRKATGQIAIKDYAGAIETL 480

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 8/92 (8%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL-- 186
           K +GN  +  + FD+AI+ Y  A E   ND  + +N +A     GD    +E  TKA+  
Sbjct: 259 KAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQ 317

Query: 187 --EIKPDH---SKALLRRASANESLGNFTDAM 213
             E++ D+   SK+  R  ++   LG+   A+
Sbjct: 318 GRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  FT+K++  AI  +  AIE+   PN  V YSN SACY S       +   
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNH-VLYSNRSACYTSLKKFTDALNDA 63

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
           T+ ++I P  SK   R  +A+  LG+  DA
Sbjct: 64  TECVKINPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P D   YSN +A         + +   
Sbjct: 391 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADC 450

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
            KA+E  P+  +A +R+A+A  ++  F  A+  L
Sbjct: 451 NKAIEKDPNFVRAYIRKATAQIAVQEFAGALETL 484

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  FT+K++D AI+ +  AIE+   PN  V YSN SACY S    +  +   
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNH-VLYSNRSACYTSLKKFSDALNDA 63

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  SK   R  +A+  LG+  +A
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 47/94 (50%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P D   YSN +A         + +   
Sbjct: 394 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
            KA+E  P+  +A +R+A+A  ++  +  A+  L
Sbjct: 454 NKAIEKDPNFVRAYIRKATAQIAVKEYASALETL 487

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 14/91 (15%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGD-------LNKVVEY 181
           K +GN F+ ++ FD+AI++Y  A EL   D  + +N +A     G+       LN  VE 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVE- 323

Query: 182 TTKALEIKPDH---SKALLRRASANESLGNF 209
             +  E++ D+   SK+  R  +A   LG+ 
Sbjct: 324 --QGREMRADYKVISKSFARIGNAYHKLGDL 352

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 49/95 (51%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A++ K++GN F   KNF  A + Y  AIELD    +++SN +  ++   +    +    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           A+E+ P + KA  RR  +   L  F  A  DL ++
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 7/98 (7%)

Query: 342 NAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYI----FMALTLADKENSQEFF 397
           N AL F  +G       +   A  L  ++I L  T + Y     F  L L   +N Q   
Sbjct: 10  NKALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKL---DNFQTAL 66

Query: 398 SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
           +   KAI+LDP+    Y+ RG  Y  L ++  A+ D +
Sbjct: 67  NDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLK 104

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A++ KD+GN +  S+++  AI+ Y  AIELD    +FYSN +  ++   +    +   
Sbjct: 10  EAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDC 69

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
             A+++  ++ KA  RR  A   L  F  A  DL++L
Sbjct: 70  NDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL 106

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  FT+K++D AI+ +  AIE+   PN  V YSN SACY S    +  +   
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNH-VLYSNRSACYASLKKFSDALNDA 63

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + + I P  SK   R  +A+  LG+  +A
Sbjct: 64  KECININPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 47/94 (50%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P D   YSN +A         + +   
Sbjct: 394 EKAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
            KA+E  P+  +A +R+A+A  ++  +  A+  L
Sbjct: 454 NKAIEKDPNFVRAYIRKATAQIAVQEYAAALETL 487

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 14/91 (15%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGD-------LNKVVEY 181
           K +GN F+ ++ FD+AI++Y  A EL   D  + +N +A     G+       LN  VE 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTAIATLNDAVE- 323

Query: 182 TTKALEIKPDH---SKALLRRASANESLGNF 209
             +  E++ D+   S++  R  +A   LG+ 
Sbjct: 324 --QGREMRADYKVISRSFARIGNAYHKLGDL 352

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPN-DPVFYSNMSACYISTGDLNKVVEYTT 183
           A + K +GN  FT+KN+D AI+ +  AIE+      V +SN SACY S    +  +    
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 184 KALEIKPDHSKALLRRASANESLGNFTDAMFD 215
           + ++I P  SK   R  +A+  LG+  +A  D
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 9/118 (7%)

Query: 110 MAQLRGLPLSQRQ---------EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPV 160
           +A+LR +   Q++         + A + + +G  +FT  ++ +A+K Y   I+  P D  
Sbjct: 372 LAKLRNVEKEQKKAEAEAYINPDKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDAR 431

Query: 161 FYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 218
            YSN +A         + +    KA+E  P+  +A +R A+A  ++  F  A+  L V
Sbjct: 432 GYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRMAAAQIAVKEFAAALETLDV 489

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 8/88 (9%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE- 187
           K +GN F+ +  FD+AI++Y  A EL   D  + +N +A     GD   V+     A+E 
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELH-KDITYLNNRAAAEYEKGDYETVIATLNDAVEK 324

Query: 188 ---IKPDH---SKALLRRASANESLGNF 209
              ++ D+   SK+  R  +A   LG+ 
Sbjct: 325 GRDMRADYKVISKSFARIGNAYHKLGDL 352

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 120 QRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVV 179
           +++  A  LK +GN    +K+++ AIK Y  AIE+ P + V+Y+N +A Y S    +  V
Sbjct: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAV 147

Query: 180 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
                A+++ P +SK   R   A  + G   DA+     VL + GD
Sbjct: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 12/117 (10%)

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           + +AI++ P  +  Y +R   Y  L+ Y +A  D + A  +NP     Y +L    + QG
Sbjct: 116 YSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQG 175

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTD--KGDYNTAIKQYDIAKRLQEVQRK 514
           K  ++               +V     +  TD  K DY TA K+ + +  L++V  K
Sbjct: 176 KVEDA----------LDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPK 222

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K +D+A+  +  AIE+   PN  V YSN SA Y S    N+ ++  
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNH-VLYSNRSASYASEQKFNEALKDA 63

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            +  +I P  +K   R  +A+  +GN  DA
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGD----LNKVVE 180
           A + K +GN  + ++NFD+AI  Y  A ELD N+  + +N SA     G+    +N + E
Sbjct: 251 AEEAKVEGNKAYKARNFDEAIACYNKAWELD-NNITYLNNRSAAEFEKGEYDTAINTLNE 309

Query: 181 YTTKALEIKPDH---SKALLRRASANESLGNFTDAM 213
              K  E++ D+   +K+  R  +A   +GN  +A+
Sbjct: 310 AIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 64/139 (46%), Gaps = 5/139 (3%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++  A+K Y   I+  P D   YSN +A           +   
Sbjct: 383 EKAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDC 442

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGDFDGASIEPMLERNLNKQ 241
            KA+E  P+  +A +R+A+A  ++ +F+ A+  L +  + + + +G +      R +++ 
Sbjct: 443 NKAIEKDPNFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGAN----AREIDQL 498

Query: 242 AMKVLNANLSKNSGDRGSE 260
            MK         +GD   E
Sbjct: 499 YMKAAQQRFQPATGDETPE 517

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN     K+FD AIK Y  AIE+ P + V+Y+N +A + S     + ++    
Sbjct: 97  AETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAES 156

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           A++  P +SK   R   A  +LG   DA+     VL + GD
Sbjct: 157 AIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           AV   ++     + K +++AIK  + AI+ DP     YS +     + G     +E   K
Sbjct: 131 AVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKK 190

Query: 185 ALEIKPDHSKALLRR 199
            L+I+ D +  +++R
Sbjct: 191 VLDIEGDKASDVMKR 205

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEY 181
           +E AV  K++GN +   +N+  AI+ Y  AIELDP   +F+SN +   +   +    +  
Sbjct: 9   KEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMND 68

Query: 182 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
              AL + P + KA  RR  ++  L     A  DL V+
Sbjct: 69  CDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
            (REAL)
          Length = 1424

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/364 (21%), Positives = 154/364 (42%), Gaps = 45/364 (12%)

Query: 143  DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
            D+I+++Q A+ +DPND   +  +   Y + G +   ++   KA+E++P H+ A   RA +
Sbjct: 713  DSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQPSHTYARYFRALS 772

Query: 203  NESLGNFTDAMFDLSV----LSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDR- 257
               +G + +++  L      ++    F    ++ +++ +L+  A   L  +++  +    
Sbjct: 773  LCDMGEYLESLETLEKVCQEVATEESFQIGLVDVLVKYSLDLYAQGFLMKSVAVANDTIE 832

Query: 258  ------------GSEILPSNTSLASFFGIFDPDLE------------ISRVSSISPPDTA 293
                          +I    + +   F   +  ++            IS ++     D+ 
Sbjct: 833  RIRIIITELKCTNQQIWICLSQVLRLFIWIESKVDTLPVESLVSIFKISELAETKEVDSI 892

Query: 294  HDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYK-GI 352
             ++ ++ L  L S T +   IA      A+    S  S S + G IR     ++ Y  GI
Sbjct: 893  DNIKIDTL--LDSTTDDNVSIACKFLILASKYSVSNQSMSDIAGTIRA----SYWYNIGI 946

Query: 353  -----FQFLKNDLLDAQAL--LQESINLHP-TPNSYIFMALTLADKENSQEFFSFFQKAI 404
                 F  LK+      A+   ++SI L   T  ++I + +   D  N +     F KA 
Sbjct: 947  SELTAFVTLKDSHYRDAAVFAFKKSIQLQSNTSETWIGLGIATMDI-NFRVSQHCFIKAT 1005

Query: 405  DLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSES 464
             L+P+ +  +++   +     D   A+    + QSL P +  P++ +A +L +QG   ES
Sbjct: 1006 ALEPKATDIWFNLAMLGLKKNDTEFAQQVLNRLQSLAPQDSSPWLGMALILEEQGNIVES 1065

Query: 465  EKLF 468
             KLF
Sbjct: 1066 SKLF 1069

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A++ K++GN     +++  AI+ Y  AIELD    V++SN + C++   +     +   K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           AL + P + KA  RR  A   L  F  A  DL+V+
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQ--LACL 454
           + KAI+LD   S  + +R   +  L ++  A  D  KA +L+P N+  Y +  LAC+
Sbjct: 32  YDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACV 88

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%)

Query: 117 PLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLN 176
           P    +  A++ K++GN F   K+F  AI+ Y  AI+LD    +++SN +  +    +  
Sbjct: 4   PTEADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQ 63

Query: 177 KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
             +    +AL++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 64  SALNDCDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%)

Query: 107 EPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMS 166
           E D    R + L    E A  LK KGN FF + +++ AI YY+ A  LD ++P+++SNM+
Sbjct: 23  EYDAKVGRRIVLESMNETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMA 82

Query: 167 ACYISTGDLNKVVEYTTKAL 186
              I      + V    K L
Sbjct: 83  TALIKLERWQEAVNACDKGL 102

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 69/146 (47%), Gaps = 8/146 (5%)

Query: 119 SQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKV 178
           ++  E A  LK +GN     K+++ AIK Y  AI   P + V+++N +A Y S    ++ 
Sbjct: 94  TEASEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEA 153

Query: 179 VEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGDFDGASIEPMLERN 237
           VE    A++I P +SK   R   A  + G   DA+     VL + GD        M++R+
Sbjct: 154 VEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD----KATEMMKRD 209

Query: 238 LNKQAMKV---LNANLSKNSGDRGSE 260
                 KV   LN   S  SG+  +E
Sbjct: 210 YETAKKKVEQSLNLEKSTVSGNATAE 235

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K+++ AI  +  AIE+   PN  VFYSN SACY S     + +   
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNH-VFYSNRSACYASLKKFPEALNDA 62

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  SK   R  +A+  LG+  +A
Sbjct: 63  EECVKINPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 48/94 (51%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P D   YSN +A         + +E  
Sbjct: 388 EKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDC 447

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
            KA+E  P+  +A +R+A+A  ++  F  A+  L
Sbjct: 448 NKAIEKDPNFIRAYIRKATAQIAVKEFAAAIETL 481

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 8/89 (8%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGD----LNKVVEYTTKALE 187
           GN  + ++ FD+AI +Y  A  L   D  + +N SA     GD    L  + E   K  E
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLH-QDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 188 IKPDH---SKALLRRASANESLGNFTDAM 213
           ++ D+   +K+  R  + +    N   A+
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAI 350

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%)

Query: 117 PLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLN 176
           P S++   A++LK++GN F   ++F  AI  Y  AI LD    +++SN +  ++   +  
Sbjct: 4   PTSEQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQ 63

Query: 177 KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
             +    +AL++ P ++KA  RR  +   L  F  A  DL ++
Sbjct: 64  SSLNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 357 KNDLLDAQALLQESINLHPTPNSYIF-MALTLADKENSQEFFSFFQKAIDLDPEYSPTYY 415
           K D   A  L  ++I L  T + Y    AL     +N Q   +   +A+ LDP+ +  Y+
Sbjct: 25  KQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPKNAKAYH 84

Query: 416 HRGQMYFILQDYVNAKMDFQKAQSLNPGN 444
            RG  Y  L ++  AK D Q      PG+
Sbjct: 85  RRGLSYIGLLEFKKAKNDLQIVLKAKPGD 113

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 70/158 (44%), Gaps = 14/158 (8%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A+  K++GN +  +K++  A++ Y  AIE D    +F+SN +   +        +E + +
Sbjct: 38  ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSAR 97

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGA------SIEPMLERNL 238
           A+E+   + KA  RR  A+  L  +  A  DL V+      D A        E ML R  
Sbjct: 98  AIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRALEVCERMLRRER 157

Query: 239 NKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFD 276
            ++A++          GD     L    SLASF G  D
Sbjct: 158 FERAIRA--------DGDEEQRRLCKTLSLASFAGNAD 187

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%)

Query: 117 PLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLN 176
           P +  +  A++ K++GN F   K+F  AI+ Y  AI+LD    +++SN +  +    +  
Sbjct: 4   PTAADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQ 63

Query: 177 KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
             +    +A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 64  SALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEY 181
           ++ A   KD+GN    S+++  AI+ Y +AI   P DP++YSN S  Y+   D    +  
Sbjct: 134 KQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIND 193

Query: 182 TTKALEIKPDHSKALLRRASANESLGNFTDAM 213
               + I  + SKA +R A+       + DA+
Sbjct: 194 ANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPN-DPVFYSNMSACYISTGDLNKVVEYTT 183
           A + K +GN  F++K ++ A+  +  AIE+ P  + V YSN SACY S       +    
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 184 KALEIKPDHSKALLRRASANESLGNFTDA 212
           +  +I P  SK   R  +A+  LG+  +A
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  FF    + DA+K Y   I   P+D   YSN +A         + +   
Sbjct: 390 EKAEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDC 449

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 218
            KALE  P+  KA +R+A+A  ++  ++ A+  L +
Sbjct: 450 EKALEKDPNFVKAYIRKATAQIAIKEYSSALETLDI 485

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 8/91 (8%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL-- 186
           KD+GN  + +  FD+AI++Y  A EL  ND  + +N +A     GD    ++    A+  
Sbjct: 262 KDEGNKLYKAHKFDEAIEHYDKAWELH-NDITYLNNKAAAQYEKGDYETTIKTLEDAIEK 320

Query: 187 --EIKPDH---SKALLRRASANESLGNFTDA 212
             E++ D+   +KA  R  +A E L +   A
Sbjct: 321 GRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 399 FFQKAIDLDPEYSPTYY-HRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYK 457
            F KAI++ PE +   Y +R   Y  L+ + +A  D  +   +NP     Y ++    Y 
Sbjct: 27  LFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINPTWSKGYNRVGAAHYG 86

Query: 458 QGKFSESEKLF 468
            G   E+EK +
Sbjct: 87  LGDLDEAEKSY 97

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN    SK++D A++ Y  AI++ P + V+++N +A Y ++ + ++ V+   +
Sbjct: 101 AEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEE 160

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           A+++ P +SK   R A A     NF +++     VL + GD
Sbjct: 161 AIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A++ K++GN +   K + +A++YY  AIELD    +++SN +   +   +     E   K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           A+ + P + KA+ RR  +   L  F  A  DL V+
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 364 QALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFI 423
           Q   Q+++      N+Y+        ++  QE   ++ KAI+LD   S  + +R      
Sbjct: 4   QEAAQQALEFKNQGNAYV-------KEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLR 56

Query: 424 LQDYVNAKMDFQKAQSLNPGNI 445
           L +++ A+ D  KA +L+P NI
Sbjct: 57  LDNFLTAQEDCDKAIALDPKNI 78

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A+  K+KGN +    ++D AI++Y  AI LD    +++SN +  ++   +    V     
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           AL++ P + KA  RR  +   +  F  A  DL+V+
Sbjct: 72  ALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A++ K++GN F   K+F  AI+ Y  AI+LD    +++SN +  +    +    +    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A++LK++GN F   K +  A +YY  AIE DP + + YSN +   +   +    ++  
Sbjct: 11  EKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDA 70

