Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_8.1772.153ON1301306135e-83
Smik_8.1942.153ON1291305093e-67
YHR116W (COX23)2.153ON151965052e-66
Suva_15.3132.153ON132974833e-63
KLTH0B05148g2.153ON111933591e-44
Ecym_82052.153ON114943503e-43
SAKL0E10934g2.153ON113933495e-43
CAGL0I02728g2.153ON111923486e-43
NDAI0B043302.153ON127933489e-43
TDEL0B051502.153ON119963462e-42
Kwal_33.147762.153ON111933433e-42
KNAG0H035202.153ON109943331e-40
ZYRO0G06534g2.153ON112943322e-40
KLLA0F24024g2.153ON122923332e-40
NCAS0B070002.153ON108883164e-38
ABR130W2.153ON111923122e-37
Kpol_505.202.153ON112933086e-37
KAFR0F007302.153ON108962964e-35
TPHA0F018702.153ON180712772e-31
TBLA0B012402.153ON119901942e-19
TDEL0F051508.391ON15571670.75
ZYRO0F04642gsingletonON54923681.0
KLTH0H02552g6.284ON7738631.5
KAFR0D018505.205ON6327611.8
Suva_10.665.205ON7226612.5
Ecym_82875.205ON5827602.6
AAL161W5.205ON6426593.5
TDEL0A069806.284ON6847593.6
TBLA0C061305.205ON6727594.2
Zrou_YGOB_Anc_5.2055.205ON5027575.2
Kwal_27.97128.872ON86145626.0
Smik_12.545.205ON6926577.6
Kwal_56.243936.284ON10026587.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_8.177
         (130 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   240   5e-83
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   200   3e-67
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   199   2e-66
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   190   3e-63
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   142   1e-44
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   139   3e-43
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   139   5e-43
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   138   6e-43
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   138   9e-43
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   137   2e-42
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   136   3e-42
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   132   1e-40
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   132   2e-40
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   132   2e-40
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   126   4e-38
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   124   2e-37
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   123   6e-37
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   118   4e-35
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   111   2e-31
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    79   2e-19
TDEL0F05150 Chr6 (965659..966126) [468 bp, 155 aa] {ON} Anc_8.39...    30   0.75 
ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} simila...    31   1.0  
KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa...    29   1.5  
KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}...    28   1.8  
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    28   2.5  
Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to ...    28   2.6  
AAL161W Chr1 (64596..64790) [195 bp, 64 aa] {ON} Syntenic homolo...    27   3.5  
TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {O...    27   3.6  
TBLA0C06130 Chr3 complement(1484597..1484800) [204 bp, 67 aa] {O...    27   4.2  
Zrou_YGOB_Anc_5.205 Chr2 (819283..819435) [153 bp, 50 aa] {ON} A...    27   5.2  
Kwal_27.9712 s27 (31850..34435) [2586 bp, 861 aa] {ON} YML093W (...    28   6.0  
Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}...    27   7.6  
Kwal_56.24393 s56 complement(979862..980164) [303 bp, 100 aa] {O...    27   7.7  

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  240 bits (613), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 118/130 (90%), Positives = 118/130 (90%)

Query: 1   MANDTSGATNAETDNGSSSINXXXXXXXXXXXXRGPITDRTKVNYVPKNNDPSSFQYYPD 60
           MANDTSGATNAETDNGSSSIN            RGPITDRTKVNYVPKNNDPSSFQYYPD
Sbjct: 1   MANDTSGATNAETDNGSSSINLEPSPPLAEPAPRGPITDRTKVNYVPKNNDPSSFQYYPD 60

Query: 61  DPENPINKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLT 120
           DPENPINKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLT
Sbjct: 61  DPENPINKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLT 120

Query: 121 ARRKNRQQWE 130
           ARRKNRQQWE
Sbjct: 121 ARRKNRQQWE 130

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  200 bits (509), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 1/130 (0%)

Query: 1   MANDTSGATNAETDNGSSSINXXXXXXXXXXXXRGPITDRTKVNYVPKNNDPSSFQYYPD 60
           M  DTS  TN  T       +            +GP+TDRTKVNYVPK++DPSSFQYYPD
Sbjct: 1   MTKDTSDTTNINTTKIIDK-DSQPSSSSVPATSKGPVTDRTKVNYVPKSDDPSSFQYYPD 59

Query: 61  DPENPINKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLT 120
           DPENP+NKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLT
Sbjct: 60  DPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLT 119

Query: 121 ARRKNRQQWE 130
           ARR NRQQWE
Sbjct: 120 ARRNNRQQWE 129

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  199 bits (505), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 92/96 (95%), Positives = 96/96 (100%)

