Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_8.1315.351ON73173138240.0
YHR072W (ERG7)5.351ON73172735850.0
Smik_8.1485.351ON73173135640.0
Suva_15.2625.351ON73173135540.0
Kpol_339.125.351ON73373331830.0
TPHA0E011205.351ON73372530840.0
KNAG0B045805.351ON72972530770.0
TDEL0E027605.351ON73172630420.0
CAGL0J10824g5.351ON73372230260.0
KAFR0D046705.351ON73173130040.0
TBLA0A031205.351ON74372829840.0
NCAS0H016405.351ON72872829840.0
NDAI0C019705.351ON73172729560.0
SAKL0G08844g5.351ON74672628960.0
ZYRO0D10164g5.351ON73273228900.0
Kwal_34.159795.351ON72872527840.0
KLLA0B10175g5.351ON73172627680.0
KLTH0H14850g5.351ON72672527520.0
Ecym_81825.351ON73272725750.0
AGR351W5.351ON72972825470.0
TPHA0D022005.372ON516124790.65
Smik_14.601.66ON1079102781.0
KNAG0E012705.14ON179091771.4
TPHA0A031107.309ON812115733.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_8.131
         (731 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1477   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1385   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1377   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1373   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1230   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1192   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1189   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1176   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1170   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1161   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1154   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1154   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1143   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1120   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1117   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1077   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1070   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1064   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...   996   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...   985   0.0  
TPHA0D02200 Chr4 complement(454720..456270) [1551 bp, 516 aa] {O...    35   0.65 
Smik_14.60 Chr14 (92155..95394) [3240 bp, 1079 aa] {ON} YNL278W ...    35   1.0  
KNAG0E01270 Chr5 complement(247055..252427) [5373 bp, 1790 aa] {...    34   1.4  
TPHA0A03110 Chr1 (684324..686762) [2439 bp, 812 aa] {ON} Anc_7.3...    33   3.8  

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1477 bits (3824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/731 (97%), Positives = 711/731 (97%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP
Sbjct: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
           QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI
Sbjct: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI
Sbjct: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN
Sbjct: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
           FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF
Sbjct: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL
Sbjct: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFHKFFD                    QSPDGSWYGSWGICFTYAGMFAME
Sbjct: 541 TDSSVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAME 600

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI
Sbjct: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYAKAYEQPGL 731
           MYAKAYEQPGL
Sbjct: 721 MYAKAYEQPGL 731

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1385 bits (3585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/727 (89%), Positives = 687/727 (94%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           MTEFYS+ IGLPKTDPRLWRLRTDELGRESWEYLTP+QAAN+PPSTFTQWLLQDP F QP
Sbjct: 1   MTEFYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
            P RNKHSPDFSAFDACHNGASFF+LLQ+P SGIFPCQYKGPMF+TIGYVAVNYIAG++I
Sbjct: 61  HPERNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVC KAR 
Sbjct: 121 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARS 180

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI
Sbjct: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           PVSYLSLVKFSCPMTPLLEE+R EIYTKPFDKI+FS +RNTVCGVDLYYPHS TL+IAN+
Sbjct: 241 PVSYLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANS 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
            VVFYEKYLRNRFIYSLSK+KVYDLIKTE++NTDSLCIAPVNQAFCALVT IEEGVDS+A
Sbjct: 301 LVVFYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           F++ QYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFF+AGLAERPEFYNTIVSAYKF
Sbjct: 361 FQRLQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKF 420

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LC AQFDTECVPGS+R+KRKG+WGFSTKTQGYTVADCTAE+IKAIIMVKNSPVFSEVHH+
Sbjct: 421 LCHAQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHM 480

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           I+SERLFEGIDVLL+LQN+GSFEYGSFATYEKIKAPLAME LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ISSERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFHK+FD                    Q PDGSWYGSWGICFTYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALE 600

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           ALHTVGE YENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDS KSLVVQ+AWALI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALI 660

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL FAEYPNKEVIDRGI+LLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYAKAYE 727
           MY++AYE
Sbjct: 721 MYSRAYE 727

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1377 bits (3564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/731 (88%), Positives = 683/731 (93%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           MTEFYSE IGLPKTDPRLWRLRTDE+GRESWEYLT EQAANEPPSTFTQWLLQDP F  P
Sbjct: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
           QP RNKHSP+FSAFDACHNGASFF+LLQ+P SGIFPCQYKGPMF+TIGYVAVNYIAG+QI
Sbjct: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGT LNYVILRLLGLPKDHPVC K+R 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TLLRLGGA+GSPHWGKIWLSALNLY+WEGVNPAPPETWLLPYSLPMHPGRWWVHTR VYI
Sbjct: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           PVSYLSLVKF+CPMTPLLEE+R+EIYTKPFDKI FS HRNTVCGVDLYYPHS+TL+IANN
Sbjct: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
           FVVFYEKYLRNRFIYSLSKRKVYDL++ EI+NTDSLCIAPVNQAFCALVT IEEGVDSQA
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           FKKFQYRFKDALFHGPQGMTIMGTNGVQ+WDCAFAIQY FIAGLAER EFYNTIVSAYKF
Sbjct: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCRAQFDTECVPGSFR+KRKG+WGFSTKTQGY V+DCTAE+IKAIIMVKNSPVF+EVH++
Sbjct: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           I++ERLFEGIDVLL+LQN+GSFEYGSFATYEKIKAPLAME LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFHK+FD                    Q P+GSWYGSWGICFTYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALE 600

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           ALHTVGE YENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDS KSLVVQ+AW LI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL FAEYP K+VIDRGIELLKNRQEESGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYAKAYEQPGL 731
           MY+KAYEQ  L
Sbjct: 721 MYSKAYEQHAL 731