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
            +A+E+  ++ KA  RRA +   L  F  A  DL ++
Sbjct: 71  KRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 6/132 (4%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A   K +GN    +K++  AI+ Y  AI+  P + ++Y+N +A Y S  + +  ++   K
Sbjct: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSLNGDFDGASIEPMLERNLNKQAM 243
           A+EI P +SK   R A A  +L    +A+ +   VL + GD       P ++R+      
Sbjct: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD----KATPAMKRDFEMAKN 214

Query: 244 KVLNA-NLSKNS 254
           +V ++ NL K+S
Sbjct: 215 RVESSMNLEKSS 226

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A++ K++GN    ++++  AI+ Y  AI+LD    +++SN +  ++   +    +    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           ALEI P + KA  RR  +   L  F +A  DL ++
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 1/100 (1%)

Query: 344 ALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIF-MALTLADKENSQEFFSFFQK 402
           AL F  +G       D   A  L  E+I L  T + Y    A+     +N Q   +   K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 403 AIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442
           A+++DP+    Y+ RG  Y  L ++ NA+ D +   +  P
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKP 111

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 128 LKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187
           LK KGN FF   +++ A+ YYQ AI  DP++P+ YSN +   I     ++ V+   K L+
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

Query: 188 -IKPDHSK 194
            I P++ K
Sbjct: 67  MICPENDK 74

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL 186
           Q K++GN  F   ++  A + YQ  ++++P +P+ YSN +   I  G   +VVE   K L
Sbjct: 5   QYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGL 64

Query: 187 EIKPDHSKALLRR 199
              P+ +  + ++
Sbjct: 65  TFTPNTTDTVYKK 77

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K++D AI  +  AI++   PN  V YSN SACY S       ++  
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNH-VLYSNRSACYTSLKKFVNALKDA 63

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  SK   R  +A+  +G+  +A
Sbjct: 64  EECVKINPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P D   YSN +A         + ++  
Sbjct: 395 EKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDC 454

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
            KA+E  P+  +A +R+A+A  ++  F+ A+  L
Sbjct: 455 NKAIEKDPNFVRAYIRKATAQIAVREFSSALETL 488

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187
           GN  + ++ FD+A+  Y  A E   ND  + +N SA     GD    ++   +A+E
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVE 324

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 397 FSFFQKAIDLDPEYSPTYY-HRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLL 455
              F KAID+  + +   Y +R   Y  L+ +VNA  D ++   +NP     Y ++    
Sbjct: 25  IDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINPSWSKGYNRVGAAH 84

Query: 456 YKQGKFSESE 465
           +  G   E+E
Sbjct: 85  FGMGDLDEAE 94

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 61/150 (40%), Gaps = 34/150 (22%)

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIY------------- 446
           ++KAI  DP +   YY  G +   L  Y  A + F+KA+S+NP N+              
Sbjct: 585 YRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLS 644

Query: 447 ------PYIQLAC---------------LLYKQGKFSESEKLFNETKLKFPTLPEVPTFF 485
                  Y +LAC               LLY  G+++ + K F E K   P    V    
Sbjct: 645 YQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLL 704

Query: 486 AEILTDKGDYNTAIKQYDIAKRLQEVQRKI 515
            +I +  G    AIK+Y IA  L    R++
Sbjct: 705 GQIYSILGRKKDAIKEYTIALNLDPKGRQL 734

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 98/242 (40%), Gaps = 51/242 (21%)

Query: 358 NDLLDAQALLQESINLHP-TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYH 416
           ND      L  E I  +P  P ++  +   L+ ++N  E    F+KA  +DP+++  Y  
Sbjct: 508 NDKSKLSILSSELITSNPRIPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTL 567

Query: 417 RGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSES------------ 464
           +G  Y     +  AK  ++KA + +PG+   Y  L  +  K G++ E+            
Sbjct: 568 QGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINP 627

Query: 465 -------------EKL-FNETKLKFPTL-------PEVPTF-FAEILTDKGDYNTAIKQY 502
                        EKL + E  L++  L         + TF  A +L   G Y  A+K +
Sbjct: 628 INVVLVCCGGVALEKLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFF 687

Query: 503 DIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRS 562
           +  K +   +  +H  +G +    +IL R+               AI+  T A +LDP+ 
Sbjct: 688 EELKHVAPDEATVHFLLGQIY---SILGRKKD-------------AIKEYTIALNLDPKG 731

Query: 563 EQ 564
            Q
Sbjct: 732 RQ 733

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 33/175 (18%), Positives = 72/175 (41%), Gaps = 16/175 (9%)

Query: 418 GQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPT 477
           G++++ L +Y  +   F   ++L P  +      + LL+     S+   L +E     P 
Sbjct: 467 GKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPR 526

Query: 478 LPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDP 537
           +PE        L+ + +++ AIK ++ A +           + P    A  L     Q  
Sbjct: 527 IPETWCCLGNFLSLQKNHHEAIKAFEKATQ-----------VDPKFAYAYTL-----QGH 570

Query: 538 TQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATL 592
                + F++A     +A   DP    A  GL  + +++ + ++A+  F+ + ++
Sbjct: 571 EYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 34/83 (40%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN     KN  +AIK ++ A ++DP     Y+     Y S+   +       KA+   P 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 192 HSKALLRRASANESLGNFTDAMF 214
           H  A       +  LG + +A+ 
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALL 617

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%)

Query: 128 LKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187
           LK +GN     K+F+ AI  Y  AIE+ P + ++Y+N +A + S    ++ V    KA+E
Sbjct: 96  LKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIE 155

Query: 188 IKPDHSKALLR 198
           I P +SK   R
Sbjct: 156 IDPAYSKGYSR 166

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIE--LDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K+F  A++ + +AI+   +PN  V YSN S  Y S    ++ +   
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNH-VLYSNRSGAYASLKKFDEALSDA 62

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
           T+ ++IK D SK   R  +A+  LGN  +A
Sbjct: 63  TECVKIKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 10/136 (7%)

Query: 93  KLAESFEYPLLSDGEPD-MAQLRGLP--LSQRQ-------EYAVQLKDKGNHFFTSKNFD 142
           K  E +E  L     PD + +LR L   + +R+       E A + +  G  +FT  ++ 
Sbjct: 350 KAVEYYEKSLTEHRTPDVLNKLRNLEREIKKREAEAYIDPEKAEKARLDGKEYFTKGDWP 409

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
            A+K Y   I   P+D   YSN +A           ++   KA+EI P   +A +R+A+A
Sbjct: 410 SAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKATA 469

Query: 203 NESLGNFTDAMFDLSV 218
             ++  ++ A+  L V
Sbjct: 470 QIAVQEYSAAIETLDV 485

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEY 181
           +E A + K +GN  +  + FD+AI  Y+ A  L   D  + +N +A     GD N  ++ 
Sbjct: 255 RENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQ-KDITYLNNRAAAEYEKGDYNSAIKT 313

Query: 182 TTKALE 187
             +A+E
Sbjct: 314 LNEAVE 319

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
            complex component and TPR protein, mediates 3'-5' RNA
            degradation by the cytoplasmic exosome; null mutants have
            superkiller phenotype of increased viral dsRNAs and are
            synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 80/368 (21%), Positives = 156/368 (42%), Gaps = 53/368 (14%)

Query: 143  DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
            D+I+++Q A+ +DPND   +  +   Y + G +   ++   KA++++P H+ A   +A +
Sbjct: 720  DSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFAQYFKAIS 779

Query: 203  NESLGNFTDAMFDLSVLSLNG----DFDGASIEPMLERNLN--KQAMKVLNANLSKNSGD 256
               +G + +++  L  +         F    +E ++  +L+   Q   + + +++K++ +
Sbjct: 780  LCDVGEYLESLDILEKVCQEAATEESFQIGLVEVLMRCSLDLYSQGFLLKSVSIAKDTIE 839

Query: 257  R----GSEILPSNTSLA-----------------------SFFGIFDPDLEISRVSSISP 289
            R     SE+   N  +                        S   IF    E S+ S    
Sbjct: 840  RIKIIISELKCENQQVWIYLSQVLRLFIWIESKVDTLPVESLVSIF----ENSQFSGSEE 895

Query: 290  PDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCY 349
             D+  ++ ++ L  L S T +   IA      A+    S    + + G +R     ++ Y
Sbjct: 896  IDSVDNIKIDTL--LDSTTDDNVSIACKFLILASKYSVSDQKFTDIAGTVRA----SYWY 949

Query: 350  K-GI-----FQFLKNDLLDAQAL--LQESINLHP-TPNSYIFMALTLADKENSQEFFSFF 400
              GI     F  LK       A+   ++SI L   T  ++I + +   D  N +     F
Sbjct: 950  NIGISELTAFITLKEPQYRDAAIFAFKKSIQLQSNTSETWIGLGIATMDI-NFRVSQHCF 1008

Query: 401  QKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGK 460
             KA  L+P+ + T+++   +    +D   A+    K QSL P +  P++ +A +L +QG 
Sbjct: 1009 IKATALEPKATNTWFNLAMLGLKKKDTEFAQQVLNKLQSLAPQDSSPWLGMALILEEQGD 1068

Query: 461  FSESEKLF 468
               S KLF
Sbjct: 1069 IIGSSKLF 1076

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN    +K+F+ A+  Y  AI++ P + V+Y+N +A + S     + V+    
Sbjct: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAM 213
           A+++ P +SK   R   A  +LG   +A+
Sbjct: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEAL 185

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 128 LKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL- 186
           +K++GN  F + NF  A +YY   I L+P +P+ YSN +   I     ++ ++   + L 
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLG 66

Query: 187 ------EIKPDHSKALLRRASANESLGNF 209
                 + +P   K L R   A ESL  F
Sbjct: 67  KLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 81/206 (39%), Gaps = 43/206 (20%)

Query: 342 NAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENS-QEFF--- 397
           NA   +C  G F  L+ D  DA    +++  + P        A TL   E+S  + F   
Sbjct: 533 NAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPN----FAYAYTLQGHEHSSNDSFDTA 588

Query: 398 -SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNI----------- 445
            + ++KA+  DP++   YY  G     L  Y  A + F+KA+S+NP N+           
Sbjct: 589 KNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALE 648

Query: 446 --------YPYIQLAC---------------LLYKQGKFSESEKLFNETKLKFPTLPEVP 482
                     Y +LAC               LLY  G++S + + F E     P    V 
Sbjct: 649 KLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATVH 708

Query: 483 TFFAEILTDKGDYNTAIKQYDIAKRL 508
               ++    G    A+K++ IA  L
Sbjct: 709 FLLGQLYQILGRKKDAVKEFTIAMNL 734

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 88/234 (37%), Gaps = 56/234 (23%)

Query: 371 INLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYS------------------- 411
           +N+   P ++  M   L+ +++ ++    F+KA  +DP ++                   
Sbjct: 529 MNIPNAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTA 588

Query: 412 ---------------PTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLY 456
                            YY  G     L  Y  A + F+KA+S+NP N+   I + C   
Sbjct: 589 KNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV---ILICCCGV 645

Query: 457 KQGKFSESEKLFNETKLKFPTLP--EVPTF-FAEILTDKGDYNTAIKQYDIAKRLQEVQR 513
              K    EK  +  +L     P   +  F  A +L   G Y+ A++ ++   +L   + 
Sbjct: 646 ALEKLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEA 705

Query: 514 KIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKI 567
            +H  +G L     IL R+               A++  T A +LDP+  Q  I
Sbjct: 706 TVHFLLGQLY---QILGRKKD-------------AVKEFTIAMNLDPKGNQLII 743

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN     K+ +DAIK ++ A ++DPN    Y+     + S    +       KAL   P 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 192 HSKALLRRASANESLGNFTDAMF 214
           H  A      +   LG + +A+ 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALL 624

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 68/175 (38%), Gaps = 16/175 (9%)

Query: 418 GQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPT 477
           G+++F L +Y  +   F   + L P  +      + LL+      +   L NE  +  P 
Sbjct: 474 GKLHFELVNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPN 533

Query: 478 LPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDP 537
            P+        L+ + D+  AIK ++ A +           + P    A  L     Q  
Sbjct: 534 APQTWCCMGNFLSLQKDHEDAIKAFEKATQ-----------VDPNFAYAYTL-----QGH 577

Query: 538 TQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATL 592
                + F+ A     +A   DP+   A  GL    +++ + D+A+  F+ + ++
Sbjct: 578 EHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A++ KD+GN F   ++F  A + Y  AIELD    +F+SN +  ++   +    +    K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           ALE+   + KA  RR  +   L  F  A  DL  +
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 1/90 (1%)

Query: 357 KNDLLDAQALLQESINLHPTPNSYIF-MALTLADKENSQEFFSFFQKAIDLDPEYSPTYY 415
           K D + A  L  ++I L  T + +    AL    ++N Q   +   KA++LD +    Y+
Sbjct: 25  KQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSKNIKAYH 84

Query: 416 HRGQMYFILQDYVNAKMDFQKAQSLNPGNI 445
            RG  Y  L ++  A+ D +      PG++
Sbjct: 85  RRGLSYVGLLEFKKARTDLKTVLKSKPGDV 114

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  FFT  ++ +A+K Y   ++  P D   +SN +A         + +E  
Sbjct: 378 EKAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDC 437

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 218
            KA+ I P+  +A +R+A+A  ++  F  A+  L++
Sbjct: 438 NKAVSIDPNFVRAYIRKATAQIAVKEFAAAIETLNI 473

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K++  AI  +  AIE+   PN  V YSN SACY S     + ++  
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNH-VLYSNRSACYASNKKFEEALKDA 61

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  SK   R  +A   L    +A
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEA 91

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K+++ A + +  AIE    PN  V YSN SAC+ S    N+ +   
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNH-VLYSNRSACFTSLKKFNEALNDA 61

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  SK   R  +A   LG   +A
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL-- 186
           K +GN F+ ++ FD+AI++Y  A +L   D  + +N SA     GD  + ++  T+A+  
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQ 329

Query: 187 --EIKPDH---SKALLRRASANESLGNFTDAM 213
             E++ D+   SK+  R  +A   L +F  A+
Sbjct: 330 GREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 45/94 (47%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y    +  P D   YSN +A         + ++  
Sbjct: 399 EKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDC 458

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDL 216
             A+   P+  +A +R+A+A  ++  F  A+  L
Sbjct: 459 DMAISKDPNFIRAYIRKATAQIAVREFASAIETL 492

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A + K++GN     K+F  AI+ Y  AI+LD    +++SN +  +    +    +    +
Sbjct: 12  AHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDE 71

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
           A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A   K +GN     K+F  A++ Y  AI++ P + ++Y+N +A + S  +  + ++    
Sbjct: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           A++I P +SK   R A A   LG   +A+     VL + GD
Sbjct: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 4/96 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPN----DPVFYSNMSACYISTGDLNK 177
            E A   K++GN  +  K F DA   Y  A+++  +    +   Y N++AC +   +   
Sbjct: 67  HEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRS 126

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 213
            + Y  +AL++   + KA  R   A   LG F D++
Sbjct: 127 CINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
            Anc_7.546 YPR189W
          Length = 1403

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 87/366 (23%), Positives = 149/366 (40%), Gaps = 51/366 (13%)

Query: 144  AIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASAN 203
            +I+++Q AI +DPND   +  +   Y++ G +   ++   KA+E+   H  A   +A A 
Sbjct: 688  SIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGSHLHAQYFKALAL 747

Query: 204  ESLGNFTDAMFDL--SVLSLNGD--------------------FDG---ASIEPMLER-N 237
              +G F+ A  DL  SV  LN                      F+G     I  ++E  N
Sbjct: 748  ADMGEFS-ASIDLLTSVTELNPTEESFHISLATTLVNYAYDLYFEGYLIKGISIVIESIN 806

Query: 238  LNKQAM-------KVLNANLSKN-----SGDRGSEILPSNTSLASFFGIFDPDLEISRVS 285
            + K          +VL  NLSK      S +   + LP    + +   IF     +    
Sbjct: 807  VIKYITTELQCFSQVLWTNLSKVLKLFISVESKIDSLP----VEALVDIFSSKDMVGTKE 862