Query: 35  GPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCL 94
           GP+TDRTKVNYVPK++DPSSFQYYPDDPENP+NKYKFALKADSQYYDPCEESSKLSFQCL
Sbjct: 56  GPVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCL 115

Query: 95  ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE
Sbjct: 116 ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  190 bits (483), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 87/97 (89%), Positives = 94/97 (96%)

Query: 34  RGPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQC 93
           RGP+TDR+KVNYVP++NDPSSFQYYPDDPENP+NKYKFALK DSQYYDPCEESSKLSFQC
Sbjct: 36  RGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQC 95

Query: 94  LERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           LERN YDR+KCQ+YFDAYRECKKQWLTARR NRQQWE
Sbjct: 96  LERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  142 bits (359), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 64/93 (68%), Positives = 78/93 (83%)

Query: 38  TDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERN 97
            D+TKV+Y PKN +  SF++YPD+PE+  NKY+FA K  SQ+YDPC+ESSK+S +CLE N
Sbjct: 19  VDKTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDASQFYDPCQESSKMSMKCLELN 78

Query: 98  DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           +YDRS CQEYFDAYRECKKQWL ARR+NR QWE
Sbjct: 79  NYDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  139 bits (350), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 61/94 (64%), Positives = 78/94 (82%)

Query: 37  ITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLER 96
           +TD+TKVN+ P +ND S+FQ+YPDDPE  +N++KF  K  S YYDPCEESSK+SF+CLE 
Sbjct: 21  VTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLEL 80

Query: 97  NDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           N+YDRS C +YFDAYRECKKQWL ARR++  +W+
Sbjct: 81  NNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  139 bits (349), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 61/93 (65%), Positives = 80/93 (86%)

Query: 38  TDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERN 97
           TD+ KVN+ P+ ND SSF++YPD+PE+ +NK++FA K  S+Y+DPC+ESSK+SF+CLE N
Sbjct: 21  TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMN 80

Query: 98  DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           +YDR  C+EYFDAYRECKKQWL +RR+NR QWE
Sbjct: 81  NYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  138 bits (348), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (84%)

Query: 38  TDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERN 97
           TD+ KV+Y PK  D + ++YYPD+PE+ +NKY+FA+K  SQYYDPC+ES+K+SF+CLE N
Sbjct: 19  TDKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYDPCQESAKMSFKCLELN 78

Query: 98  DYDRSKCQEYFDAYRECKKQWLTARRKNRQQW 129
           DYDR +C+EYFDAYRECKKQWL ARRK+R  W
Sbjct: 79  DYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  138 bits (348), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 75/93 (80%)

Query: 38  TDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERN 97
           T +  VN+ P   D S+F+YYPDDPE  +NKYKF +K  S+YYDPC+ESS++SF+CL+RN
Sbjct: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93

Query: 98  DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           ++DR KC EYFDAYRECKKQWL ARR NR QW+
Sbjct: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  137 bits (346), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 78/96 (81%)

Query: 35  GPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCL 94
           G + D +KV+Y PK  DPS FQYYP++PE+ +N+  FA+K  SQYYDPC+ES+++S  CL
Sbjct: 24  GAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCL 83

Query: 95  ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           +RNDY++  C+EYFDAYRECKKQWL +RR++R QWE
Sbjct: 84  DRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  136 bits (343), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 77/93 (82%)

Query: 38  TDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERN 97
            D++K++Y P++    S+++YPD+PE+  NK++FA K  SQ+YDPC+ESSK+S +CLE N
Sbjct: 19  VDKSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMSMKCLELN 78

Query: 98  DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           DYDRS CQEYFDAYRECKKQWL ARRKNR QWE
Sbjct: 79  DYDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  132 bits (333), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 56/94 (59%), Positives = 74/94 (78%)

Query: 37  ITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLER 96
           ++ +  V++ P   +P  F+Y+PD P++  +KYKF  K DS++YDPC+ESSK+SF CLE+
Sbjct: 16  VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQ 75

Query: 97  NDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           NDYDRSKC+ YFDAYRECKKQWL ARR N+ QWE
Sbjct: 76  NDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  132 bits (332), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 76/94 (80%)

Query: 37  ITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLER 96
           + +  KV+Y P+ + P  FQYYPD PE+ +++Y+FA+K  SQY+DPC+ESS++SF CL+R
Sbjct: 19  VVEPKKVDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQESSRMSFNCLDR 78

Query: 97  NDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           N+YDR  C+EYFDAYRECKKQWL ARR+NR  WE
Sbjct: 79  NNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  132 bits (333), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 56/92 (60%), Positives = 78/92 (84%)