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1373 bits (3554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/731 (88%), Positives = 684/731 (93%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           MTEFYSE+IGLPKTDPR WRLRTD+LGRESWEYLTPEQAAN+PPSTFTQWLLQDP+F QP
Sbjct: 1   MTEFYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
            P +NKHSPDFSAFDACHNGASFF+LLQ+P SGIFPCQYKGPMF+TIGYVAV+YIAG+QI
Sbjct: 61  HPAKNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGL KDHPVC KAR 
Sbjct: 121 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARD 180

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TLLRLGGAIG+PHWGK+WLSALNLYKWEGVNPAPPETWLLPYSLP+HPGRWWVHTRGVYI
Sbjct: 181 TLLRLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 240

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           PVSYLSLVKF CPMTPLLEE+R EIYTKPFDKI+FSNHRNTVCGVDLYYPHS+ L+IANN
Sbjct: 241 PVSYLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANN 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
           FVVFYEKYLRNRFIYSLSKRKVYDL+K EIENTDSLCIAPVNQAFCALVT IEEGVDSQA
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           FK FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFF AGLAERPEF++TIVSAYKF
Sbjct: 361 FKDFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKF 420

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCR+QFDTECVPGSFR+KRKG+WGFSTKTQGYTV+DCTAESIKAIIMV+NSPVFS+VHHL
Sbjct: 421 LCRSQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHL 480

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           IT+ERLFEGIDVLL+LQNVGSFEYGSFATYEKIKAPLAME LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITNERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFHKFFD                    Q PDG WYGSWGICFTYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALE 600

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           ALHTVGE YENSSTVRKGCDFLVSKQM+DGGWGESMKSSELHSYVDS +SLVVQ+AWALI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALI 660

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL FAEYP +EVIDRGIELLK+RQEESGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYAKAYEQPGL 731
           MY KAYE   L
Sbjct: 721 MYTKAYEPESL 731

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1230 bits (3183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/733 (78%), Positives = 641/733 (87%), Gaps = 2/733 (0%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           M EFYSE IGL KTDP+LWRLRTD+LGRESWEYLTPE A  +P S++TQWLLQ P F  P
Sbjct: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60

Query: 61  QPGRN--KHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGV 118
            P +N    + +++A+DACHNGASFF+LLQD  SGIFPCQYKGPMF+TIGY+AVNYIAGV
Sbjct: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120

Query: 119 QIPEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKA 178
           +IP+HERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYV LRLLGL KDHPVC KA
Sbjct: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180

Query: 179 RGTLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGV 238
           R TL++LGGAIG+PHWGK WLS LNLYKWEGVNPAPPETWLLPYSL +HPGRWWVHTRGV
Sbjct: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240

Query: 239 YIPVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIA 298
           Y+P+SYLSLV++SC +TPLL E+R+EIYTKPFD IDFS HRNTVCGVDLYYPHS+ LD+A
Sbjct: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300

Query: 299 NNFVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDS 358
           N+ +VFYEKYLR ++++  SK  VYDLIK EIENTD LCIAPVNQAFCALVT IEEG DS
Sbjct: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360

Query: 359 QAFKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAY 418
           QAFK+F++RFKDALFHGPQGMT+MGTNGVQ WDCAFAIQYFF+AGLAE+PEFY+TIV AY
Sbjct: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420

Query: 419 KFLCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVH 478
           +FLCR+QFDTECVPGSFR+KR G+WGFSTKTQGYTV+DCTAE+IKAIIMV+NS VF  VH
Sbjct: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480

Query: 479 HLITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYV 538
             I+ ERL +GIDVL+SLQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYV
Sbjct: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540

Query: 539 ECTDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFA 598
           ECTDSSVLGLT+FHK                       Q  DGSWYG WGICFTYAGMFA
Sbjct: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600

Query: 599 MEALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWA 658
           MEAL+TVGENY NS TVRKGCDFLVSKQM+DGGWGESMKSSELHSYVDS KSLVVQ+AW 
Sbjct: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660

Query: 659 LIALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 718
           L+AL  AEYP+K+VIDRGI+LLK+RQ  SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720

Query: 719 LGMYAKAYEQPGL 731
           LG+Y KAY   G+
Sbjct: 721 LGLYTKAYSDNGI 733

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1192 bits (3084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/725 (76%), Positives = 625/725 (86%), Gaps = 1/725 (0%)

Query: 3   EFYSERIGLPKTDPRLWRLRTDELGRESWEYLTP-EQAANEPPSTFTQWLLQDPNFSQPQ 61
           EFYSE+IGLPKTDP+ WRLRTDELGRESWEYL   E   N+  ST+T+WLLQ P+F  P 
Sbjct: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63

Query: 62  PGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIP 121
           P  N  S +F A +ACHNGASF++LLQDP SG+FPCQYKGPMF+ IGY+AVNYIAG++IP
Sbjct: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123

Query: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGT 181
           +HERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYV LRLLGL KDHPVC KAR T
Sbjct: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183

Query: 182 LLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIP 241
           L+RLGGAIG+PHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLP+HPGRWWVHTRGVYIP
Sbjct: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243

Query: 242 VSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNF 301
           VSYLSL K++C +TPLL EIR EIYTK F+ IDFS HRNTVCGVDLYYPHS+ LD+AN+ 
Sbjct: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303

Query: 302 VVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAF 361
           +VFYE YLR  ++Y  S++ VY+LIK EIENTD LCIAPVNQAFCALVT IEEG +S+ F
Sbjct: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363

Query: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFL 421
           ++FQYR KDALFHGPQGMT+MGTNG Q WDCAF IQY+F+AGLAE+PEFY+ I +AYKFL
Sbjct: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423