Query: 286  SISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAAL 345
                  T  D+LL        +    +LI  A ++  +D+   L  +S +  AI  N  +
Sbjct: 863  VDDIDQTTLDILLSKSDSDNISIGCQFLILAAKYSVPSDSLKGL--SSTIRSAIWYNIGI 920

Query: 346  AFCYKGIFQFLKNDLLDAQAL--LQESINLHP-TPNSYIFMALTLADKENSQEFFSFFQK 402
            A      F  LK D     A+   + SI     T  ++I + ++  D  N +     F K
Sbjct: 921  AEL--NAFLILKQDKYRDAAIFCFKNSIKYQSNTAEAWIGLGISTMDL-NYRVAQHCFIK 977

Query: 403  AIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFS 462
            A+ LDP+ +  +++   +     D   AK    ++QS+ P +  P++ +A +   +G   
Sbjct: 978  AVALDPKNTEIWFNLAMLGLRHDDITFAKEVLNRSQSVAPQDSVPWLGMALVSELKGDKQ 1037

Query: 463  ESEKLF 468
            ES +LF
Sbjct: 1038 ESSRLF 1043

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 2/101 (1%)

Query: 379 SYIFMALTLADKENSQEFFS--FFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQK 436
           S+ +  L +A  +N QE  S  +FQ AI +DP    ++   GQ Y        +   F+K
Sbjct: 669 SWPYRVLGIAYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEK 728

Query: 437 AQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPT 477
           A  L+  +++     A  L   G+FS S  L        PT
Sbjct: 729 AMELDGSHLHAQYFKALALADMGEFSASIDLLTSVTELNPT 769

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%)

Query: 128 LKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187
           LK +GN FF   ++  A  YY   I+L+P +P+ YSN +   I  G+    VE   + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 188 IKPDHSK 194
                +K
Sbjct: 66  YTSSSTK 72

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIEL--DPNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K+++ A + +  AI++   PN  V YSN SACY S     + ++  
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNH-VLYSNRSACYTSLKKFAEGLKDA 62

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  SK   R  +A   L N  DA
Sbjct: 63  EECVKINPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 67/132 (50%), Gaps = 16/132 (12%)

Query: 92  PKLAES-FEYPLLSDGEPDMAQL--RGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYY 148
           PK AE+  E PL  + EP+  ++  +G  ++  +E A     +GN F+ ++ FD+AI++Y
Sbjct: 217 PKQAEAKTEEPLKENNEPEPMEVDEKGPQVAAEEEKA-----EGNKFYKARKFDEAIEHY 271

Query: 149 QHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL----EIKPDH---SKALLRRAS 201
             A EL   D  + +N +A     GD    +   T A+    E++ D+   +K+  R  +
Sbjct: 272 NKAWELH-KDITYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGN 330

Query: 202 ANESLGNFTDAM 213
           A   LG+   ++
Sbjct: 331 AYHKLGDLKKSI 342

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 48/97 (49%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +F+  ++ +A+K Y   I+  P D   YSN +A         + +   
Sbjct: 380 EKAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADC 439

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219
            +A+E  P+  +A +R+ASA  ++  F  A+  L  +
Sbjct: 440 DRAIEKDPNFIRAYIRKASAQIAVKEFAAAVETLDTV 476

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (42%), Gaps = 21/129 (16%)

Query: 102 LLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND--- 158
           L  DGEP              E A   K++ N  + +K F +A + Y+  IE+  ND   
Sbjct: 68  LAYDGEP-------------HEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKV 114

Query: 159 -PVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDA----M 213
               ++N++AC +   +  + +    KAL+  P + K   R A A   L    +A     
Sbjct: 115 NESLFANLAACELEIKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVK 174

Query: 214 FDLSVLSLN 222
           F L++ S N
Sbjct: 175 FGLTIDSEN 183

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+T  +FD  I  ++ A+ ++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 195 ALLRRASANESLGNFTDAM-FDLSVLSL 221
           A    A ++ ++G F +A  + LSVLS+
Sbjct: 527 ARYNLAVSSMNIGCFKEAAGYLLSVLSM 554

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+T  +FD  I  ++ A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 468 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 527

Query: 195 ALLRRASANESLGNFTDAM-FDLSVLSLN 222
           A    A ++ ++G F +A  + LSVLS++
Sbjct: 528 ARYNLAVSSMNIGCFKEAAGYLLSVLSMH 556

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN    +K+++ A++ Y  AI+L P   V+Y+N +A Y S    ++ ++    
Sbjct: 103 AEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAES 162

Query: 185 ALEIKPDHSKALLR 198
           A++++P+ SK   R
Sbjct: 163 AIKVEPNWSKGYSR 176

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELD--PNDPVFYSNMSACYISTGDLNKVVEYT 182
           A + K +GN  F +K++  AI  +  AIE+   PN  V YSN SA Y S+    + +   
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNH-VLYSNRSAAYTSSKQYEQALSDA 63

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDA 212
            + ++I P  +K   R+ +A + L  + +A
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 46/96 (47%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A + + +G  +FT  ++ +A+K Y   I+  P+D   YSN +A           +   
Sbjct: 383 EKAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDC 442

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 218
            KA+E  P   +A LR+A+   ++  F  A+  L +
Sbjct: 443 NKAIEKDPSFIRAYLRKATCQIAVKEFAGAIETLDL 478

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A + K +GN  + ++ FD+AI +Y  A E    D  + +N SA     GD    ++  T+
Sbjct: 251 ADKAKAEGNKAYKARQFDEAISHYNQAWET-FKDITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 185 ALE 187
           A+E
Sbjct: 310 AVE 312

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPV----FYSNMSACYISTGDLNK 177
            E A   K +GN  + +K F DA + Y   I ++  D       ++N +AC +   +  +
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRR 139

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
            +E  +KAL I P + K   R + A  SL    +A
Sbjct: 140 CIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL 186
           +LK KGN  F + ++ +AI +Y   I +DP++P+ YSN +   +     ++ +    K L
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGL 64

Query: 187 EI 188
           ++
Sbjct: 65  QL 66

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G  F   +N  D+I+++Q A+ +DPND   +  +   Y + G +   ++   KA+E+ PD
Sbjct: 691 GISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPD 750

Query: 192 HSKA 195
           H+ A
Sbjct: 751 HNYA 754

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%)

Query: 400  FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
            F KA+ L P+    +++   +     D V A     +AQS+ P N  P++ +A L  K+G
Sbjct: 993  FIKAMVLSPKDVEIWFNLALLALQNNDTVLAGEIMSRAQSMAPQNSSPWLGMALLYEKEG 1052

Query: 460  KFSESEKLFNET 471
            K +ES  +F  +
Sbjct: 1053 KSTESANMFGHS 1064

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 49/118 (41%), Gaps = 5/118 (4%)

Query: 380 YIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQS 439
           Y  M ++  + +N  +   +FQ A+ +DP    ++   GQ YF       +   F+KA  
Sbjct: 687 YRVMGISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVE 746

Query: 440 LNPGNIYP-YIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYN 496
           L+P + Y  Y     L     +  E E+  +  +      PE   F  E+ T   DY+
Sbjct: 747 LSPDHNYAKYFNSVAL----AQMDEFERAIDILRHVLKDEPEKEVFKMELATQIVDYS 800

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN     K+++ AIK Y  AI + P + V+Y+N +A + S  + ++ ++    
Sbjct: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGDFDGASIEPMLERNLNKQAM 243
           A+++   +SK   R   A  + G   +A+     VL + GD    S   +++R+      
Sbjct: 153 AVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD----SATDVMKRDYETAKR 208

Query: 244 KV-----LNANLSKNSGDRGS 259
           KV     LN      + DRG+
Sbjct: 209 KVEQALELNKTDETETSDRGT 229

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 4/117 (3%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPV----FYSNMSACYISTGDLNK 177
            E A   K +GN  + +K F DA + Y   + ++  D       Y+N +AC +   +  +
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRR 139

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 234
            +E  +KAL I P + K   R + A   L    +A    +  +   D +  SI  ML
Sbjct: 140 CIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATFANQRIDPENKSILNML 196

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 76/171 (44%), Gaps = 22/171 (12%)

Query: 398 SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYK 457
           ++F+KA+  D ++   YY  G     L ++ +A + F+KA+S+NP N+   I + C    
Sbjct: 620 NYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNV---ILICCCGVA 676

Query: 458 QGKFSESEKLFNETKLKFPTLP--EVPTF-FAEILTDKGDYNTAIKQYDIAKRLQEVQRK 514
             K S  EK  +  +L     P   +  F  A +L    +Y  A++ ++   +L   +  
Sbjct: 677 FEKLSYPEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEAT 736

Query: 515 IHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQA 565
           +H  +G L     I+ R+               A++  T A +LDP+  Q 
Sbjct: 737 VHFILGQLYN---IMGRKKD-------------AVKEYTIAMNLDPKGNQV 771

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEI 188
           K++GN  +    + DAI  Y   I   P +PV +SN +   I  G+  + +E   + L++
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 189 KPDHSKALLR 198
                 A LR
Sbjct: 68  AASPQHAALR 77

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           D+I+++Q AI +DPND   +  +   Y+  G +   ++   KA+E+   H+ A   ++ A
Sbjct: 683 DSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSIA 742

Query: 203 NESLGNFTDAM 213
              +G FT+++
Sbjct: 743 LSEMGEFTESI 753

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 3/107 (2%)

Query: 389 DKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPY 448
           +++   +   +FQ AI +DP    ++   GQ Y        +   F+KA  L+  + Y  
Sbjct: 677 ERQQESDSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAK 736

Query: 449 IQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDY 495
              +  L + G+F+ES  L  E      T PE  TF   + T   +Y
Sbjct: 737 YFKSIALSEMGEFTESIPLLKEIT---GTHPEEETFQVSLATTLVNY 780

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYI 170
             K +GN +F   N+  AIK Y+  IE++P +P+ YSN +   I
Sbjct: 5   HFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALI 48

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+T  +FD  I  ++ A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 195 ALLRRASANESLGNFTDAM-FDLSVLSLN 222
           A    A ++ ++G + +A  + L+VLS++
Sbjct: 527 ARYNLAVSSMNIGCYKEAAGYLLTVLSMH 555

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+T  +FD  I  ++ A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 195 ALLRRASANESLGNFTDAM-FDLSVLSLN 222
           A    A ++ ++G   +A  + LSVLS++
Sbjct: 527 ARYNLAVSSMNIGCLKEAAGYLLSVLSMH 555

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%)

Query: 128 LKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187
           LK +GN    +K+F+ AI  Y  AI   P++ V+++N +A Y S     + VE    A++
Sbjct: 101 LKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK 160

Query: 188 IKPDHSKALLRRASANESLGNFTDAM 213
           + P +SK   R   A  +LG   +A+
Sbjct: 161 VNPSYSKGYSRLGFAQYALGRPEEAL 186

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A +LK +GN    +K ++ AIK Y  AI++ P + ++Y+N +A + S  + ++ ++    
Sbjct: 102 AEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAES 161

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           A+ + P + +   R   A  + G   +A+     VL + GD
Sbjct: 162 AISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYI 170
           + K KGN  +   NF DA+ +Y+ AI  DP +PV YSN +   I
Sbjct: 6   EFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALI 49

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 103/263 (39%), Gaps = 63/263 (23%)

Query: 342 NAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKEN-SQEFF--- 397
           N ++++C+ G +  L ND   A   L+++  ++P        A TL   E  S + F   
Sbjct: 616 NNSISWCFIGNYFSLINDHDKAIKYLKKATTINPR----FTYAYTLEGHEQASIDAFDTA 671

Query: 398 -SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLY 456
            + ++KAI  DP +   YY  G     L  Y  A + F+KA+ +NP N    I L C   
Sbjct: 672 KNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCCCGS 728

Query: 457 KQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIH 516
              K + +EK  N  +L     P                N++  ++ +AK L  + R   
Sbjct: 729 ALEKLNFNEKALNYYELACNLQP----------------NSSFAKFKLAKLLYSMSR--- 769

Query: 517 VGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQM 576
                                       +N+A+E+L +  ++ P        L QL   M
Sbjct: 770 ----------------------------YNLALEILEQVIEMAPEEVTPHFLLGQLYQMM 801

Query: 577 EKIDDAIELFQDSATLARTMDEK 599
            +  D+++ +    T+A  +D K
Sbjct: 802 GRKKDSVKEY----TIAMNLDPK 820

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 4/124 (3%)

Query: 100 YPLLSDGEPDMAQLR-GLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND 158
           + L++D +  +  L+    ++ R  YA  L+  G+   +   FD A   Y+ AI  DPN 
Sbjct: 628 FSLINDHDKAIKYLKKATTINPRFTYAYTLE--GHEQASIDAFDTAKNCYRKAIACDPNH 685

Query: 159 PVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 218
              Y  +  C +  G  ++ + Y  KA  I P ++  L    SA E L NF +   +   
Sbjct: 686 YNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNAILLCCCGSALEKL-NFNEKALNYYE 744

Query: 219 LSLN 222
           L+ N
Sbjct: 745 LACN 748

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%)

Query: 380 YIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQS 439
           Y  + +   +K+   E   +FQ A+ ++P    ++   GQ Y+       +   F+KA  
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 440 LNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTD 491
           ++PGN Y +   A  L K G + ES ++F E   + P          E+L +
Sbjct: 744 VSPGNAYAHYFKALSLSKMGLYDESIEIFRELTAEHPDEESYQVSMVEVLVE 795

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 39/71 (54%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           ++I+++Q A+ ++P D   +  +   Y S G +   V+   KALE+ P ++ A   +A +
Sbjct: 699 ESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHYFKALS 758

Query: 203 NESLGNFTDAM 213
              +G + +++
Sbjct: 759 LSKMGLYDESI 769

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 400  FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
            F KA  L+P  +  +Y    +     D   A+    K+QS+ P +  P+  LA    K+G
Sbjct: 987  FIKATALNPRETSVWYDMAILALRYNDVAFARAVLMKSQSIAPQDSTPWFGLALASEKEG 1046

Query: 460  KFSESEKLF 468
               +S +LF
Sbjct: 1047 LTQDSARLF 1055

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPV----FYSNMSACYISTGDLNK 177
            E A   K +GN  + +K F DA + Y   + ++  D       ++N +AC +   +  +
Sbjct: 80  HEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRR 139

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
            +E  +KAL I P ++K   R + A   L    +A
Sbjct: 140 CIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 23/182 (12%)

Query: 398 SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYK 457
           + ++KAI  DP++   YY  G     L  Y  A + F+KA+S+NP N+   I + C    
Sbjct: 564 TCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV---ILICCCGVA 620

Query: 458 QGKFSESEKLFNETKLKFPTLP--EVPTF-FAEILTDKGDYNTAIKQYDIAKRLQEVQRK 514
             K S  EK     +L     P   +  F  A +L     Y+ A++ ++    L   +  
Sbjct: 621 LEKMSYQEKALQYYELASELQPSSSLAKFKKAHLLYVMARYSVALENFEELAELAPDEAT 680

Query: 515 IHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKI-GLAQLK 573
           +H  +G L     I+ R+               A++  T A +LDP+  Q  I  L +  
Sbjct: 681 VHFLLGQLY---QIMGRKKD-------------AVKEFTIAMNLDPKGNQLIIDALEKCH 724

Query: 574 LQ 575
           LQ
Sbjct: 725 LQ 726

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 99/245 (40%), Gaps = 31/245 (12%)

Query: 356 LKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYY 415
           L N+LL+ Q            P ++  +    + + +  E   +F+KA ++DP ++  Y 
Sbjct: 497 LSNELLETQP---------DKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYT 547

Query: 416 HRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKF 475
            +G  +        AK  ++KA + +P +   Y  L     K G++ E+   F + +   
Sbjct: 548 LQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSIN 607

Query: 476 PTLPEVPTFFAEILTDKGDYN-TAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQST 534
           P +  +      +  +K  Y   A++ Y++A  LQ            L+    ++AR   
Sbjct: 608 P-VNVILICCCGVALEKMSYQEKALQYYELASELQPSSSLAKFKKAHLL---YVMAR--- 660

Query: 535 QDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLAR 594
                     +++A+E   E  +L P        L QL   M +  DA++ F    T+A 
Sbjct: 661 ----------YSVALENFEELAELAPDEATVHFLLGQLYQIMGRKKDAVKEF----TIAM 706

Query: 595 TMDEK 599
            +D K
Sbjct: 707 NLDPK 711

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN +   ++ D+AI+Y++ A E+DP+    Y+     + S   ++       KA+   P 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 192 HSKALLRRASANESLGNFTDAMF 214
           H  A          LG + +A+ 
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALL 598