Query: 39  DRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERND 98
           ++TKVN+ P+  D +++++YPDDPE+ +N+Y+FA+K  S+YYDPC+ESSK+SF+CLE N+
Sbjct: 31  NKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYYDPCQESSKMSFKCLELNN 90

Query: 99  YDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           YDR  C +YFDAYRECKKQWL ARR+ R+ WE
Sbjct: 91  YDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  126 bits (316), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 72/88 (81%)

Query: 43  VNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRS 102
           VN+ P   +P S++Y+PDDP   +NKYKF +K DS+YYDPC+E S++S +CLERN +D+S
Sbjct: 20  VNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQECSEMSRKCLERNPFDKS 79

Query: 103 KCQEYFDAYRECKKQWLTARRKNRQQWE 130
           +CQEYFDAYR+CKK W+  RR+NR+QWE
Sbjct: 80  QCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  124 bits (312), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 73/92 (79%), Gaps = 1/92 (1%)

Query: 38  TDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERN 97
           TDR  VN+ P + D SSFQ+YPD+ E+P+ +Y+ A K  SQY DPC+ES+ +S +CLERN
Sbjct: 20  TDRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMSMKCLERN 78

Query: 98  DYDRSKCQEYFDAYRECKKQWLTARRKNRQQW 129
           +YDR  C+EYFDAYRECKKQWL+ARRK+  QW
Sbjct: 79  NYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  123 bits (308), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 76/93 (81%), Gaps = 1/93 (1%)

Query: 38  TDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERN 97
           TD++KV++  K+ D    ++YPD+PE+ + KY+F  K  SQYYDPC+ES+++SF CL+RN
Sbjct: 21  TDKSKVDFANKD-DKKDLKFYPDNPESTLAKYRFITKETSQYYDPCQESAQMSFNCLDRN 79

Query: 98  DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           +YD+SKC+ YFDAYRECKKQWL ARR++R QWE
Sbjct: 80  NYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  118 bits (296), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 78/96 (81%), Gaps = 2/96 (2%)

Query: 37  ITDRTKVNYVPKN--NDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCL 94
           +TD+TKVN+V ++   + + F+YYPDDPE+  ++ +F  K  ++YYDPC+ES++LSF+CL
Sbjct: 13  VTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFKCL 72

Query: 95  ERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130
           E N+YDRS C++YFDAYRECKKQWL AR+ +R +WE
Sbjct: 73  ELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  111 bits (277), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 48/71 (67%), Positives = 59/71 (83%)

Query: 55  FQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYREC 114
           F++YPD+PE+   KY+F  K  SQYYDPC+ES+K+SF+CL+ NDYDR KC+ YFDAYREC
Sbjct: 103 FKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMSFKCLDMNDYDRDKCRAYFDAYREC 162

Query: 115 KKQWLTARRKN 125
           KKQWL ARR N
Sbjct: 163 KKQWLRARRNN 173

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 79.3 bits (194), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 61/90 (67%), Gaps = 3/90 (3%)

Query: 39  DRTKVNYVPKN--NDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCL-E 95
           D T V++V  +  N  ++FQY+PD P + + ++ FA K  S++YDPC ES+++S +C+ +
Sbjct: 28  DPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRFNFADKESSKFYDPCHESAQMSVRCMTD 87

Query: 96  RNDYDRSKCQEYFDAYRECKKQWLTARRKN 125
             D  ++ C E+F AYR+CKK W+ A+++ 
Sbjct: 88  HPDDHKTVCAEFFAAYRDCKKAWIDAKKRG 117

>TDEL0F05150 Chr6 (965659..966126) [468 bp, 155 aa] {ON} Anc_8.391
           YLR245C
          Length = 155

 Score = 30.4 bits (67), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 11/71 (15%)

Query: 70  KFALKADSQYYDP--------CEESSKLSFQC---LERNDYDRSKCQEYFDAYRECKKQW 118
           K AL+A    Y P        C  +S L+F C   +E   Y  + C E     +    + 
Sbjct: 22  KLALEARELSYSPYSQFRVGCCLLTSSLTFVCGANVENASYGGAICAERTTIVKAVTSEN 81

Query: 119 LTARRKNRQQW 129
            T R +N+QQW
Sbjct: 82  STERDENKQQW 92

>ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} similar
          to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
          Plasma membrane multidrug transporter member of the
          major facilitator superfamily involved in efflux of
          fluconazole diazaborine benomyl methotrexate and other
          drugs
          Length = 549

 Score = 30.8 bits (68), Expect = 1.0,   Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%)