Query: 422 CRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLI 481
           CR+QFDTEC PGSFR+KR G+WGFSTKTQGYTV+DCTAESIKAIIMV+NSP F+++H+  
Sbjct: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483

Query: 482 TSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECT 541
           + ERL++GID+L+SLQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYVECT
Sbjct: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543

Query: 542 DSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAMEA 601
           DSSVLGLTYFHK +D                    Q  DGSWYG WGICFTYAGMFAMEA
Sbjct: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603

Query: 602 LHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIA 661
           L TVGENY+NS  VRKGCDFLV KQM+DGGW ESMKSSELH+YV S +SLVVQ+AW LIA
Sbjct: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663

Query: 662 LFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGM 721
           L  A+YP+K+VIDRGI+LLK+RQ+ SGEWKFE VEGVFNHSCAIEY SYRFLFPIKALG+
Sbjct: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723

Query: 722 YAKAY 726
           Y K Y
Sbjct: 724 YVKNY 728

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1189 bits (3077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/725 (76%), Positives = 629/725 (86%), Gaps = 9/725 (1%)

Query: 4   FYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQ--DPNFSQPQ 61
            YSE++GLP+TDP+ WRLRTDELGRE+W+Y+  +Q   +P S+FTQWLLQ  D   S P+
Sbjct: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65

Query: 62  PGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIP 121
                     +AFD+C NGA+FF+ LQDP SG+FPCQYKGPMF+TIGY+AVNYIAG++IP
Sbjct: 66  E-------PVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIP 118

Query: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGT 181
           +HER+EIIRYIVNT+HPVDGGWGLHSVDKSTVFGTVLNYVILRLLGL +DHPVC KAR T
Sbjct: 119 KHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDT 178

Query: 182 LLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIP 241
           LLRLGGAIG+PHWGKIWLS LNLYKWEGVNPAPPETWLLPY LP+HPG+WWVHTRGVY+P
Sbjct: 179 LLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLP 238

Query: 242 VSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNF 301
           +SYLSLV +SC +TPLLEEIR EIYTKPFD IDFS HRNTVCGVDLYYPHS+ LD+ANN 
Sbjct: 239 ISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNA 298

Query: 302 VVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAF 361
           ++FYEKYLR  +IY  SK KVY LI+ EI+NTD LCIAPVNQAFCALVT IEEGVDS+AF
Sbjct: 299 IIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAF 358

Query: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFL 421
            KF+ RFKDALFHGPQGMT+MGTNGVQTWDCAFA+QYFF+AGLAERPEFYN IV+AY+FL
Sbjct: 359 TKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFL 418

Query: 422 CRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLI 481
            R+QFDTECVPGSFR+KRKGSWGFSTKTQGYTV+DCTAE+IKAIIMVKN+P FS+VH  I
Sbjct: 419 IRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEI 478

Query: 482 TSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECT 541
              RL+EGIDVLLSLQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVECT
Sbjct: 479 EDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECT 538

Query: 542 DSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAMEA 601
           DSSVLGLT+FHK++                     Q PDGSWYG WGIC+TYAGMFA+EA
Sbjct: 539 DSSVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALEA 598

Query: 602 LHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIA 661
           LH+V ENY NS+ VRKGCDFLVSKQ+ DGGWGESMKSSELHSYV + +SLVVQ+AWA+IA
Sbjct: 599 LHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIA 658

Query: 662 LFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGM 721
           L  AEYP+K+VI+RGIELL++RQ  SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG+
Sbjct: 659 LLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 718

Query: 722 YAKAY 726
           Y K Y
Sbjct: 719 YNKTY 723

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1176 bits (3042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/726 (74%), Positives = 617/726 (84%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           M +FYSE +GL +TDP LWRLRTDELGRE+W YLTPEQA N+   TFTQWLLQ   F +P
Sbjct: 1   MVQFYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
            P R+  + DF A DAC NGASFF+LLQDP+SGIFPCQYKGPMFLTIGYVAV+YI+G  I
Sbjct: 61  SPNRHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHERIEIIRYIVNTAHPVDGGWGLHSVDKST FGTV+NYVILRLLGLPKDHPVC KAR 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARA 180

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
            L++LGGAIG+PHWGKIWLS LNLYKWEGVNPAPPE WLLPY+LP+HPGRWWVHTR +Y+
Sbjct: 181 LLMKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYL 240

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           PVSYLSL+++SCP+  LL E+R EIY KPFD I+FS++RNTVCG+DLYYPH+  L++ANN
Sbjct: 241 PVSYLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANN 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
            +VFYEK+LR  ++   +K +VY LIK EI NTD LCIAPVNQAFCALVT+IEEG +S A
Sbjct: 301 VMVFYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           FKKF+ R KDALFHGPQGMTIMGTNGVQTWDCAFAIQYFF+AGLAE+PE+Y+TI +AYKF
Sbjct: 361 FKKFEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKF 420

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCR QFDTECV GSFR+KR G+W FSTK QGYTV+DCTAE+IKAIIMV+NSP F+ + + 
Sbjct: 421 LCRTQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNE 480

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           IT ERL +GIDVLLSLQN+ SFEYGSFATYEKIKAPL+ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 ITDERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVEC 540

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH F+D                    Q  DGSWYG WG+C++YAGMFAME
Sbjct: 541 TDSSVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAME 600

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           ALH+VGENY NS  VRKGCDFLVS+Q+ DGGWGESMKSSELHSYV + +SLVVQ+AW LI
Sbjct: 601 ALHSVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLI 660

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL   +YPNK VID GI+LLK RQ E+GEWKFE +EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLLGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYAKAY 726
           +Y   Y
Sbjct: 721 LYTATY 726