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 18/147 (12%)

Query: 102 LLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIEL--DPN-- 157
           L  DGEP              E A   K++GN  +  K + DA + Y   IE+  D N  
Sbjct: 68  LAYDGEP-------------HEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKI 114

Query: 158 DPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS 217
           +   +SN +AC +   +  + V    +AL+  P + K   R A A   L    DA   + 
Sbjct: 115 NESLFSNRAACELELKNYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE 174

Query: 218 VLSLNGDFDGASIEPMLERNLNKQAMK 244
              L  D + A+++ +L++ + ++  K
Sbjct: 175 -FGLKLDSESAALKALLQKVIKREEDK 200

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 91/245 (37%), Gaps = 57/245 (23%)

Query: 358 NDLLDAQALLQESINLHP-TPNSYIFMALTLADKENSQEFFSFFQKAIDLDP-------- 408
           ND      L  E + ++   P ++  +    + K++ +E    FQ++  LDP        
Sbjct: 390 NDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTL 449

Query: 409 ---EYSP-----------------------TYYHRGQMYFILQDYVNAKMDFQKAQSLNP 442
              EYS                         YY  G     L  Y    + F+KA+S+NP
Sbjct: 450 QGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINP 509

Query: 443 GNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFF---AEILTDKGDYNTAI 499
            N+   I + C      K S  E+      L     P         A++L   G YN A+
Sbjct: 510 VNV---ILICCCGVALEKLSHQERALQNYDLACELQPMSSLALFKRAQLLLAMGKYNYAL 566

Query: 500 KQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLD 559
           + ++   ++   +  IH  +G L     I+ R+  QD           A++ LT A +LD
Sbjct: 567 ESFEKLVKIAPDEATIHFLLGQLY---QIVGRK--QD-----------AVKELTIAMNLD 610

Query: 560 PRSEQ 564
           P+  Q
Sbjct: 611 PKGSQ 615

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 4/95 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND----PVFYSNMSACYISTGDLNK 177
            E A   K++GN  +  K F DA + Y  AI++  +D       Y+N +AC +   +  +
Sbjct: 71  HEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRR 130

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
            +     AL + P + K   R A A  ++  F D 
Sbjct: 131 CINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 62/139 (44%), Gaps = 8/139 (5%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIEL-----DPNDPVFYSNMSACYISTGDLNK 177
           E A++LK +GN     +N+ DAI  Y  AI+L      P D  + SN S     +G   +
Sbjct: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE 141

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLNGDFDGASIEPMLER 236
             +     ++I P  SK   R A A      + DAM     VL L G+    +++   E 
Sbjct: 142 ACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFE- 200

Query: 237 NLNKQAMKVLNANLSKNSG 255
            + KQ  + LN +   +SG
Sbjct: 201 -ITKQKFETLNFSTHIDSG 218

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 38/91 (41%), Gaps = 1/91 (1%)

Query: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           E A  LK +GN       +++AIK Y  AI+   N   +YSN S  Y   G     V   
Sbjct: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLAYSKLGRYEDAVNDA 138

Query: 183 TKALEIKPDHSKALLRRASANESLGNFTDAM 213
           T A+ I P  SKA  R   A        D M
Sbjct: 139 TLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 4/95 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND----PVFYSNMSACYISTGDLNK 177
            E A   K++GN F+  K + DA + Y   I++  +D       Y+N +AC +   +  K
Sbjct: 71  HEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRK 130

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
            +E   KAL     + K   R   A  S+  F ++
Sbjct: 131 CIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 22/165 (13%)

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           +++A+  DP++   YY  G  Y  L  Y  A + F+KA+++NP N+   I + C      
Sbjct: 539 YRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV---ILICCCGVALE 595

Query: 460 KFSESEKL--FNETKLKFPTLPEVPTF-FAEILTDKGDYNTAIKQYDIAKRLQEVQRKIH 516
           K S  EK   + E   +      +  F  A +L     Y+ A++ ++   +L   +  +H
Sbjct: 596 KLSYQEKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVH 655

Query: 517 VGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPR 561
             +G L     I+ R+               A++  T A +LDP+
Sbjct: 656 FLLGQLY---QIMGRKKD-------------AVKEFTVAMNLDPK 684

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 11/96 (11%)

Query: 499 IKQYDIAKRLQEVQRKIH-VGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACD 557
           + QYD A    E  R I+ V +  +      L + S Q+           A++   +AC+
Sbjct: 563 LGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQEK----------ALQYYEQACE 612

Query: 558 LDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLA 593
           L P S  AK   A L   M +   A+E F++ A LA
Sbjct: 613 LQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLA 648

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 124 YAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTT 183
           YA  L+  G+   ++ + D A   Y+ A+  DP     Y  +  CY+  G  +K + +  
Sbjct: 517 YAYTLQ--GHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFE 574

Query: 184 KALEIKP 190
           KA  I P
Sbjct: 575 KARNINP 581

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 104/247 (42%), Gaps = 37/247 (14%)

Query: 343 AALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKE--NSQEFFS-- 398
           +A+ +C  G    L  D  +A   L+++ NL P        A TL   E  N+  F +  
Sbjct: 456 SAITWCCLGNLFSLNRDHDEAIKALKKATNLDPR----FAYAYTLQGHEYSNNDAFDNAK 511

Query: 399 -FFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYK 457
             ++KA+ ++P +   +Y  G     L  Y  A + F+KA+S+NP N+   I   C    
Sbjct: 512 MCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV---ILNCCCGVA 568

Query: 458 QGKFSESEKLFNETKLKFPTLPEVPTFF---AEILTDKGDYNTAIKQYDIAKRLQEVQRK 514
             +    EK  +  +L     P         +++L + G Y+ A++ ++  ++L   +  
Sbjct: 569 LERLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAP 628

Query: 515 IHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKL 574
           IH  +G L     I+ R+               AI   T A +LDP+      G+  +K 
Sbjct: 629 IHFLLGQLY---QIVGRKKD-------------AITQFTIAMNLDPK------GIQLVKE 666

Query: 575 QMEKIDD 581
            +EK  +
Sbjct: 667 ALEKCHE 673

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%)

Query: 118 LSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNK 177
           + Q  + A+     GN F  +++ D+AIK  + A  LDP     Y+     Y +    + 
Sbjct: 450 MEQDDKSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDN 509

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMF 214
                 KAL I P+H  A      +   LG + +A+ 
Sbjct: 510 AKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALL 546

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 62/125 (49%), Gaps = 6/125 (4%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+T+ ++D  I  ++ A+ ++PND + ++ + A   ++    + V    +AL +KP   +
Sbjct: 503 FYTTADYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVR 562

Query: 195 ALLRRASANESLGNFTDA----MFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNANL 250
           A    A ++ ++G F +A    +  LS+  +NG  D   +E     N    A K  +  L
Sbjct: 563 ARYNLAVSSINIGCFKEAAEHLLTALSMHEINGILD-TDLETNFSSNTLNNAYKS-HTGL 620

Query: 251 SKNSG 255
           S NSG
Sbjct: 621 STNSG 625

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN    +K+++ AI  Y  AI++ P + ++Y+N +A + S    ++ VE    
Sbjct: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAES 161

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 162 AISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+  SF  K++++DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 287 QKALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 346

Query: 454 LLYKQGKFSES 464
           L Y+  ++ ++
Sbjct: 347 LYYQISQYRDA 357

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 85/205 (41%), Gaps = 13/205 (6%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND----PVFYSNMSACYISTGDLNK 177
            E A   K++GN  + +K F DA + Y   IE+  +D       Y+N +AC +   +  +
Sbjct: 75  HEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRR 134

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERN 237
            +     AL+  P + K   R   A  +L    +A   +    L  D     ++ +L+  
Sbjct: 135 CLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIV 193

Query: 238 LNKQ-AMKVLNANLSKNSGDR-GSEILPSNT-SLASFFGI-FDPDLEISRVSSIS---PP 290
           L KQ A K  N+   +    R G +I+  N   L     +  +   EI R + +S   P 
Sbjct: 194 LKKQEAKKEQNSKKEQEKQIREGMQIILENAMKLRKIINVKSNESPEIVRDAKVSLEDPV 253

Query: 291 DTAHDMLLEALQRLYSATSEGYLIA 315
           D    ++  AL  LY  T E   +A
Sbjct: 254 DCESQLIFPALV-LYPTTDEFDFVA 277

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN    +K+++ AI  Y  AI++ P + ++Y+N +A + S  + ++ V+    
Sbjct: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAES 161

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 162 AISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 7/61 (11%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL 186
           + K  GN +F   N+  A++YY+  IE++P +P+ YSN      S   L K+ +Y T+AL
Sbjct: 5   EYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSN------SAMSLIKLTKY-TEAL 57

Query: 187 E 187
           E
Sbjct: 58  E 58

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL 186
            L+ KGN  ++   ++ A+ YY++A   +P++PV  +NMS   +        +    +AL
Sbjct: 10  HLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRAL 69

Query: 187 EI 188
           EI
Sbjct: 70  EI 71

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 53/96 (55%), Gaps = 4/96 (4%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+ +  FD  I  +Q A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 434 FYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 493

Query: 195 ALLRRASANESLGNFTDA----MFDLSVLSLNGDFD 226
           A    A ++ ++G + +A    +  LS+  + G+F+
Sbjct: 494 ARYNLAVSSMNIGCYKEAAEHLLTALSMHDVEGEFE 529

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP----VFYSNMSACYISTGDLNK 177
            E A   K +GN  + +K F DA + Y   + ++  D       ++N +AC +   +  K
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRK 139

Query: 178 VVEYTTKALEIKPDHSKALLR 198
            VE   KAL I P + K   R
Sbjct: 140 CVEDCGKALTINPKNIKCYYR 160

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 1/116 (0%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+  ++  K++++DP  S T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 289 QKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 348

Query: 454 LLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEIL-TDKGDYNTAIKQYDIAKRL 508
           L Y+  ++ ++   +       P + EV      +  T     N A+  Y  A RL
Sbjct: 349 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARL 404

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 27/44 (61%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYI 170
           +LK +GN  +  +++  A+++Y   +E D  +P+ +SN + C I
Sbjct: 6   RLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLI 49

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 76/184 (41%), Gaps = 23/184 (12%)

Query: 398 SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYK 457
           + ++KA+  DP++   YY  G     L  Y  A + F+KA+S+NP N+   + + C    
Sbjct: 600 TCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICCCGGS 656

Query: 458 QGKFSESEKLFNETKLKF---PTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRK 514
             K    EK+    +L     PT         ++L     YN A++ ++   +L      
Sbjct: 657 LEKLGYKEKVLQYYELACQLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 716

Query: 515 IHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKL 574
            H  +G       I+ R+               A++ LT A +LDP+  Q  I   Q K 
Sbjct: 717 AHYLLG---QTYRIVGRKKD-------------AVKELTVAMNLDPKGNQVVIDELQ-KC 759

Query: 575 QMEK 578
            M++
Sbjct: 760 HMQE 763

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN     K+ D AIK ++ A +LDPN    Y+     + S    +       KAL   P 
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 192 HSKALLRRASANESLGNFTDAMF 214
           H  A     +++  LG + +A+ 
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALL 634

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A +LK+KGN    +K +  AI  Y  AI+L P +  +Y+N +  YI   + +  +    K
Sbjct: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193

Query: 185 ALE----IKPDHSKALLRRASANESLGNFTDAM 213
           ++E    I P + KA  R   A   +G++  ++
Sbjct: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G  +   +   D+I+++Q AI +D +D   +  +   Y S G +   ++   K LE+ P 
Sbjct: 682 GISYLEKQQAADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFEKPLELSPH 741

Query: 192 HSKALLRRASANESLGNFTDAM 213
           H  AL  +A     +G F +++
Sbjct: 742 HPHALYFKALGLSDVGQFVESI 763

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 1/93 (1%)

Query: 376  TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
            T +S+I + +   D  N +     F KA  L+P  +  +++   +     D   AK    
Sbjct: 959  TTSSWIGLGIATMDI-NYRVSQHCFIKASALEPRDTEIWFNLSMLSLKNNDTTFAKQVLD 1017

Query: 436  KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
            + QS+ P    P++ LA L   +G   ES +LF
Sbjct: 1018 RTQSIAPQESTPWLGLALLHELEGNRQESSRLF 1050

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 5/96 (5%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPV-----FYSNMSACYISTGDLN 176
            E A   K++GN  + +K F DA   Y   I+++ N  V      ++N +AC +   +  
Sbjct: 73  HEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFR 132

Query: 177 KVVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
           + +     AL++ P + K   R   A  +L    +A
Sbjct: 133 RCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 4/95 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPV----FYSNMSACYISTGDLNK 177
            E A   K++ N  +  K F DA + Y   I++   D       ++N +AC +   +   
Sbjct: 82  HEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRS 141

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
            V    KA+EI P + K   R   A  +LG F +A
Sbjct: 142 CVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           DAI+++Q A+ ++PN+   +  +   Y+S G +   +    KA E+ PDH  A    A +
Sbjct: 686 DAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLYAKYFTAQS 745

Query: 203 NESLGNFTDAM 213
              +G +  ++
Sbjct: 746 LSEMGEYVKSI 756

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 51/113 (45%), Gaps = 2/113 (1%)

Query: 379 SYIFMALTLADKENSQE--FFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQK 436
            + F  + +A+ E  QE     +FQ A+ ++P    ++   GQ Y        +   F+K
Sbjct: 668 CWPFRVIGIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEK 727

Query: 437 AQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEIL 489
           A  L+P ++Y     A  L + G++ +S  +F E  ++ P        ++E L
Sbjct: 728 ATELDPDHLYAKYFTAQSLSEMGEYVKSISIFEEIIMETPKEESFQVSYSETL 780

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 40/71 (56%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           D+I+++Q A+ +DPND   +  +   Y + G +   ++   KA+ +KP H+ A   +A +
Sbjct: 713 DSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIGLKPSHTYAQYFKAVS 772

Query: 203 NESLGNFTDAM 213
              +G + +++
Sbjct: 773 LCDMGEYLESL 783

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%)

Query: 400  FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
            F KA  L+P+ +  +++   +     D   A+    K+QSL P +  P++ +A +L KQG
Sbjct: 1001 FIKATALEPKATDIWFNLAMLGLKKNDTDFAQQVLNKSQSLAPQDSSPWLGMALILEKQG 1060

Query: 460  KFSESEKLF 468
               ES KLF
Sbjct: 1061 NIVESSKLF 1069

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184
           A  LK +GN    +K+++ AI  Y  AI++ P + ++Y+N +A + S  + ++ V+    
Sbjct: 102 AEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAES 161

Query: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224
           ++ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 162 SISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 74/182 (40%), Gaps = 23/182 (12%)

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           ++KA+  DP++   YY  G     L  Y  A + F+KA+S+NP N+   + + C      
Sbjct: 597 YRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNV---VLICCCGGSLE 653

Query: 460 KFSESEKLFNETKLKF---PTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIH 516
           K    EK     +L     PT         ++L     YN A++ ++   +L       H
Sbjct: 654 KLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAH 713

Query: 517 VGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQM 576
             +G       I+ R+               AI+ LT A +LDP+  Q  I   Q K  M
Sbjct: 714 YLLG---QTYRIVGRKKD-------------AIKELTVAMNLDPKGNQVIIDELQ-KCHM 756

Query: 577 EK 578
           ++
Sbjct: 757 QE 758

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN     K+ D AIK ++ A +LDPN    Y+     + S    +       KAL   P 
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 192 HSKALLRRASANESLGNFTDAMF 214
           H  A     ++   LG + +A+ 
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALL 629

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKAL 186
           K++GN  F    + +A+  Y   I   P +PV YSN +   I  G+  + ++   + L
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%)

Query: 379 SYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQ 438
           ++  M     + +NSQ     ++ A+D++P     +Y  GQ Y +L  ++ +   FQKA 
Sbjct: 473 AWTLMGHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKAC 532

Query: 439 SLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
           +L P +   +  LA    K G F+++ K F
Sbjct: 533 TLKPLDKRMWQALASCYVKIGNFNDAIKSF 562

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 5/125 (4%)

Query: 114 RGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTG 173
           R + L+++   A  L   G+ F   KN   AI+ Y+HA++++P D   +  +   Y    
Sbjct: 462 RAITLNKKNISAWTLM--GHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLD 519