Query: 46 VPKNNDPSSFQYY-PDDPENPIN 67
          VP+  DP   +Y  PDDPE P+N
Sbjct: 76 VPQQKDPFLVEYTGPDDPERPVN 98

>KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa]
           {ON} similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
           YMR194C-B
          Length = 77

 Score = 28.9 bits (63), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 19/38 (50%)

Query: 81  DPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQW 118
           DPC+  +     CL +  +D SKC    D+  EC  ++
Sbjct: 3   DPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKF 40

>KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}
           Anc_5.205 YLL009C
          Length = 63

 Score = 28.1 bits (61), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 92  QCLERNDYDRSKCQEYFDAYRECKKQW 118
           QCL     D  KC+EY + YR C K +
Sbjct: 33  QCLLFKGADDGKCKEYIEKYRMCMKSF 59

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
           YLL009C (REAL)
          Length = 72

 Score = 28.1 bits (61), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 93  CLERNDYDRSKCQEYFDAYRECKKQW 118
           C+  N  D  KC+E+ D Y+EC K +
Sbjct: 39  CILFNGQDSDKCKEFIDKYKECMKGY 64

>Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to
           Ashbya gossypii AAL161W
          Length = 58

 Score = 27.7 bits (60), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 92  QCLERNDYDRSKCQEYFDAYRECKKQW 118
           +CL  N  + +KC+E  D YR C K +
Sbjct: 28  ECLLFNGLESTKCKELVDKYRSCMKGY 54

>AAL161W Chr1 (64596..64790) [195 bp, 64 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL009C (COX17)
          Length = 64

 Score = 27.3 bits (59), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 93  CLERNDYDRSKCQEYFDAYRECKKQW 118
           CL  N  D  KCQE    Y++C K +
Sbjct: 35  CLLFNGVDAVKCQELVQKYKDCMKGY 60

>TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {ON}
           Anc_6.284 YMR194C-B
          Length = 68

 Score = 27.3 bits (59), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 81  DPCEESSKLSFQCLERNDYDRSKCQEYFD-AYRECKKQWLTARRKNR 126
           DPC+  +     CL  +DY  SKCQ+  D  YR C K +    ++N+
Sbjct: 3   DPCKPEACAIQNCLISSDYKESKCQDLVDQLYRCCDKFYKEDGKENK 49

>TBLA0C06130 Chr3 complement(1484597..1484800) [204 bp, 67 aa] {ON}
           Anc_5.205 YLL009C
          Length = 67

 Score = 27.3 bits (59), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 92  QCLERNDYDRSKCQEYFDAYRECKKQW 118
           QC+  N  + +KC E+ + Y+EC K +
Sbjct: 37  QCILFNGQESTKCTEFINKYKECMKGY 63

>Zrou_YGOB_Anc_5.205 Chr2 (819283..819435) [153 bp, 50 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 50

 Score = 26.6 bits (57), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 92  QCLERNDYDRSKCQEYFDAYRECKKQW 118
           QC+  N  D  KCQE+ + Y++C + +
Sbjct: 20  QCILFNGQDSGKCQEFVNKYKKCMQGY 46

>Kwal_27.9712 s27 (31850..34435) [2586 bp, 861 aa] {ON} YML093W
           (UTP14) - Protein required for cell viability [contig
           336] FULL
          Length = 861

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 43  VNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESS 87
           +N  P++ND S F      P   + K    L ADS   DP +ES+
Sbjct: 298 MNPTPQHNDGSMFTRSEKSPGTQLEKEVDLLLADSNLADPQKEST 342

>Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}
           YLL009C (REAL)
          Length = 69

 Score = 26.6 bits (57), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 93  CLERNDYDRSKCQEYFDAYRECKKQW 118
           C+  N  D  KC+E+ + Y+EC K +
Sbjct: 36  CILFNGQDSEKCKEFIEKYKECMKGY 61

>Kwal_56.24393 s56 complement(979862..980164) [303 bp, 100 aa] {ON}
           [contig 163] FULL
          Length = 100

 Score = 26.9 bits (58), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 93  CLERNDYDRSKCQEYFDAYRECKKQW 118
           CL +  YD SKC +  D   EC  ++
Sbjct: 38  CLTKTGYDESKCSQVIDQLYECCTKF 63

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,441,589
Number of extensions: 641451
Number of successful extensions: 1404
Number of sequences better than 10.0: 58
Number of HSP's gapped: 1399
Number of HSP's successfully gapped: 58
Length of query: 130
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 33
Effective length of database: 42,358,797
Effective search space: 1397840301
Effective search space used: 1397840301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)