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1170 bits (3026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/722 (77%), Positives = 623/722 (86%), Gaps = 2/722 (0%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           MT+FYS+ +G+P+TDP+ WRLRT ELGRE+WEY+  ++   +P STF QWLLQD  F  P
Sbjct: 1   MTQFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQDEEFPTP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
            P   K   D S+  AC+ GASF++LLQD KSGIFPCQYKGPMF+TIGYVAVNYIAGV++
Sbjct: 61  SP--RKEGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKL 118

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYV LRLLGLPKDH VC +AR 
Sbjct: 119 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARH 178

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TL RLGGA G+PHWGKIWLS LNLYKWEGVNPAPPETWLLPYSLP+HPGRWWVHTR VY+
Sbjct: 179 TLHRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYL 238

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           PVSYLSL+K+SCP+T LL EIR+EIYTK FDKI+FS HRNTVCGVDLYYPHS+ LD AN+
Sbjct: 239 PVSYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTAND 298

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
            +VFYEKYLR R +   SK+ VY+LIK EI+NTDSLCIAPVNQAFCALVT++EEG DS+A
Sbjct: 299 VIVFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKA 358

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           F++FQYRFKD LFHGPQGMT+MGTNGVQTWDCAF IQYFF+AGLAE+PEF   I++AYKF
Sbjct: 359 FERFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKF 418

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCR+QFDTECV GSFR+KR G+WGFSTKTQGYTV+DCTAE+IKAIIMV+NSPVFS VH  
Sbjct: 419 LCRSQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDE 478

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           IT ERL +GIDVLLSLQN+G FEYGSFATYEKIKAPL+ME LNPAEVFGNIMVEYPYVEC
Sbjct: 479 ITDERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVEC 538

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFHK++D                    Q  DG WYG WGICFTYAGMFAME
Sbjct: 539 TDSSVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAME 598

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           ALH+VGE Y+NS TVRKGCDFL+SKQM DGGWGESMKSSELH YVDS KSLVVQ+AWALI
Sbjct: 599 ALHSVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALI 658

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL  A+ PN++ I+RGI LLK+RQ+ SGEWKFES EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 659 ALLLAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALG 718

Query: 721 MY 722
           +Y
Sbjct: 719 LY 720

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/731 (74%), Positives = 614/731 (83%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           MT FYS+ +GL KTDPRLWRLRTD+LGR++W+Y+    A ++P +TF QWLLQ P F  P
Sbjct: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
            P        F+A DAC+NGA+FF+LLQD  SGIFPCQYKGPMF+TIGYVAVNYIAG++I
Sbjct: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHE+IE+IRYIVNTAHPVDGGWGLHSVDKST FGT +NYVILRLLGL K H VC +AR 
Sbjct: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TLLRLGGAIG PHWGKIWLS LNLY WEGVNPAPPETWLLPY LP+HPGRWWVHTRGVY+
Sbjct: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           P+SYLSLV++S   TPLLEEIRKEIY KPFD I+FS HRNTVCGVDLYYPHS  LD AN 
Sbjct: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
            +V YEK+LR  ++   S++ +Y+LI+ E +NTD LCIAPVNQAFCAL T IEEGV+S+ 
Sbjct: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           F+K+Q RFKDALFHGPQGMT+ GTNGVQTWDCAFAIQY FIAGLAE+PEFY+ + +A+KF
Sbjct: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCR+QFDTECVPGSFR+KR G+WGFSTKTQGYTV+DCTAESIKAIIMV+NSPVF+++H  
Sbjct: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           IT ERL +GID+LL LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH+ +                     Q  DGSWYGSWGICFTYAGMFAME
Sbjct: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           AL +VGE YENS  V KGCDFLVSKQM DGGW ESMKSSELH+YV + +SLVVQ+AW LI
Sbjct: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL  A+YP+K+VIDRGI LLK+RQE SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYAKAYEQPGL 731
           +Y K Y   G+
Sbjct: 721 LYVKEYGAQGI 731

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1154 bits (2984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/728 (73%), Positives = 617/728 (84%), Gaps = 3/728 (0%)

Query: 4   FYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQPG 63
            YS+ + LPKTDPR WRL TD+LGRESWEYL+ E +   P STF +WLLQ P+F  P+P 
Sbjct: 14  LYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKPK 73

Query: 64  RNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIPEH 123
             +   +F+  DA  NGA+FF+LLQDP+SGIFPCQYKGPMFLTIGYVAV YIAG++IPEH
Sbjct: 74  IKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPEH 133

Query: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGTLL 183
           ER+EIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPK HPVC KAR TL+
Sbjct: 134 ERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTLI 193

Query: 184 RLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVS 243
           RLGGAIGSPHWGKIWLS LNLYKWEGVNPAPPETWLLPYSLP+HPGRWWVHTRGVY+PVS
Sbjct: 194 RLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPVS 253

Query: 244 YLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNFVV 303
           YL L KF+CP TPL+EEIRKEIY   +D IDFS HRNTVCGVDLYYPHS+ LD+ANN +V
Sbjct: 254 YLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNILV 313

Query: 304 FYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAFKK 363
           FYEK++R  FIY+ SK KV DLI+ EI NTD LCIAPVNQAFC+LV  +E+GV+S+ F++
Sbjct: 314 FYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFER 373

Query: 364 FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFLCR 423
            QYRFKDALFHGPQGMT+MGTNGVQTWDCAFA+QYFF+AGLAERPEF + I+ +YKFLCR
Sbjct: 374 CQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLCR 433

Query: 424 AQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLITS 483
           +QFDTECVPGSFR+KR G WGFSTKTQGYTV+DCTAESIKAIIMV+NSP F EVH  I+ 
Sbjct: 434 SQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEISD 493