Query: 174 DLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAM--FDLSV-LSLNGDFDGASI 230
                + Y  KA  +KP   +     AS    +GNF DA+  F+ ++ LS+N D D + +
Sbjct: 520 MHLYSLYYFQKACTLKPLDKRMWQALASCYVKIGNFNDAIKSFERALQLSINTDQDSSLL 579

Query: 231 EPMLE 235
             + E
Sbjct: 580 YKLAE 584

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 4/95 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIEL----DPNDPVFYSNMSACYISTGDLNK 177
            E A   K++GN  FT K F +A   Y   IE+    D  +   ++N +AC +   +   
Sbjct: 77  HEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRS 136

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
            +     AL + P + K   R   A   L N  +A
Sbjct: 137 CINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 94/224 (41%), Gaps = 22/224 (9%)

Query: 377 PNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQK 436
           P ++  +   L+ K++ ++    F+KA  +DP+++  Y  +G        +  AK  F+K
Sbjct: 551 PETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRK 610

Query: 437 AQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDY- 495
           A + +P +   Y  +     K G + E+   F + +  +P +  V      +  +K +Y 
Sbjct: 611 AIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYP-INAVLICCCGVALEKLEYQ 669

Query: 496 NTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEA 555
           + A++ Y++A  LQ               +A +L              ++N+A++   E 
Sbjct: 670 DKALEYYELACTLQPNSNLAR------FKRANLLYAMG----------RYNLALQSFEEL 713

Query: 556 CDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEK 599
             L P        L QL   M + ++AI  F    T+A  +D K
Sbjct: 714 SKLTPEEPTVHFVLGQLYQIMGRKNEAIREF----TVAMNLDPK 753

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 64/170 (37%), Gaps = 16/170 (9%)

Query: 418 GQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPT 477
           G++++ + +Y  A + F +   L P  I      + LL+    +     L +     +P 
Sbjct: 490 GKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPN 549

Query: 478 LPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDP 537
            PE        L+ K D+  AI+ ++ A +           I P    A  L        
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATK-----------IDPKFAYAYTLQGHECS-- 596

Query: 538 TQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQ 587
                + F+ A +   +A   DPR   A  G+    +++   D+A+  F+
Sbjct: 597 ---SNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFE 643

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 74/193 (38%), Gaps = 26/193 (13%)

Query: 409 EYSPTYY-HRGQMYFILQDYVNAKMD-------FQKAQSLNPGNIYPYIQLACLLYKQGK 460
           +Y  TYY ++ + +  + +Y++ K D       F+KA  ++P   Y Y         QG 
Sbjct: 541 DYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTL-------QGH 593

Query: 461 FSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIG 520
              S   F+  K  F                 G Y+  +  YD A    E  R+I+    
Sbjct: 594 ECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINA 653

Query: 521 PLIGKATI-LARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579
            LI    + L +   QD           A+E    AC L P S  A+   A L   M + 
Sbjct: 654 VLICCCGVALEKLEYQDK----------ALEYYELACTLQPNSNLARFKRANLLYAMGRY 703

Query: 580 DDAIELFQDSATL 592
           + A++ F++ + L
Sbjct: 704 NLALQSFEELSKL 716

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 40/71 (56%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           ++I+++Q A+ +DP D   +  +   Y++ G +   ++   +AL++   HS AL  +A  
Sbjct: 697 ESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEHHSYALYYKAVC 756

Query: 203 NESLGNFTDAM 213
           +  LG + +++
Sbjct: 757 HSQLGEYEESL 767

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 82/225 (36%), Gaps = 56/225 (24%)

Query: 377 PNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTY---------------------- 414
           P ++  +    + K++ +E    FQ++  LDP ++  Y                      
Sbjct: 409 PETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRK 468

Query: 415 ------------YHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFS 462
                       Y  G     L  Y    + F+KA+S+NP N+   I + C      K S
Sbjct: 469 ALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNV---ILICCCGVALEKLS 525

Query: 463 ESEKLFNETKLKFPTLPEVPTFF---AEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519
             EK      L     P         A++L   G YN A++ ++    +   +  IH  +
Sbjct: 526 HQEKALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALENFEKLVTIAPDEATIHFLL 585

Query: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQ 564
           G L     I+ R+  QD           A++ LT A +LDP+  Q
Sbjct: 586 GQLY---QIVGRK--QD-----------AVKELTIAMNLDPKGSQ 614

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 35/83 (42%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN F   K+ +++IK +Q + +LDP+    Y+     Y S    +  +    KAL   P 
Sbjct: 416 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALGSNPQ 475

Query: 192 HSKALLRRASANESLGNFTDAMF 214
           H  A          LG + + + 
Sbjct: 476 HYNAHYGLGMCCLKLGQYEECLL 498

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 46/115 (40%), Gaps = 17/115 (14%)

Query: 102 LLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP-- 159
           L  DGEP              E A   K++GN  +  K F DA   Y   IE+  +D   
Sbjct: 67  LAYDGEP-------------HEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGI 113

Query: 160 --VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
             +   N +AC +   +  + +    +AL++ P + KA  R   A   L    +A
Sbjct: 114 SELLLLNRAACELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYI 170
             KD GN  F    +D AI+ Y+  I L+P + V YSN++  Y+
Sbjct: 37  HFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYL 80

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G  F+ ++ F   I  ++ A+E++PND + ++ + A   ++    + ++   KAL +KP 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 192 HSKALLRRASANESLGNFTDAMFD-LSVLSLN 222
             +A    A ++ ++G + +A    LS LS++
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+  S+  K++++DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 281 QKALSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 340

Query: 454 LLYKQGKF 461
           L Y+  ++
Sbjct: 341 LYYQISQY 348

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 4/96 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPN----DPVFYSNMSACYISTGDLNK 177
            E A   K +GN  +  K F DA + Y   I++       +   Y+N +AC +   +  +
Sbjct: 78  HEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRR 137

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 213
            +    +AL++ P + K   R A A  +L    +A+
Sbjct: 138 CINDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 46/93 (49%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
             +++  M     + +NS      +++A+D++P+    +Y  GQ Y +L+ ++ +   FQ
Sbjct: 453 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPKDFKAWYGLGQAYEVLEMHLYSLFYFQ 512

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
           KA SL P +   +  L     K G  S++ K F
Sbjct: 513 KACSLQPLDRRMWQALGTCYIKIGYKSDALKCF 545

>TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1397

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 41/82 (50%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G  +  ++    +I+++Q A+ +DP D   +  +   Y + G +   ++   +ALE+  +
Sbjct: 673 GIFYLETQEEASSIEWFQSALRIDPKDVESWVGLGQAYYACGRIEASMKVFERALELDSE 732

Query: 192 HSKALLRRASANESLGNFTDAM 213
           H      +A +  +LG F D++
Sbjct: 733 HQHCRYLKAQSLAALGQFVDSI 754

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 45/82 (54%)

Query: 131 KGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKP 190
           +G  ++   +FD  I+ ++ +++++PND V ++ + A   ++      ++   +AL +KP
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKP 496

Query: 191 DHSKALLRRASANESLGNFTDA 212
              +A    A A+ ++G + +A
Sbjct: 497 SFVRARYNLAVASMNIGCYKEA 518

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+    FD  I  ++ A+ ++PND + ++ + A   ++    + ++   KAL++KP   +
Sbjct: 406 FYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVR 465

Query: 195 ALLRRASANESLGNFTDAM-FDLSVLSLNGDFDGAS 229
           A    A ++ ++G + +A  + LS L ++ + +G S
Sbjct: 466 ARYNLAVSSINIGCYKEAAEYLLSALKMH-EVEGVS 500

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 40/71 (56%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+  ++  K++++DP  + T+YH G+++ +  DY  A   FQ+A + +  N   +  +  
Sbjct: 298 QKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 357

Query: 454 LLYKQGKFSES 464
           L Y+  ++ ++
Sbjct: 358 LYYQISQYRDA 368

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+++  FD  I  ++ A+++ PND + ++ + A   ++    + ++   KAL +KP   +
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVR 519

Query: 195 ALLRRASANESLGNFTD-AMFDLSVLSL 221
           A    A ++ ++G + + A + L+ LS+
Sbjct: 520 ARYNLAVSSINIGCYKEAAQYLLTALSM 547

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 63/153 (41%), Gaps = 6/153 (3%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
            PNSY    + + +     E    F+ A+  +PE+   +   G +    +  +N     +
Sbjct: 309 NPNSYEIGCILMENGAKLSEAALAFEAAVQENPEHVDAWLKLGLVQIQNEKEINGITALE 368

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNET-KLKFPTLPEVPTFFAEILTDKGD 494
           K   L+P N+     LA     +G    +  + N   + ++P L E  T   E+ +D+  
Sbjct: 369 KCLKLDPKNLEAMKNLAISYVNEGYDVSAFTMLNRWIETRYPHLLE-NTHGIELDSDQDR 427

Query: 495 Y---NTAIKQY-DIAKRLQEVQRKIHVGIGPLI 523
           Y       KQ+  +A +L+     + +G+G L 
Sbjct: 428 YVVNEIVTKQFLQVANKLETADADVQLGLGLLF 460

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 55/145 (37%), Gaps = 34/145 (23%)

Query: 398 SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGN------------- 444
           +F++KAI  D  +   YY  G     L +Y  A + F+KA+S+NP N             
Sbjct: 645 TFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEK 704

Query: 445 ------IYPYIQLAC---------------LLYKQGKFSESEKLFNETKLKFPTLPEVPT 483
                    Y +LAC               LLY   K++++   F E     P    V  
Sbjct: 705 LGNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQF 764

Query: 484 FFAEILTDKGDYNTAIKQYDIAKRL 508
              ++    G    AIK+Y IA  L
Sbjct: 765 ILGQLYQIMGRKKDAIKRYTIAMNL 789

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 87/223 (39%), Gaps = 20/223 (8%)

Query: 377 PNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQK 436
           P ++  +    + +++  E    F KA  LDP +   Y  +G  Y  +  Y  AK  ++K
Sbjct: 590 PETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRK 649

Query: 437 AQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYN 496
           A S +  +   Y  +     K G++ ++   F + +   P+   +       +   G+  
Sbjct: 650 AISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQE 709

Query: 497 TAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEAC 556
            A+  Y++A ++Q               +A +L   +          K+  A++   E  
Sbjct: 710 KALNYYELACQIQPTSSLAK------FKRAHLLYSMA----------KYTQALDAFEELI 753

Query: 557 DLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEK 599
            + P     +  L QL   M +  DAI+ +    T+A  +D K
Sbjct: 754 KIAPEEATVQFILGQLYQIMGRKKDAIKRY----TIAMNLDPK 792

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 124 YAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTT 183
           YA  L+  G+ + +  ++D A  +Y+ AI  D +    Y  M  C +  G+  + + Y  
Sbjct: 625 YAYTLQ--GHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFE 682

Query: 184 KALEIKPDHSKALLRRASANESLGNFTDAM 213
           KA  I P ++  +       E LGN   A+
Sbjct: 683 KARSINPSNAILICCCGVTMEKLGNQEKAL 712

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 35/73 (47%)

Query: 141 FDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRA 200
           ++ A+ Y++ A  ++P++ +            G+  K + Y   A +I+P  S A  +RA
Sbjct: 674 YEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKFKRA 733

Query: 201 SANESLGNFTDAM 213
               S+  +T A+
Sbjct: 734 HLLYSMAKYTQAL 746

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 35/82 (42%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN F   K+ D+AI+ +  A +LDPN    Y+     Y+S    +    +  KA+     
Sbjct: 597 GNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLH 656

Query: 192 HSKALLRRASANESLGNFTDAM 213
           H  A       +  LG +  A+
Sbjct: 657 HYNAYYGMGMCSMKLGEYEQAL 678

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           + Q+  +   K++++DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +
Sbjct: 286 DPQKALNLLLKSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSI 345

Query: 452 ACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGD-YNTAIKQYDIA 505
             L Y+  ++ ++   +       P       + +E+  D G  Y T  KQ + A
Sbjct: 346 GVLYYQISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDA 393

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 41/73 (56%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           + Q+  ++  K++++DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +
Sbjct: 285 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 452 ACLLYKQGKFSES 464
             L Y+  ++ ++
Sbjct: 345 GVLYYQISQYRDA 357

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 4/95 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPN----DPVFYSNMSACYISTGDLNK 177
            E A   K++GN  +  K F DA + Y   IE+  +    +   Y+N +AC +   +   
Sbjct: 75  HEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRS 134

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
            +     AL   P + K   R   A  ++  F  A
Sbjct: 135 CISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 51/98 (52%), Gaps = 4/98 (4%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           ++I+++Q A+ +DP+D   +  +   Y + G +   V+   KALE++P  + A   +A +
Sbjct: 698 ESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKALS 757

Query: 203 NESLGNFTDAMFDLSVLS----LNGDFDGASIEPMLER 236
              +G + D++  L  L+    L   +  + +E M+E 
Sbjct: 758 LSRMGLYNDSIEILKTLAAGNPLEESYQVSLVEIMVEH 795

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 52/121 (42%), Gaps = 7/121 (5%)

Query: 380 YIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQS 439
           Y  + +   +K++  E   +FQ A+ +DP    ++   GQ Y+       +   F+KA  
Sbjct: 683 YRVLGIANLEKQSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALE 742

Query: 440 LNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFP-------TLPEVPTFFAEILTDK 492
           + P + Y +   A  L + G +++S ++        P       +L E+    A +L  +
Sbjct: 743 VEPTSAYAHYFKALSLSRMGLYNDSIEILKTLAAGNPLEESYQVSLVEIMVEHANVLCSQ 802

Query: 493 G 493
           G
Sbjct: 803 G 803

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 400  FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
            F KA  L P  +  +Y    +     D   A+    K+Q++ P +  P++ LA    K+G
Sbjct: 986  FIKATALSPRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWLGLALASEKEG 1045

Query: 460  KFSESEKLF 468
               ES +LF
Sbjct: 1046 LVEESSRLF 1054

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 55/99 (55%), Gaps = 2/99 (2%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+ +++FD  I  ++ A+ + P+D   ++ + A   ++    + ++   +A+++KP   +
Sbjct: 427 FYANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVR 486

Query: 195 ALLRRASANESLGNFTDAMFD-LSVLSLNGDFDGASIEP 232
           A    A ++ ++G + +A    L+ LS++ + +G ++ P
Sbjct: 487 ARYNLAVSSMNIGCYREAAEHLLTALSMH-EVEGVAMAP 524

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 54/134 (40%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
           TP ++  +    +  ++  E    FQKA  LDP ++  Y  +G  Y     +  AK  ++
Sbjct: 413 TPQTWCCVGNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYR 472

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDY 495
           KA + N  +      L     K G++ ES   F +     P    +      +    G  
Sbjct: 473 KALATNSQHYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNVILICCCGVVFEKLGHQ 532

Query: 496 NTAIKQYDIAKRLQ 509
             A+K Y++A  LQ
Sbjct: 533 QDALKYYELACELQ 546

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 34/83 (40%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN F  +K+ D+AIK +Q A +LDP     Y+     Y S    +       KAL     
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 192 HSKALLRRASANESLGNFTDAMF 214
           H  A          LG + +++ 
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLL 503

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 74/182 (40%), Gaps = 23/182 (12%)

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           ++KA+  DP++   YY  G     L  Y  A + F+KA+S+NP N+   + + C      
Sbjct: 590 YRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICCCGGSLE 646

Query: 460 KFSESEKLFNETKLKF---PTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIH 516
           K    EK     +L     PT         ++L     Y+ A++ ++   +L       H
Sbjct: 647 KLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYSVALQTFEELVKLVPDDATAH 706

Query: 517 VGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQM 576
             +G       I+ R+               AI+ LT A +LDP+  Q  I   Q K  M
Sbjct: 707 YLLG---QTYRIVGRKKD-------------AIKELTVAMNLDPKGNQVIIDELQ-KCHM 749

Query: 577 EK 578
           ++
Sbjct: 750 QE 751

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GN     K+ D AIK ++ A +LDPN    Y+     + S    +       KAL   P 
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 192 HSKALLRRASANESLGNFTDAMF 214
           H  A     +++  LG + +A+ 
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALL 622

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 73/177 (41%), Gaps = 20/177 (11%)

Query: 418 GQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPT 477
           G+++F + +Y  +   F + + L P  +      + LL+      +S  L N      P 
Sbjct: 472 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 531

Query: 478 LPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATIL--ARQSTQ 535
            PE       +L+ + D++ AIK ++ A +L            P    A  L     S+ 
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 580

Query: 536 DPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATL 592
           D +   +  +  A+     AC  DP+   A  GL    +++ + ++A+  F+ + ++
Sbjct: 581 DSSDSAKTCYRKAL-----AC--DPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 46/77 (59%)

Query: 136 FTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKA 195
           +++ +FD  ++ +Q+A++++PND + ++ + A   ++    + ++   KA+ +KP   +A
Sbjct: 452 YSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRA 511

Query: 196 LLRRASANESLGNFTDA 212
               A A+ ++G + +A
Sbjct: 512 RYNLAVASMNIGCYQEA 528

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+++ ++D  +  ++ A+ + P+D + ++ + A   ++    + ++   KAL++KP   +
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 488

Query: 195 ALLRRASANESLGNFTDAM-FDLSVLSLN 222
           A    A +  ++G F +A  + L+ LS++
Sbjct: 489 ARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa]
           {ON} complement(185867..187786) [1920 nt, 640 aa]
          Length = 639

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%)

Query: 378 NSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKA 437
           +++  M     + +NSQ     +++A+D++P     +Y  GQ Y +L  ++ +   FQKA
Sbjct: 444 SAWTLMGHEFVELKNSQAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKA 503

Query: 438 QSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
            +L P +   +  LA    K G   +S K +
Sbjct: 504 CTLKPLDKRMWQALASCYAKVGNIRDSIKSY 534

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 75/175 (42%), Gaps = 22/175 (12%)

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           ++KAI  DP++   YY  G     L  Y  A + F+KA+ +NP N    I + C  +   
Sbjct: 578 YRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA---ILICCCGHSLE 634

Query: 460 KFSESEKLFNETKLKFPTLPE--VPTF-FAEILTDKGDYNTAIKQYDIAKRLQEVQRKIH 516
           K +  ++     +L     PE  +P +  A++L   G +++A+  ++   +L   +  +H
Sbjct: 635 KLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLSPEEVTVH 694

Query: 517 VGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQ 571
             +G +      + R+               AI+  T A +LDP   Q  I   Q
Sbjct: 695 FMLGQIY---QTMGRKKD-------------AIKEYTIALNLDPMGNQVIIDALQ 733

>Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]
           {ON} YHR166C (CDC23) - Cell division cycle protein
           [contig 160] FULL
          Length = 619

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 45/93 (48%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
             +++  M     + +NS      +++A+D++P     +Y  GQ Y +L  ++ +   FQ
Sbjct: 422 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 481

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
           K+ +L P +   +  LA    K G  +ES K +
Sbjct: 482 KSCALKPLDKRMWQALASCYEKVGNAAESIKCY 514

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 1/108 (0%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
           T +++  M     + +NS      +++A+D+DP     +Y  GQ Y +L  ++ +   FQ
Sbjct: 443 TTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYYFQ 502

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPT 483
           +A  L P +   +  L     K G  +E+ K + E  L+  T  E  T
Sbjct: 503 RACILKPLDKRMWQALGSCYAKVGNHAEAIKCY-ERALQLTTQSEQDT 549

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 92/225 (40%), Gaps = 33/225 (14%)

Query: 353 FQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLAD-KENSQEFFSFFQKAIDLDPEYS 411
           FQF   + +++Q+ L+ +I         IF  L   + + N  E+ + F+  + L P ++
Sbjct: 289 FQFENLENINSQSKLESNIPFK------IFQLLLFKEFQGNVDEYLTTFEDLLTLFPNFT 342

Query: 412 PTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNET 471
                +    +   DYVN++  F+K    +P  +      + +LY   K ++        
Sbjct: 343 FLQAQKALTSYQYMDYVNSEQIFEKIMEDDPYRLDDMDTFSNILYVMQKNAK-------- 394

Query: 472 KLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILAR 531
                 L  +  F ++I   + +    I  Y  A+  QE ++ I         +A  L +
Sbjct: 395 ------LAYLAQFVSQIDRFRPETCCVIANYYSAR--QEHEKSIMY-----FRRALTLDK 441

Query: 532 QSTQDPTQLDEE-----KFNMAIELLTEACDLDPRSEQAKIGLAQ 571
           ++T   T +  E       N AIE    A D+DPR  +A  GL Q
Sbjct: 442 KTTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQ 486

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE- 187
           K +GN  F    + +A+  Y   I   P +PV YSN +   I  G+  + ++   + L+ 
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQH 71

Query: 188 ----IKPDH 192
                 PDH
Sbjct: 72  ASTTTTPDH 80

>Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} similar
           to Ashbya gossypii AEL281C
          Length = 1398

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 82/194 (42%), Gaps = 13/194 (6%)

Query: 380 YIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQS 439
           Y  + +   +K+   E   +FQ A+ LD   +  +   GQ Y +      +   ++KA  
Sbjct: 671 YRVLGIFYLEKQQEAEAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALE 730

Query: 440 LNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPT----LPEVPTFFAEILTDKGDY 495
           LNP + +    LA  L + G+F +  +L +    ++P     L ++  F  +  TD  + 
Sbjct: 731 LNPKHKFARYLLAASLCQMGEFEKGIELLSVLNEEYPLEEIFLVQLSGFLVDYSTDLHNQ 790

Query: 496 NTAIKQYDIAKRLQEVQRKIHVGIGPLIGK-----ATILARQSTQDPTQLDEEKFNMAIE 550
              IK   I   L+ V R I V +  L  K      T+    S    TQ   EKF +   
Sbjct: 791 GYLIKS--IGTALKAV-RLIEVVVTKLNKKVSSVFVTLSKVLSLFMLTQSQFEKFPLESL 847

Query: 551 L-LTEACDLDPRSE 563
           L + EAC+L   S+
Sbjct: 848 LNILEACELKNTSK 861

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           +AI+++Q A+ LD  D   +  +   Y   G +   V    KALE+ P H  A    A++
Sbjct: 686 EAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALELNPKHKFARYLLAAS 745

Query: 203 NESLGNFTDAMFDLSVLS 220
              +G F   +  LSVL+
Sbjct: 746 LCQMGEFEKGIELLSVLN 763

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 41/73 (56%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           + Q+  +F  K+++++P  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +
Sbjct: 257 DPQKALNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 316

Query: 452 ACLLYKQGKFSES 464
             L Y+  ++ ++
Sbjct: 317 GVLYYQISQYRDA 329

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 367 LQESINLHPT-PNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQ 425
            + ++ L+ T  N++  M     + +NS      +++A+D++P     +Y  GQ Y +L 
Sbjct: 407 FRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLD 466

Query: 426 DYVNAKMDFQKAQSLNP 442
            ++ A    QKA SL P
Sbjct: 467 RHLYALYYLQKACSLKP 483

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} similar
            to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
            dsRNA virus protection family member contains 8 copies of
            the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 71/361 (19%), Positives = 149/361 (41%), Gaps = 39/361 (10%)

Query: 143  DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
            ++I+++Q A+ +D ND   +  +   Y + G L   ++   KA E+ PDH  A   +A +
Sbjct: 696  ESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDHLFAGYFKAIS 755

Query: 203  NESLGNFTDAM---------------FDLSVLSLNGDFD-------------GASIEPM- 233
               +G +   +               F +S++++  D+                +++ + 
Sbjct: 756  LAGIGEYEQCIEIIAALLEKLPNEESFQVSMVNILIDYSVELFSQGYLAKAVAQAVDSIK 815

Query: 234  -LERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSL---ASFFGIFDPDLEISRVSSISP 289
             +E  ++  + KV N  +S +   +   ++ S   +    S   IF+   E+    S+  
Sbjct: 816  RIEYIISNISHKVQNVWISLSKALKLFILVQSKVDMLPIESLVNIFEA-CELKNTDSVDT 874

Query: 290  PDTAH-DMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFC 348
             D  + + LL    +  ++ +  +L+ +A  + A+  Y ++    R   ++  N  +A  
Sbjct: 875  LDEINLENLLSDETQDNTSIATKFLVLSAKCSLASCEYENIPRTVR--ASLWYNLGIAEL 932

Query: 349  YKGIFQFLKNDLLDAQALLQESINLHP-TPNSYIFMALTLADKENSQEFFSFFQKAIDLD 407
            +  I    +N    A    ++SI L   T  ++I + ++  D  N +     F KAI L 
Sbjct: 933  FTYITLKAENYRDAAIICYKQSIKLQSNTTEAWIGLGISCMDV-NYRVAQHCFIKAIALA 991

Query: 408  PEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKL 467
            P+    +Y    +     D   A+    K+QS+ P +  P+  +A     +    ES K+
Sbjct: 992  PKEIGIWYDLAILALKNGDIEFARDVLMKSQSIAPQDSSPWFGMALAHEHENNLEESSKM 1051

Query: 468  F 468
            F
Sbjct: 1052 F 1052

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%)

Query: 131 KGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKP 190
           +G   F ++ +  A+K Y   I+ +P  PV + N +A +       +V++   KA+ + P
Sbjct: 435 EGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDP 494

Query: 191 DHSKALLRRASA 202
            + KA +R+  A
Sbjct: 495 SYIKAYVRKGFA 506

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAI-ELDPNDPVFYSNMSACYISTGDLNKVVEYTTKA 185
           +LK+ GN  +  K ++ A+ Y+  A+ +   N  + YSN +A +I      + +E     
Sbjct: 10  ELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNC 69

Query: 186 LEIKPDHSKALLRRASA-------NESLGNFTDAM 213
           +E+ P+  K   R   A       +E+  NF  A+
Sbjct: 70  VELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKAL 104

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 403 AIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQ 458
            ++L P +   Y   G  Y  LQ    A+ +F+KA  LN  N++   +LA + Y Q
Sbjct: 69  CVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNVHAKKELAYVKYLQ 124

>Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}
           similar to Ashbya gossypii ABR206W
          Length = 626

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
             N++  M     + +NS      +++A+D++P     +Y  GQ Y +L  ++ A    Q
Sbjct: 429 CTNAWTLMGHEFVETKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQ 488

Query: 436 KAQSLNP 442
           KA SL P
Sbjct: 489 KACSLKP 495

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
            N+F   +  + AI Y++ A+ L+ +    ++ M   ++ T + +  +E   +A++I P 
Sbjct: 403 ANYFSAKQQHEKAIMYFRRALTLNKSCTNAWTLMGHEFVETKNSHAAIECYRRAVDINPC 462

Query: 192 HSKALLRRASANESLGNFTDAMFDL 216
             KA      A E L     A++ L
Sbjct: 463 DFKAWYGLGQAYEVLDRHLYALYYL 487

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 4/95 (4%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP----VFYSNMSACYISTGDLNK 177
            E A   K++GN  + +K + DA + Y   I++  +D       +SN +AC +   +  +
Sbjct: 75  HEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRR 134

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDA 212
            V    +AL+    + K   R A A   L    DA
Sbjct: 135 CVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 94/244 (38%), Gaps = 24/244 (9%)

Query: 339 IRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPT-PNSYIFMALTLADKENSQEFF 397
           I  N    +C  G    L+ D   A    +++  L P    +Y       +  ++S    
Sbjct: 546 IMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAK 605

Query: 398 SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYK 457
           + ++KA+  D ++   YY  G     L  Y  A + F+KA+S+NP N+   + + C    
Sbjct: 606 TCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNV---VLICCCGGS 662

Query: 458 QGKFSESEKLFNETKLKF---PTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRK 514
             K    EK     +L     PT         ++L     YN A++ ++   +L      
Sbjct: 663 LEKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 722

Query: 515 IHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKL 574
            H  +G       I+ R+               AI+ LT A +LDP+  Q  I   Q K 
Sbjct: 723 AHYLLG---QTYRIVGRKKD-------------AIKELTVAMNLDPKGNQVVIDELQ-KC 765

Query: 575 QMEK 578
            M++
Sbjct: 766 HMQE 769

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 47/82 (57%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+ + +F+  I  ++ A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 456 FYANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVR 515

Query: 195 ALLRRASANESLGNFTDAMFDL 216
           A    A ++ ++G + +A+  L
Sbjct: 516 ARYNLAVSSMNIGCYKEAVEHL 537

>NDAI0J00710 Chr10 (150941..151948) [1008 bp, 335 aa] {ON} Anc_7.458
           YJR088C
          Length = 335

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 406 LDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           LDPE   T++  G++YF L+DY  AK  F++   + P N   + +L+ +LY Q 
Sbjct: 174 LDPE---TWWFMGEVYFQLKDYHKAKYCFEEILIIMPFNYEAFARLSEVLYYQA 224

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+   +  K+++ DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 283 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 342

Query: 454 LLYKQGKFSES 464
           L Y+  ++ ++
Sbjct: 343 LYYQISQYRDA 353

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 77/189 (40%), Gaps = 24/189 (12%)

Query: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
           F KA +LDP ++  Y  +G  Y   + +  A+  ++KA + +  +   Y  L     + G
Sbjct: 517 FNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNG 576

Query: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQ-----EVQRK 514
               S   F + ++  P    +       L    +Y  A+K YD A +LQ        RK
Sbjct: 577 NHDRSLLFFEKARMINPVNIVLICCCGVELEKVRNYELALKYYDFASKLQPNSALAKYRK 636

Query: 515 IHVGIGPLIGKATILARQSTQDPTQLDEEKFNM----------------AIELLTEACDL 558
             +     +G+ + LA +  +D  +LD E  N+                A++  T A +L
Sbjct: 637 AELLFS--LGRYS-LAVELFEDLIKLDSENPNLHYMLGKIYQTMGRKKDAVKEYTVAMNL 693

Query: 559 DPRSEQAKI 567
           DP+  Q  I
Sbjct: 694 DPKGNQYII 702

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 32/77 (41%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           GNHF   K+ D+AIK +  A ELDP     Y+     Y S    +    +  KAL     
Sbjct: 501 GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQ 560

Query: 192 HSKALLRRASANESLGN 208
           H  A     + +   GN
Sbjct: 561 HYNAYYGLGTCDSQNGN 577

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+   +  K+++ DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 279 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 338

Query: 454 LLYKQGKFSES 464
           L Y+  ++ ++
Sbjct: 339 LYYQISQYRDA 349

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 57/149 (38%), Gaps = 9/149 (6%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G       ++  A   +Q A+  D  +P+F+ ++   Y         ++  T+A+ + P 
Sbjct: 303 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 362

Query: 192 HSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNANLS 251
            S+      +  E+  N      D    +   D +   I   LE  L KQ       N++
Sbjct: 363 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEA-LTKQLENP--GNIN 419

Query: 252 KNSGDRGSEILPSNTSLASFFGIFDPDLE 280
           K++G       P+N S A    I  P L+
Sbjct: 420 KSNG------APTNASPAPPPVILQPTLQ 442

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+   +  K+++ DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 281 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 340

Query: 454 LLYKQGKFSES 464
           L Y+  ++ ++
Sbjct: 341 LYYQISQYRDA 351

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
             +++  M     + +NS      +++A+D++P     +Y  GQ Y +L  ++ +   FQ
Sbjct: 431 CTSAWTLMGHEFVELKNSHAAIESYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 490

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
           KA +L P +   +  LA    K  K  ES K +
Sbjct: 491 KACALKPLDKRMWQALASCYEKLSKKDESIKCY 523

>TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.72
           YHR166C
          Length = 622

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 43/93 (46%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
             N++  M     +  NS      +++A+D++ +    +Y  GQ Y +L  ++ +   FQ
Sbjct: 425 CTNAWTLMGHEFVELRNSHAAIECYRRAVDMNTKDFKAWYGLGQAYEVLDMHLYSLYYFQ 484

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
           KA +L P +   +  LA    K G   E+ K +
Sbjct: 485 KACTLKPLDKRMWQALASCYAKVGNRQEAIKCY 517

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+++ ++D  +  ++ A+ + P+D + ++ + A   ++    + ++   KAL++KP   +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 195 ALLRRASANESLGNFTDAM-FDLSVLSLN 222
           A    A +  ++G + +A  + L+ LS++
Sbjct: 496 ARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 3/125 (2%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+   +  K++++D + + T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 294 QKALGYLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 353

Query: 454 LLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEIL-TDKGDYNTAIKQYDIAKRLQEVQ 512
           L Y+  ++ ++   +       P + EV      +  T     N A+  Y  A RL    
Sbjct: 354 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDP-- 411

Query: 513 RKIHV 517
             IH+
Sbjct: 412 ENIHI 416

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 37.7 bits (86), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+   +  K+++ DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +  
Sbjct: 273 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 332