Query: 484 ERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECTDS 543
           ERL++GI++L+SLQN+G FEYGSFATYEKIKAPL+ME+LNPAEVF NIMVEYPYVECTDS
Sbjct: 494 ERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTDS 553

Query: 544 SVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAMEALH 603
           SVLGLTYFHK +D                    Q+ DGSWYGSWGICFTYA MFA+EAL 
Sbjct: 554 SVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEALE 613

Query: 604 TVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGK---SLVVQSAWALI 660
           T+GE+Y NS TV+KGCDF+VSKQ KDGGW E+MKSSE+H YVDSG    S VVQ++W++I
Sbjct: 614 TIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSVI 673

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L  A YP+K+V+ RGIE +K++Q  SGEW+F++VEGVFNHSC IEYPSYRFLFPIKALG
Sbjct: 674 GLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKALG 733

Query: 721 MYAKAYEQ 728
           +Y   Y Q
Sbjct: 734 LYRTRYCQ 741

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1154 bits (2984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/728 (74%), Positives = 620/728 (85%), Gaps = 4/728 (0%)

Query: 2   TEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQ 61
            + YS+ +GL KTDP  WRLRT+ LGR +WEY+  EQ  N+P STFT+WLLQ P+F  P 
Sbjct: 3   AKLYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPT 62

Query: 62  PGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIP 121
           P   +     +A +AC++GASFF+LLQD +SG FPCQYKGPMF+TIGYVAVNYIAG++IP
Sbjct: 63  PTTEEPR---TAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEIP 119

Query: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGT 181
            HERIEIIRY+VNTAHPVDGGWGLHS DKSTVFGTV+NYVILRLLG+ KDH VC +AR T
Sbjct: 120 NHERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARKT 179

Query: 182 LLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIP 241
           LL LGGAIG+PHWGK+WLS LNLYKWEGVNPAPPETWLLPY LP+HPGRWWVHTRGVY+P
Sbjct: 180 LLSLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYLP 239

Query: 242 VSYLSLVKFSCPMTPLLEEIRKEIYT-KPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           +SYLSLV FSC +TPLL+EIR+EIYT +PF+ I F+ +RN VCGVDLYYPHS+ LD+AN 
Sbjct: 240 ISYLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVANA 299

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
            +V YE+YLR  ++  LSKRKVY+LIK EI NTD LCIAPVNQAFCALVT IEEGVDS A
Sbjct: 300 CIVKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSNA 359

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           F+KF YRFKD+LFHGPQGMT+MGTNGVQ WDCAFAIQYFF+AGLAE+ EFY+TI SAY F
Sbjct: 360 FQKFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYAF 419

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCR+QFDTECV GSFR+KR GSWGFSTKTQGYTV+DCTAESIKAIIMVKNSPVF  +HHL
Sbjct: 420 LCRSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHHL 479

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           IT E++++GIDVLLSLQNVGSFEYGSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 480 ITDEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVEC 539

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFH +++                    Q+ DGSWYGSWGIC+TYAGMFAME
Sbjct: 540 TDSSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAME 599

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           ALH+VGE Y NS  V+KGCDFLV++QM DGGWGE MKSSELH+YV+S +S VVQ+AW +I
Sbjct: 600 ALHSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVVI 659

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL  A+YP K+VI +G+ELLK+RQE SGEWKFES EGVFNHSCAIEYPSYR LFPIKALG
Sbjct: 660 ALLLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKALG 719

Query: 721 MYAKAYEQ 728
           +YA+ Y++
Sbjct: 720 LYAEIYDK 727

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1143 bits (2956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/727 (73%), Positives = 609/727 (83%), Gaps = 2/727 (0%)

Query: 2   TEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQ 61
            + YSE +GL KTDP LWRLRT+  GR+SWEY+T +Q+ N+P S FT+WLLQ P+F  PQ
Sbjct: 3   NKLYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDFPTPQ 62

Query: 62  PGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIP 121
              N    D SA   C  GA FF+LLQD  SG FPCQYKGPMF+TIGYVAVNY+A ++IP
Sbjct: 63  YPDN--IKDVSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKIP 120

Query: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGT 181
           E ERIEIIRYIVNTAHPVDGGWGLHS DKSTVFGTVLNY+ILRLLGL  +HPVC KAR T
Sbjct: 121 ESERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARDT 180

Query: 182 LLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIP 241
           LLRLGGAI +PHWGK+WLS LNLYKWEGVNPAPPETWLLPY +P+HPGRWWVHTRGVY+P
Sbjct: 181 LLRLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYLP 240

Query: 242 VSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNF 301
           +SYLSLV + C +T LL+EIR EIY KPFD IDFS HRNTVCGVDLYYPHS+TLD AN+ 
Sbjct: 241 ISYLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANSL 300

Query: 302 VVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAF 361
           +V YEKYLR   +   SK KVYDLIK EIENTD LCIAPVNQAFCALVT +EEG DS+AF
Sbjct: 301 IVPYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKAF 360

Query: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFL 421
           ++FQYRFKDALF GPQGMT+MGTNGVQTWDCAFAIQY F+AGLA+RPEFYNTI +AYKFL
Sbjct: 361 ERFQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKFL 420

Query: 422 CRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLI 481
           CR+QFDT+CV GSFR+KR G+WGFSTKTQGYTV+DCTAESIKAIIMV+NS +F ++H  I
Sbjct: 421 CRSQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDEI 480

Query: 482 TSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECT 541
           + ERL++ +D+LL LQN GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVECT
Sbjct: 481 SDERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVECT 540