Query: 454 LLYKQGKFSES 464
           L Y+  ++ ++
Sbjct: 333 LYYQISQYRDA 343

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 46/90 (51%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           N ++  ++  +++++D E S T+YH G+++ I  DY  A   FQ+A + +  N   +  +
Sbjct: 267 NPEKALNYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSI 326

Query: 452 ACLLYKQGKFSESEKLFNETKLKFPTLPEV 481
             L Y+  ++ ++   +       P + EV
Sbjct: 327 GVLYYQIYQYRDALDAYTRAIRLNPYISEV 356

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/78 (20%), Positives = 41/78 (52%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+ +  FD  I  ++ A+ + PND   ++ + A   ++    + ++   +A+++KP   +
Sbjct: 431 FYANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVR 490

Query: 195 ALLRRASANESLGNFTDA 212
           A    A ++ ++G + +A
Sbjct: 491 ARYNLAVSSMNIGCYKEA 508

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 83/206 (40%), Gaps = 47/206 (22%)

Query: 344 ALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKE--NSQEFFS--- 398
            + +C  G    L  D  +A   L+++ +L+P        A TL   E  N+  F +   
Sbjct: 438 CITWCCLGNLFSLNRDHDEAIKALKKATSLNPQ----FAYAYTLQGHEYSNNDAFDNAKM 493

Query: 399 FFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNI------------- 445
            ++KA+ ++P +   +Y  G     L  Y  A + F+KA+S+NP N+             
Sbjct: 494 CYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERL 553

Query: 446 ------YPYIQLAC---------------LLYKQGKFSESEKLFNETKLKFPTLPEVPTF 484
                   + QLAC               LL+  G++S +  L N  KL+  T  E P  
Sbjct: 554 GRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNA--LQNFEKLEQLTPNEAPVH 611

Query: 485 F--AEILTDKGDYNTAIKQYDIAKRL 508
           F   ++    G    AI Q+ IA  L
Sbjct: 612 FLLGQLYQIVGRKKDAITQFTIAMNL 637

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%)

Query: 395 EFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACL 454
           E     +KA  L+P+++  Y  +G  Y     + NAKM ++KA ++NP +   +  L   
Sbjct: 456 EAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMS 515

Query: 455 LYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQ 509
             K G++ E+   F + +   P    +       L   G    A+  Y +A  LQ
Sbjct: 516 CIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQ 570

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE- 187
           K+ GN  F    + +A+  Y   I   P +PV YSN +   I   +    ++   + L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 188 -IKPDHS 193
            + P+H+
Sbjct: 72  ALGPEHA 78

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+ ++++D  I  ++ A+ + P+D + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 432 FYANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 491

Query: 195 ALLRRASANESLGNFTDAM-FDLSVLSLN 222
           A    A ++ ++G + +A  + L+ LS++
Sbjct: 492 ARYNLAVSSMNIGCYKEAAEYLLTALSMH 520

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 52/101 (51%), Gaps = 2/101 (1%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+    FD  I  ++ A+ ++ ND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 436 FYVDDQFDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVR 495

Query: 195 ALLRRASANESLGNFTDAMFD-LSVLSLNGDFDGASIEPML 234
           A    A ++ ++G + +A    L+ LS++ +  G +  P +
Sbjct: 496 ARYNLAVSSINIGCYKEAAEHLLTALSMH-EVSGGATNPSM 535

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 8/110 (7%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND----PVFYSNMSACYISTGDLNK 177
            E A   K +GN  +  K + +A   Y+  IE++ N+     + + N +AC +   +   
Sbjct: 71  HEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRS 130

Query: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDAM----FDLSVLSLNG 223
            +    KAL   P + K   R A A  ++  + ++     F L V S N 
Sbjct: 131 CINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNS 180

>Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
           T N++  M     +  NS      +++A+D+ P     ++  GQ Y +L  ++ +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 436 KAQSLNPGN 444
           KA +L P +
Sbjct: 490 KACTLKPWD 498

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 53/116 (45%), Gaps = 1/116 (0%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q+  +   K++++D   + ++YH G+++ I  DY +A   FQ+A + +  N   +  +  
Sbjct: 341 QKALNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGV 400

Query: 454 LLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEIL-TDKGDYNTAIKQYDIAKRL 508
           L Y+  ++ ++   +       P + EV      +  T     N A+  Y  A RL
Sbjct: 401 LYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQVNDALDAYKQAARL 456

>Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
           T N++  M     +  NS      +++A+D+ P     ++  GQ Y +L  ++ +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 436 KAQSLNPGN 444
           KA +L P +
Sbjct: 490 KACTLKPWD 498

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 48/126 (38%), Gaps = 9/126 (7%)

Query: 106 GEPDMAQLRGLPL-SQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPV---- 160
           G  ++  L+ L    +  E A   K++GN  +  K + DA   Y   IE+   D      
Sbjct: 59  GNVELEALKALAYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGS 118

Query: 161 FYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDA----MFDL 216
            Y N +AC +   +    +    KAL       KA  R   A   L    +A    +F L
Sbjct: 119 LYLNRAACELELRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSVLFGL 178

Query: 217 SVLSLN 222
            + S N
Sbjct: 179 KLDSQN 184

>Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
           T N++  M     +  NS      +++A+D+ P     ++  GQ Y +L  ++ +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 436 KAQSLNPGN 444
           KA +L P +
Sbjct: 490 KACTLKPWD 498

>YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}
           CDC23Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 626

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
           T N++  M     +  NS      +++A+D+ P     ++  GQ Y +L  ++ +   FQ
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNET 471
           KA +L P +   +  L     K G   E+ K +  +
Sbjct: 490 KACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRS 525

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 82/195 (42%), Gaps = 19/195 (9%)

Query: 140 NFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRR 199
           N    + Y   ++   P       N++AC+    DL + + Y+ K ++++P + K  +RR
Sbjct: 48  NVGAVVSYNDKSLTHHPRYIKLLDNLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRR 107

Query: 200 ASANESLGNFTDAM--FDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDR 257
               + LG   +A   + L + +    ++  +I+        K+ +++++A  +K     
Sbjct: 108 GKVLQKLGKDKEAYDNYRLGLRNAKEAYEKFNIDA------PKKFIELVSAQKAKAKLRL 161

Query: 258 GSEILPSNTSLASFFGIFDPDLEISRVSSISPP----------DTAHDMLLEALQRLYSA 307
            S++  S  S      I DP  E +R++S+  P          D    + LE L ++   
Sbjct: 162 QSQVPASKVSFEK-RTIIDPLEEQARLASVKKPRSSVAAMHHIDFIGQLPLELLPKVLQG 220

Query: 308 TSEGYLIANALFTKA 322
            S G LI  +   K 
Sbjct: 221 FSPGELITISFVNKT 235

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%)

Query: 378 NSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKA 437
           +++I M     + +NS      +++A D++P     +Y  GQ Y +L  +  A   FQKA
Sbjct: 438 HAWILMGHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKA 497

Query: 438 QSLNP 442
            +L P
Sbjct: 498 CALKP 502

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 548 AIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAE 607
           AIE    A D++PR  QA  GL Q    ++K   A+  FQ +  L + +D+++   + + 
Sbjct: 456 AIECYRRASDVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKACAL-KPLDKRMWFASASC 514

Query: 608 AAKIQKRLRA 617
             K+ K ++A
Sbjct: 515 YEKLDKTVQA 524

>KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar to
           uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 621

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 43/93 (46%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
             +++  M     + +NS      +++A+D++P     +Y  GQ Y +L  ++ +   FQ
Sbjct: 424 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQ 483

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
           K+ +L P +   +  LA    K     ES K +
Sbjct: 484 KSCALKPLDKRMWQALASCYEKVDNLEESIKCY 516

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 69/174 (39%), Gaps = 36/174 (20%)

Query: 116 LPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP----VFYSNMSACYIS 171
           L +S  +EY    KD+G  FF + ++  A + Y+ ++   P +     V YSN++A    
Sbjct: 268 LEISGYKEY----KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFK 323

Query: 172 TGDLNKVVEYTTKALEIKPD---------------------HSKALLRRASANESLGNFT 210
            G+  + +     ALE+ P                        K + RRA A E + N+ 
Sbjct: 324 VGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYE 383

Query: 211 DAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSK-NSGDRGSEILP 263
            A+ D   L    +F+   +         ++  KVLN    K  S +R    +P
Sbjct: 384 RALQDYQSLIEKNNFNDKIM------GGKRRCQKVLNPTEPKATSPNRSPTPVP 431

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 414 YYHRGQMYFILQDYVNAKMDFQKAQSLNPGN----IYPYIQLACLLYKQGKFSESEKLFN 469
           Y  RG  +F   DYV+A  +++K+ +  P N    I  Y  L   L+K G++   ++  +
Sbjct: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEY---KRCLS 332

Query: 470 ETKLKFPTLPEVPTFFAEILTD 491
           + +      P+ P  + E + D
Sbjct: 333 DIESALEMFPKDPNLWDEPIQD 354

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAI----ELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           + KD+G  +F   ++  A + Y+ ++    +L P   +  SN+ A  + TGD   ++  +
Sbjct: 399 EFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIS 458

Query: 183 TKALEIKPDHSK 194
           T AL++ P  SK
Sbjct: 459 TSALDLFPKESK 470

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%)

Query: 378 NSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKA 437
           +++  M     + +NS      +++A+D++P     +Y  GQ Y +L  ++ +   FQKA
Sbjct: 488 SAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKA 547

Query: 438 QSLNP 442
            +L P
Sbjct: 548 CALKP 552

>NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72
          Length = 631

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 375 PTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDF 434
              +++  M     + +NS      +++A+D++      +Y  GQ Y +L  ++ +   F
Sbjct: 434 KCTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWYGLGQAYEVLDMHLYSLYYF 493

Query: 435 QKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
           QKA +L P +   +  L     K G  +E+ K F
Sbjct: 494 QKACTLKPLDRRMWQALGTCYTKIGNKTEAIKCF 527

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 42/78 (53%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSK 194
           F+++  FD  I  ++ A+ + P D + ++ + A   ++    + ++   KAL++KP   +
Sbjct: 441 FYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVR 500

Query: 195 ALLRRASANESLGNFTDA 212
           A    A ++ ++G + +A
Sbjct: 501 ARYNLAVSSINIGCYKEA 518

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 19/99 (19%)

Query: 135 FFTSKNFDDAIKYYQHAIELDPNDPVFYSN----MSACYISTGDLNKVVEYTTKALEIKP 190
            F  KNF  ++K +Q   EL  N+PV   +    + AC+    D    +    ++LE+ P
Sbjct: 207 LFRKKNFMASLKLFQ---ELLVNNPVLKPDPRIGIGACFWQLKDYKMAINAWERSLELDP 263

Query: 191 DHS------------KALLRRASANESLGNFTDAMFDLS 217
            +             K L+   + +E   NF DAM DLS
Sbjct: 264 TNKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166C CDC23 Subunit of the anaphase-promoting
           complex/cyclosome (APC/C) which is a ubiquitin-protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 628

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 43/93 (46%)

Query: 376 TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQ 435
             +++  M     + +NS      +++A+D++      +Y  GQ Y +L  ++ +   FQ
Sbjct: 431 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINARDFKAWYGLGQAYEVLDMHLYSLYYFQ 490

Query: 436 KAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
           KA +L P +   +  LA    K G   E+ K +
Sbjct: 491 KACTLKPLDRRMWQALAACYAKVGNRQEAIKCY 523

>Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa]
           {ON} YGR047C (TFC4) - transcription factor tau (TFIIIC)
           subunit 131 [contig 117] FULL
          Length = 1052

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 380 YIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHR--GQMYFILQDYVNAKMDFQKA 437
           Y  +A  LA  E  QE   FF   +DL+ EY      R   + Y  ++DY NAK+ F K 
Sbjct: 492 YFEVATALAKAERYQEAIEFFTPLLDLN-EYCTLEVFRMLSKCYKEVEDYENAKIIFGKL 550

Query: 438 QSLNPGNIYPYIQLACLLYKQG 459
             + P ++   + LA + Y  G
Sbjct: 551 VEMTPEDLETKLTLAEIYYHLG 572

>Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR283C
            (GCN2) - eukaryotic initiation factor 2 alpha
            (eIF2-alpha) kinase [contig 11] FULL
          Length = 1689

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 66/151 (43%), Gaps = 7/151 (4%)

Query: 486  AEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQD-PTQLDEEK 544
             E+LT  G+YN  I  Y +     E+    + G+  +     I  R S  D P+  D  K
Sbjct: 921  TEVLTGSGNYNEKIDMYSLGIIFFEMVYSFNTGMERVNDIKKI--RTSAIDFPSDFDSSK 978

Query: 545  FNMAIELLTEACDLDP-RSEQAKIGLAQLKLQMEKIDDAI-ELFQDSATLARTMDEKLQA 602
              +  +++T+  D DP R   AK  L    L ++  DD I E  ++ A  A    ++++ 
Sbjct: 979  LAVEKKIITQLLDHDPNRRPNAKTLLRSGLLPVKHQDDVIKEALRNLADPASPWQQQVKE 1038

Query: 603  TTFAEAAKIQKRLRAD--PIISAKMEQTLAS 631
            + FA+   +   +  D   + S+   Q L S
Sbjct: 1039 SLFAQPYSVTNDILFDNQKVYSSPFNQLLKS 1069

>Suva_9.202 Chr9 (332519..334621) [2103 bp, 700 aa] {ON} YIL005W
           (REAL)
          Length = 700

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 73/164 (44%), Gaps = 14/164 (8%)

Query: 462 SESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAI-KQYDIA--KRLQEVQRKIHVG 518
           SE++K+FNE      T+ ++PTFF   +   GD+ + +   Y     + + E+ + +   
Sbjct: 387 SEAQKIFNEEYFTMNTVTQLPTFF---MFKDGDFVSHVYPGYSTTEMRNINEIMKWVQKY 443

Query: 519 IGPLIGKATILARQSTQDPTQLDEEKF-NMAIELLTEACDLDPRSEQA---KIGLAQLKL 574
             PL   AT +   + ++      E + N+AI+L++   D   +       K+ LA    
Sbjct: 444 SNPL---ATEITSSNLREWMSFQTESYSNLAIQLVSTGSDKQIKGSNTLIRKLLLATFDY 500

Query: 575 QMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRAD 618
           +  ++++  E   D  T  +    KL     A A K+  ++R +
Sbjct: 501 EHVRMENNFEQINDKRT-KKAASIKLLKEKKAPADKVVDKMREE 543

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 41/82 (50%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G ++   +   ++I+++Q A+ +D +D   +  +   Y + G +   ++   +ALE+ P+
Sbjct: 667 GVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPE 726

Query: 192 HSKALLRRASANESLGNFTDAM 213
           H  A L  A +   L  F  ++
Sbjct: 727 HKYAGLFLAISLCQLSEFEKSL 748

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 164 NMSACYISTGDLNKVVEYTTKALEIKPDHSKALLR 198
           NMSA Y   GDL K + Y TK +E+ P + K  +R
Sbjct: 78  NMSATYEKLGDLKKALSYATKMVEVDPYNLKCYIR 112

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 74/177 (41%), Gaps = 35/177 (19%)

Query: 113 LRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP----VFYSNMSAC 168
           +  + LS   EY      +G+ FF + ++  A++ Y+ ++   P       + YSN++A 
Sbjct: 349 ISSIELSGYNEY----NSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAA 404

Query: 169 YISTGDLNKVVEYTTKALEIKPDH---------------------SKALLRRASANESLG 207
            +  G+ + +V+   KAL++ P                       SK +LR+A A E L 
Sbjct: 405 ELKIGEYSNLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLE 464

Query: 208 NFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPS 264
           NF  A      L  N  F    ++        ++  KVLN  ++K +  + S   P+
Sbjct: 465 NFELAYKQYHSLIENNVFSDKIMDG------KRRCQKVLNPEIAKKTQQKPSSSKPA 515

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%)

Query: 405 DLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSES 464
           ++DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +  L Y+  ++ ++
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 465 EKLFNETKLKFPTLPEV 481
              +       P + EV
Sbjct: 367 LDAYTRAIRLNPYISEV 383

>NDAI0C00160 Chr3 complement(21850..24186) [2337 bp, 778 aa] {ON}
           Anc_2.665 YKL022C
          Length = 778

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 110 MAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACY 169
           +  LR   ++ +  +++Q+     +    +N + AIK ++  +E   +D   Y ++   Y
Sbjct: 619 LESLRASNMTSKMAFSIQMNLAHTYRKLGEN-ERAIKCFKAVLEESGHDADIYCSLGFLY 677

Query: 170 ISTGDLNKVVEYTTKALEIKPDHSKA 195
           + T  L K V+Y   +L +KP ++ A
Sbjct: 678 LKTNQLEKAVDYLHNSLSLKPTNNSA 703

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 38/73 (52%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           N+Q   +   K++++D   + T+YH G+++ +  DY  A   FQ A + +  N   +  +
Sbjct: 297 NTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 356

Query: 452 ACLLYKQGKFSES 464
             L Y+  ++ ++
Sbjct: 357 GVLYYQISQYRDA 369

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G       ++  A   +QHA+  D  +P F+ ++   Y         ++  T+A+ + P 
Sbjct: 323 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 382

Query: 192 HSKALLRRASANESLGN-FTDAM 213
            S+      +  E+  N  TDA+
Sbjct: 383 ISEVWYDLGTLYETCNNQLTDAL 405

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%)

Query: 377 PNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQK 436
           P ++  M    +  ++  E  + F KAI LDP ++  Y  +G  Y     + NAK  F+K
Sbjct: 492 PIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRK 551

Query: 437 AQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETK 472
           A ++   +      L     K GKF E+   F + +
Sbjct: 552 ALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKAR 587

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 35/71 (49%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           ++++++  A+ +DPND   +  +   Y + G +    +   KA+EI P H  A    + +
Sbjct: 703 ESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEIDPLHLYAQYFNSLS 762

Query: 203 NESLGNFTDAM 213
              +G F + +
Sbjct: 763 LAEMGCFEECI 773

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 46/104 (44%), Gaps = 1/104 (0%)

Query: 371 INLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNA 430
           + L  T   Y  + +   +++   E   +F  A+ +DP    ++   GQ YF       +
Sbjct: 679 MELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGRVEAS 738

Query: 431 KMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSES-EKLFNETKL 473
              F+KA  ++P ++Y     +  L + G F E  E L N T+L
Sbjct: 739 TKVFEKAIEIDPLHLYAQYFNSLSLAEMGCFEECIEILKNITQL 782

>ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 42/78 (53%)

Query: 143 DAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASA 202
           ++I+++Q A+ ++ +D   +  +   Y + G +   ++   KA+E+  +H  A   +A +
Sbjct: 685 NSIEWFQSALRVNQSDVEAWVGLGQAYYACGRIEASIKVFEKAIELDSEHHYAKYLKAQS 744

Query: 203 NESLGNFTDAMFDLSVLS 220
              +G F +A+  L+ L+
Sbjct: 745 LSLMGQFDEAIDILNALT 762

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 67/160 (41%), Gaps = 10/160 (6%)

Query: 313  LIANALFTKATDAYHSLLSASRVDGAIR-GNAALAFCYKGIFQFLKNDLL--DAQALLQE 369
            LI +A +  AT  Y +L    R       G + L+      +  LKND     A A  ++
Sbjct: 890  LILSAKYAVATTTYEALTRTVRSSLWYNIGTSELS-----AYHILKNDKFRDSAIASFKK 944

Query: 370  SINLHP-TPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYV 428
            SI     T  S++ + +   D  N +     F K   + P+    ++    +     D  
Sbjct: 945  SIQYQSNTVESWMGLGIATMDV-NYRVAQHCFIKCTAMAPKEGSVWFDLALLALQNNDAE 1003

Query: 429  NAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLF 468
             A     K+QS+ P +  P++  A +L KQGK  ES ++F
Sbjct: 1004 FALTVLNKSQSIAPQDSSPWLGNALILEKQGKIKESCRMF 1043

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           N Q+  S   K+++ DP  + T+YH G+++ I  DY  A   FQ+A + +  N   +  +
Sbjct: 266 NPQKALSLLLKSLEFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSI 325

Query: 452 ACLLYKQGKF 461
             L Y+  ++
Sbjct: 326 GVLYYQISQY 335

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 51/116 (43%), Gaps = 1/116 (0%)

Query: 394 QEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLAC 453
           Q   +   K++++D   + T+YH G+++ +  DY  A   FQ+A + +  N   +  +  
Sbjct: 361 QTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGV 420

Query: 454 LLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEIL-TDKGDYNTAIKQYDIAKRL 508
           L Y+  ++ ++   +       P + EV      +  T     N A+  Y  A RL
Sbjct: 421 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARL 476

>ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON}
           similar to uniprot|P25298 Saccharomyces cerevisiae
           YMR061W RNA14 Cleavage and polyadenylation factor I (CF
           I) component involved in cleavage and polyadenylation of
           mRNA 3' ends bridges interaction between Rna15p and
           Hrp1p in the CF I complex
          Length = 652

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 426 DYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPEVPTF 484
           D VN     ++   LNP +I PY++L      +  F ES +++N    KFPT   + T 
Sbjct: 27  DIVNG---IRRKIELNPADILPYLELVQYYESKDSFQESREVYNSLHDKFPTYSPLWTL 82

>TPHA0B04430 Chr2 (1036315..1039527) [3213 bp, 1070 aa] {ON}
           Anc_1.88 YGR047C
          Length = 1070

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 13/139 (9%)

Query: 351 GIFQFLKNDLLDA----QALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDL 406
           G+F+   + LL+A    Q L  ES       + Y  +A+TL   E  +E   FF   + L
Sbjct: 468 GLFRLHNDQLLEAMSHFQLLYDESFT--EVADLYFEVAITLTKNEKYKEAIDFFLPLLTL 525

Query: 407 DPEYSPTYYHR--GQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSES 464
           + +Y+     R  G+ Y   +DY NA++ ++K    N  ++   + LA + Y+ G   E 
Sbjct: 526 E-DYNNIELFRPIGKCYKETEDYANARIYYEKVIKSNLCDLDDKVALAEINYQLGNMDE- 583

Query: 465 EKLFNETKLKFPTLPEVPT 483
              FN   L+   L +  T
Sbjct: 584 ---FNNILLEVVELRKKET 599

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 43/90 (47%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           ++Q   +   K++++D   + T+YH G+++ +  DY  A   FQ A + +  N   +  +
Sbjct: 293 DTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 352

Query: 452 ACLLYKQGKFSESEKLFNETKLKFPTLPEV 481
             L Y+  ++ ++   +       P + EV
Sbjct: 353 GVLYYQISQYRDALDAYTRAIRLNPYISEV 382

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G       ++  A   +QHA+  D  +P F+ ++   Y         ++  T+A+ + P 
Sbjct: 319 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 192 HSKALLRRASANESLGN-FTDAM 213
            S+      +  E+  N  TDA+
Sbjct: 379 ISEVWYDLGTLYETCNNQLTDAL 401

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
            Anc_7.546 YPR189W
          Length = 1430

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%)

Query: 400  FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459
            F K+I L P+ +  +++   +    +D   A+    + QS+ P    P++ +A LL K+G
Sbjct: 1004 FIKSIALSPKDTEVWFNLSLLALKAKDLDFARQVLARTQSIAPQESSPWLGMALLLEKEG 1063

Query: 460  KFSESEKLFN 469
               ES  +F+
Sbjct: 1064 NTQESINMFS 1073

>Kpol_1028.101 s1028 complement(221597..222760) [1164 bp, 387 aa]
           {ON} complement(221597..222760) [1164 nt, 388 aa]
          Length = 387

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 118 LSQRQEYAVQLKDKGNHFFTSKNFD-DAIKYYQHAIELDPNDPVFYSNMSAC 168
           LS+   + + L+ K N + TS+N++ + IK Y       P +P  Y+N   C
Sbjct: 29  LSRTVSHEITLETKKNKYMTSRNYNPNLIKLYTVTKSFTPTEPFMYTNNRMC 80

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 49/122 (40%), Gaps = 25/122 (20%)

Query: 127 QLKDKGNHFFTSKNFDDAIKYYQHAI----ELDPNDPVFYSNMSACYISTGDLNKVVEYT 182
           + + KG   F   ++  A+  Y+ ++    E  P   +  SNM   Y+  G+  K ++  
Sbjct: 292 EFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLA 351

Query: 183 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAMFDLSVLSL 221
             ALE+ P+                      SK ++R A A E   N+T A  +  +L  
Sbjct: 352 PLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVA 411

Query: 222 NG 223
           NG
Sbjct: 412 NG 413

>SAKL0C02816g Chr3 complement(264072..267428) [3357 bp, 1118 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1118

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 44/101 (43%), Gaps = 1/101 (0%)

Query: 372 NLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYH-RGQMYFILQDYVNA 430
           N     + Y  +A+ L   E  QE   FF   ++LD       Y    + Y  ++DY  A
Sbjct: 530 NFADITDLYFEVAVALTKAEKYQEAIEFFTPLLELDDYRGLELYKPLSKCYKEVEDYPRA 589

Query: 431 KMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNET 471
           ++ ++K  +L+P N+   + LA + Y  G      +L  E 
Sbjct: 590 RVIYEKLVALSPANLETKLTLAEIHYHLGDHETFNRLLLEV 630

>TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1059

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 64/145 (44%), Gaps = 28/145 (19%)

Query: 380 YIFM-ALTLADKENSQEFFSFFQKAIDLDPEYSPT-YYHRGQMYFILQDYVNAKMDFQKA 437
           ++F+ A  L  K+N       FQ+ + ++P   P      G  ++ L+DY  A   +++A
Sbjct: 185 FLFLRAKLLYQKKNYAASLRSFQELLVINPVIQPDPRIGIGLCFWQLKDYKIAIASWKRA 244

Query: 438 QSLNPGNIYPYIQLACLLYKQGKF------SESEKLFNETKLKFPTLPEVPTFFAE---- 487
             LNP N     Q A +L   G F      SE++ +F ET  K   L  +   F+E    
Sbjct: 245 HELNPNN-----QSAAILVLLGDFHESLVTSENDTVFQETYSK--VLQNLNGLFSEDREN 297

Query: 488 --ILT-------DKGDYNTAIKQYD 503
             +LT        KGDYN  I  Y+
Sbjct: 298 PVLLTLLEVYFYLKGDYNKVIDIYE 322

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (44%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALE 187
           G  +     F  A +Y+  A +  P DP+  + M   Y    DL+K   Y  +ALE
Sbjct: 572 GMQYMALNTFSLAEEYFTLAYDTCPQDPLLLNEMGVMYFKRNDLHKAKRYLKRALE 627

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 3/98 (3%)

Query: 391 ENSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQ 450
           E  +E   +F K+  LDP ++P +      Y I  +   A   +  A    PG   P + 
Sbjct: 511 EKIEEARKYFSKSSILDPNFAPAWLGFAHTYAIEGEQDQAISAYSTAARFFPGIHLPNLF 570

Query: 451 LACLLYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEI 488
           L         FS +E+ F    L + T P+ P    E+
Sbjct: 571 LGMQYMALNTFSLAEEYFT---LAYDTCPQDPLLLNEM 605

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 10/104 (9%)

Query: 351 GIFQFLKNDLLDAQALLQESIN----LHPTPNSYIFMALTLADK-----ENSQEFFSFFQ 401
           G+  F +NDL  A+  L+ ++     L+PT  + + + + LA       EN +     F+
Sbjct: 606 GVMYFKRNDLHKAKRYLKRALEAVKELNPTSRTSVSIQMNLAHAYRRLGEN-ERAIKCFK 664

Query: 402 KAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNI 445
             +++  + S TY   G +Y   ++   A      A SL P N+
Sbjct: 665 TVLEVSSKDSDTYCSLGFLYLKTKELQRAIDHLHTALSLKPSNL 708

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 144 AIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           A +Y+  A ++ PNDP+  + M   +    DL K   Y  KALE   D
Sbjct: 521 AEEYFTLAYDIYPNDPLLLNEMGVLHFKKNDLQKSKRYLKKALEAAKD 568

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%)

Query: 144 AIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKA 195
           AIK ++  +E+   DP  + ++   Y+ T  L K +++   +L +KP +S A
Sbjct: 596 AIKCFKAILEVCGKDPDIFCSLGFLYLKTKQLQKAIDHLHLSLSLKPSNSVA 647

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 38/73 (52%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           + Q   +   K++++D   + T+YH G+++ +  DY  A   FQ+A + +  N   +  +
Sbjct: 289 DPQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSI 348

Query: 452 ACLLYKQGKFSES 464
             L Y+  ++ ++
Sbjct: 349 GVLYYQISQYRDA 361

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 30/71 (42%)

Query: 129 KDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEI 188
           K +GN  F   ++  A K+Y   I  +P +P+ YSN +   I     ++ +      L  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 189 KPDHSKALLRR 199
             D     ++R
Sbjct: 67  SSDPEHEAIKR 77

>ABL100W Chr2 (209847..212564) [2718 bp, 905 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR055C (PRP6)
          Length = 905

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 7/83 (8%)

Query: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEY 181
           ++Y + L  +GNH       D A+ +    +  DP +P  Y  +S  Y  T  L K ++ 
Sbjct: 642 RDYVIFLCFRGNH-------DGAVGFLNSMLSKDPENPQLYLLLSRVYSETSHLTKALDL 694

Query: 182 TTKALEIKPDHSKALLRRASANE 204
            + A++  P   K  ++ A   E
Sbjct: 695 LSSAVKKLPSSDKLWIQLAYLQE 717

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 33/59 (55%)

Query: 402 KAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGK 460
           K+++LDP  S T+Y+ G+++   +D+  A    Q+A + +  N   +  +  L Y+ G+
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQ 463

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G      K+F  A +  Q A+  D  +P+F+ ++   Y   G  +  ++  T+A+ + P 
Sbjct: 421 GRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPY 480

Query: 192 HSKALLRRASANESLGN-FTDAM 213
            S+      +  E+  +  TDA+
Sbjct: 481 ISEVWYNLGTLYETCNDQITDAL 503

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 64/153 (41%), Gaps = 7/153 (4%)

Query: 352 IFQ--FLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPE 409
           IFQ  +L+   L  + L Q+  N    P +Y+     L  K    + F    K  +  P+
Sbjct: 365 IFQGKYLECLELCEKVLEQDEFNFDVLP-TYVQCLYELGGK---NKLFLVSHKLAESFPK 420

Query: 410 YSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFN 469
            S T++  G  YF + +   A+  F KA  L+P   Y ++  A     +G+  ++   ++
Sbjct: 421 SSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYS 480

Query: 470 ETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQY 502
                FP    +P  +  +   + D  T  ++Y
Sbjct: 481 TAARFFPG-THLPHLYLGMQYSRMDTLTLAEEY 512

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 42/90 (46%)

Query: 392 NSQEFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQL 451
           + Q   +   K+++ D   + T+YH G+++ +  DY  A   FQ+A + +  N   +  +
Sbjct: 293 DPQTALNLLLKSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSI 352

Query: 452 ACLLYKQGKFSESEKLFNETKLKFPTLPEV 481
             L Y+  ++ ++   +       P + EV
Sbjct: 353 GVLYYQISQYRDALDAYTRAIRLNPYISEV 382

>CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} some
           similarities with uniprot|P09798 Saccharomyces
           cerevisiae YKL022c CDC16
          Length = 743

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 27/64 (42%)

Query: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191
           G  +  S     A +Y+  A E  P DPV  + +       G+L+K   Y  KA E   D
Sbjct: 530 GMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKD 589

Query: 192 HSKA 195
             ++
Sbjct: 590 MERS 593

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
           dsRNA virus protection family member contains 8 copies
           of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 35/69 (50%)

Query: 141 FDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRA 200
           + ++I+++Q +I +  +D   +  +   Y++ G +   ++   K LE+  +H  A    A
Sbjct: 685 YAESIEWFQSSIRVSSSDVESWVGLGQAYLNCGRVEASIKVFKKVLELDENHHFAWYFLA 744

Query: 201 SANESLGNF 209
            A  +LG F
Sbjct: 745 IALSALGEF 753

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 30/54 (55%)

Query: 142 DDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKA 195
           D+AIK ++  +E DP D + ++++ A   ++   +  ++     +E+KP   +A
Sbjct: 408 DNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRA 461

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,225,112
Number of extensions: 2618297
Number of successful extensions: 10266
Number of sequences better than 10.0: 324
Number of HSP's gapped: 10151
Number of HSP's successfully gapped: 516
Length of query: 638
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 522
Effective length of database: 40,180,143
Effective search space: 20974034646
Effective search space used: 20974034646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)