Query: 542 DSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAMEA 601
           DSSVLGLT FHK ++                    Q  DGSWYGSWGIC+TYAGMFAMEA
Sbjct: 541 DSSVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAMEA 600

Query: 602 LHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIA 661
           LH+VGE Y NS  V+KGCDFLV++Q++DGGWGESMKSSELH+YV + +SLVVQ+AW ++A
Sbjct: 601 LHSVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVLA 660

Query: 662 LFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGM 721
           L  A+YPNK +ID+GI LLK RQ+ SGEWKFES EGVFNHSCAIEYPSYRFLFPIKALG+
Sbjct: 661 LLLAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALGL 720

Query: 722 YAKAYEQ 728
           Y++ YE 
Sbjct: 721 YSQIYEH 727

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1120 bits (2896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/726 (71%), Positives = 605/726 (83%), Gaps = 1/726 (0%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           MT+ YS+++GLPKTDP  WRL TDELGRE+WEYL+ EQAA EP S++ ++LLQ P+F  P
Sbjct: 17  MTKLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAP 76

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
           +P R    P+F+A+DA +NGA F QLLQ+ +SGIFPCQYKGPMF+TIGYVA  Y AG++I
Sbjct: 77  KPERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEI 135

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHER EI+RYIVN AHPVDGGWGLHS DKST FGT +NYVILRLLGLP DH VC +AR 
Sbjct: 136 PEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARS 195

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TLL+LGGAIG+PHWGKIWLS LNLY WEGVNPAPPE WLLPY+LP+HPGRWWVHTR VY+
Sbjct: 196 TLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYM 255

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           PV YLS  KF C +TPLL+EIR EIYTK +D IDFS HRNTVCG+DLYYPH++ LD+AN 
Sbjct: 256 PVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANW 315

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
            +VFYEKYLR  +  + + +KVY+LIK EI NTD LCIAPVN AFCA+VT IEEGVDS  
Sbjct: 316 GMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHE 375

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           F +F+ RFKD LFHGPQGMT+MGTNGVQ WDCAFA+QY F+A LAE PEF   IV AYKF
Sbjct: 376 FNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAYKF 435

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCR+QFDTEC PGSFR+KR G W FSTKTQGYTV+DCTAE++KAIIMV+NSP F E  + 
Sbjct: 436 LCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNE 495

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           I+ ERL++ +D+LL+LQNVGSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVEC
Sbjct: 496 ISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVEC 555

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYFHK +D                    Q+ +GSWYGSWG+CFTYAGMFA+E
Sbjct: 556 TDSSVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFALE 615

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           AL+TVGENYENS  VRKGCDFLVS+QM+DGGWGES KSSELH+YV S +SLVVQ+AW++I
Sbjct: 616 ALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVI 675

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L  AEYP+K+VIDRGI+LLK+RQ  SGEWKFES+EGVFNHSC IEYPSY+FLFPIKALG
Sbjct: 676 GLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALG 735

Query: 721 MYAKAY 726
           +YAK Y
Sbjct: 736 LYAKRY 741

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1117 bits (2890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/732 (69%), Positives = 610/732 (83%), Gaps = 1/732 (0%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           MT+ YSE + L +TDP LWRLR D+LGRESWEY++ E A N+P S + QWLLQ P+F +P
Sbjct: 1   MTKLYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKP 60

Query: 61  QPG-RNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQ 119
            P   + ++  F+A +AC NGASF+QLLQDP SGIFPCQYKGPMF+TIGYV V+Y+AG++
Sbjct: 61  SPKIHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIE 120

Query: 120 IPEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKAR 179
           IP+ +R+E+IRYIVNT+HPVDGGWGLHS DKSTVFGT +NYV LRLLGLP+DHPVC KAR
Sbjct: 121 IPKPKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKAR 180

Query: 180 GTLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVY 239
            TL +LGGA+G+PHWGKIWLS LNLYKWEGVNPAPPETWLLPY LP+HPGRWWVHTR +Y
Sbjct: 181 RTLHKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIY 240

Query: 240 IPVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIAN 299
           +PVSYLSL+++ CP+TPLL+E+R+E+Y KPF+ IDF ++RNTVCGVDLYYPHS+ LD+ N
Sbjct: 241 LPVSYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMN 300

Query: 300 NFVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQ 359
           + +VFYEK+LR  +I +++K +VY LIK EI NTD LCIAPVNQAFCALVT IEEGV+S 
Sbjct: 301 SVLVFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSP 360

Query: 360 AFKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYK 419
            FK+FQ+RF DALFHGPQGMT+MGTNGVQTWDCAF IQ  F AGLAE+ ++Y T+V AY+
Sbjct: 361 QFKRFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYE 420

Query: 420 FLCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHH 479
           FL RAQF  ECVPGSFR+ RKG+WGFSTKTQGYTV+DCTAESIKAIIMVK SP +++VH 
Sbjct: 421 FLNRAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHS 480

Query: 480 LITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVE 539
           LI  ERL + IDVLLSLQNVG FEYGSFATYE IKAPL ME LNPAEVFGNIMVEYPYVE
Sbjct: 481 LIDDERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVE 540

Query: 540 CTDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAM 599
           CTDS+VLGLT FH + D                    Q+ DGSWYG WG+CFTYAGMFA+
Sbjct: 541 CTDSAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFAL 600

Query: 600 EALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWAL 659
           EALH+VGE+Y NS  V+KGCDFLV +QM DGGWGE+MKS ELH+YV+S +S+VVQ++W +
Sbjct: 601 EALHSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVI 660

Query: 660 IALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 719
           IAL  ++YPNK VIDR ++ L+ RQE SGEWKF+ VEGVFNHSCAIEYP+YRF+FPIKAL
Sbjct: 661 IALLLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKAL 720

Query: 720 GMYAKAYEQPGL 731
           G+Y  A+ +  +
Sbjct: 721 GLYVNAFGKEAI 732

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1077 bits (2784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/725 (70%), Positives = 580/725 (80%), Gaps = 1/725 (0%)

Query: 4   FYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQPG 63
            YSE +GLPKTD + WRL+TD LG E WEYL+  +A  +P S + ++LLQ P+F  P+P 
Sbjct: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61

Query: 64  RNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIPEH 123
            NK+S  F+A DA  NGA FF LLQ+  SGIFPCQYKGPMF+TIGYVA  Y A V IP  
Sbjct: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120

Query: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGTLL 183
            + EIIRYIVN++HPVDGGWGLH VDKST FGTV+NYVILRLLGL  D+ VC +AR TL 
Sbjct: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180

Query: 184 RLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVS 243
           RLGGA+G+PHWGK WLS LNLYKWEGVNPAPPE WLLPY+LP+HPGRWWVHTR +Y  + 
Sbjct: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240

Query: 244 YLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNFVV 303
           YLS  K+SCP+TPLLEEIR EIYT+PF+ IDFS  +N VCGVDLYYPH+R L+IAN  ++
Sbjct: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300

Query: 304 FYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAFKK 363
           FYEKYL+  +    S RKVY+LIK EI+NTD LCIAPV+ AFCA+VT IEEG DS  FK+
Sbjct: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360

Query: 364 FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFLCR 423
           F  RF+D LF GPQGMT+MGTNGVQ WDCAFAIQY+F+AGLAE PEF+ TI  AYKFLCR
Sbjct: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420

Query: 424 AQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLITS 483
           +QFDTEC PGSFR+KR G+W FSTKTQGYTV+DCTAES+KAIIMV+NSP F+ +   I+ 
Sbjct: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480

Query: 484 ERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECTDS 543
           ERL++ +DVLL+LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECTDS
Sbjct: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540

Query: 544 SVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAMEALH 603
           SVLGLTYF K +                     Q PDGSWYG WGICFTYAGMFA+EALH
Sbjct: 541 SVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEALH 600

Query: 604 TVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIALF 663
           TV E YENS  V+KGCDFLVSKQ  DGGW ESMKSSELHSYV+S  S  VQ+AWALI L 
Sbjct: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660

Query: 664 FAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMYA 723
            AEYPNKE+ID+GI LLK RQ ESGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG+YA
Sbjct: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720

Query: 724 KAYEQ 728
           K YE 
Sbjct: 721 KKYEH 725

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1070 bits (2768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/726 (67%), Positives = 579/726 (79%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           M E YSE IGLP+TDP+ WRL TD+LGR++WEYL+   +   P STF +WLL+  +F +P
Sbjct: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
            P  N  +  F+A++A HNGA FF+LLQDP SG FPCQYKGPMF+TIGYV   YIA ++I
Sbjct: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PEHE+ E+IRY+ N AHPVDGGWGLH VDKSTV GTVLNYV++RLLGLPKDH VC +AR 
Sbjct: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TLLRLGGAI SPHW KIWLS LNLYKWEGVNPAPPE W+LPY L +HP RWWVHTRG+Y+
Sbjct: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           PVSYLS  ++SC + PLLEEIR EIYT+PF+ IDF  HRNTVCGVDLYYPH++ LD  N 
Sbjct: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
           F+  YE+Y+R  ++   S  +VY+L+K EI NTD LCIAPVN AFCA+VT IEEG DS+ 
Sbjct: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           F +F YRFKD LFHGPQG+T+MGTNGVQ WDCAF IQY F+AGLAE PEF+ TIV ++KF
Sbjct: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCR+QF  +CV GSFR+KR G+W FSTKTQGYTV+DCTAE+IKAIIMV NS  + +V  +
Sbjct: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
             +E+L  GIDVLL LQN+ SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDSSVLGLTYF ++F+                    Q P+GSWYG WGIC+TYAGMFA+E
Sbjct: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660
           AL+T+GE YENS  VRKGCDF V+KQ+ DGGW E MKSSELH+YV   +S VVQ+AW LI
Sbjct: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660

Query: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L  A++P+K VIDR I LLK RQ+ SGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYAKAY 726
           +Y K Y
Sbjct: 721 LYVKEY 726

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1064 bits (2752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/725 (68%), Positives = 583/725 (80%), Gaps = 1/725 (0%)

Query: 3   EFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQP 62
           + Y++ +GLP TD  LWRLRTDELG E WEYL+ E+A  +P S++ ++LLQ+P+F  P+P
Sbjct: 2   KLYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPEP 61

Query: 63  GRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIPE 122
            R+    +F+A DA  NGA FF LLQ+  +GIFPCQYKGPMFLTIGYVA  Y A + +PE
Sbjct: 62  LRSSKCDEFTAGDAAFNGAQFFSLLQE-DTGIFPCQYKGPMFLTIGYVATLYCARIPVPE 120

Query: 123 HERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGTL 182
           H +IEIIRYIVN+AHPVDGGWGLH VDKST FGT +NYVILRLLGL  DH VC +AR TL
Sbjct: 121 HIKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARKTL 180

Query: 183 LRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPV 242
            RLGGAIG+PHWGK WLS LNLY+WEGVNPAPPE WLLPY+LP+HPGRWWVHTR VY  +
Sbjct: 181 HRLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQAL 240

Query: 243 SYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNFV 302
            YLS  K+ C +TPLL+EIRKEIY KPF+ IDFS H+NTV GVDLYYPH++ L+IAN  +
Sbjct: 241 GYLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANVAL 300

Query: 303 VFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAFK 362
             YE YL+  +    S RKVY+LIK EI+NTD LCIAPV+ AFCA+VT IEEG DS  FK
Sbjct: 301 TLYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYEFK 360

Query: 363 KFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFLC 422
           +F   F++ LF GPQGMT+MGTNGVQ WDCAFAIQY+F+AGLAE PEF +TI  AYKFLC
Sbjct: 361 RFVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKFLC 420

Query: 423 RAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLIT 482
           R+QFDTEC PGSFR+KR G+W FSTKTQGYTV+DCTAE++KAIIMV+NSP F+ +   I+
Sbjct: 421 RSQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGEIS 480

Query: 483 SERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECTD 542
            ERL++ +D+LL LQN GSFEYGSFATYEKIKA  A+E LNPAEVFGNIMVE+PYVECTD
Sbjct: 481 DERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVECTD 540

Query: 543 SSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAMEAL 602
           SSVLGLTYF K+++                    Q+PDGSWYG WG+CFTYAGMFA+EAL
Sbjct: 541 SSVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALEAL 600

Query: 603 HTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIAL 662
           +TVGENYENS  VRKGCDF  S+Q  DGGW ESMKSSELH+YV++  S VVQ+AWALI L
Sbjct: 601 YTVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALIGL 660

Query: 663 FFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMY 722
             A+YPN++VIDRGI LLK RQ  SGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG+Y
Sbjct: 661 LLAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALGLY 720

Query: 723 AKAYE 727
           +K YE
Sbjct: 721 SKRYE 725

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/727 (63%), Positives = 559/727 (76%), Gaps = 1/727 (0%)

Query: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60
           M E YS+ +GLP TDP  WRL    LG  SW+Y++   +   P    T+WLL   NFS P
Sbjct: 1   MVELYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTP 60

Query: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120
           +P       +F A++A +NGASF +LLQ+  SG FP QYKGPMF+TI YV   Y+   +I
Sbjct: 61  EPDVGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180
           PE E+IEIIRYIVNTAHPVDGGWGLH+  KSTVFGTVLNY++LRLLG+ KDH VC +AR 
Sbjct: 121 PECEKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARS 180

Query: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240
           TL RLGGAIG+PHWGKIWLS LNLYKWEGVNPAP E W LPY +P+HP RWW+HTR +Y+
Sbjct: 181 TLHRLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYL 240

Query: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300
           P+SYL  + ++C +TPLL+EIR EIYT  FD+I FS HRNTVC VDLY+PHS  L++ N+
Sbjct: 241 PMSYLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINS 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360
            +V+Y+ YLR  ++   S +KVY+LI+ EI NT+ LC+APV+ AFC++VT IEEG DS  
Sbjct: 301 AIVWYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPE 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420
           F++    F   +FHGPQGMT+MGTNG Q WDC+F +QY F+A LAE PEF + + +AYKF
Sbjct: 361 FERLMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKF 420

Query: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480
           LCR+QF  ECV GS+R+KR G W FSTKTQGYTV+DCTAE++KA+IMVK SPVF+ +H  
Sbjct: 421 LCRSQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDE 480

Query: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540
           I+ E L + IDVLLSLQNVGS EYGSFATYEKI+APL ME LNPAEVF NIMVEYPYVEC
Sbjct: 481 ISEEALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAME 600
           TDS +LGLTYF +++D                    Q  DGSWYG WGIC+TYAGMFA+E
Sbjct: 541 TDSCILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALE 600

Query: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGK-SLVVQSAWAL 659
           AL+T+GENYENS  VR+GCDFLV KQ+ DGGW ES+KS+EL  Y++  K SLVV ++WAL
Sbjct: 601 ALYTIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWAL 660

Query: 660 IALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 719
           I L  A+YP+KEVIDRGI+LLK+RQ  SGEWKFE +EG+FNHSCAIEYP+YRFLFPIKAL
Sbjct: 661 IGLLLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKAL 720

Query: 720 GMYAKAY 726
           G+YAK Y
Sbjct: 721 GIYAKKY 727

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/728 (61%), Positives = 559/728 (76%)

Query: 4   FYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQPG 63
            YS+ +GLP TD R WRL  DE+G E WEY+  ++ +  P +T  QWLL  P+F  P+P 
Sbjct: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61

Query: 64  RNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIPEH 123
            +     F+A +A +NGA F  LLQD  SG FPC Y+GPMF+TIGYV   ++ GV IPE 
Sbjct: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121

Query: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGTLL 183
           +R E++RY+VNTAHPVDGGWGLHS DKSTV GT LNYV+LRLLG+ ++H V  +AR TLL
Sbjct: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181

Query: 184 RLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVS 243
           R+GGAIGSP+WGK+WLS LNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR +++P+S
Sbjct: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241

Query: 244 YLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNFVV 303
           YL+ V++ C +TPLLEEIR EI+T+PF++IDF+ +RN VCG+DLYYPH+  L+  N  +V
Sbjct: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301

Query: 304 FYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAFKK 363
            YEKYLR  ++   S  ++Y+LIK EI+NTD LCIAPVN A  A+VT IEEG DS  F +
Sbjct: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361

Query: 364 FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFLCR 423
           F  RFK+ LF GPQGM +MGTNGVQ WDCAF IQ  F A L ++PEFY  IV AY+FLCR
Sbjct: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421

Query: 424 AQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLITS 483
           +Q   +CVPGS+R+ R G+W FSTKTQGY V+DCTAE+ K++++V+NSPVF EV   I+S
Sbjct: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481

Query: 484 ERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECTDS 543
           E+L + ID LL LQN+GSF+YGSFA+YEKI+APL++E LN AEVF NIMVE+PYVECTDS
Sbjct: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541

Query: 544 SVLGLTYFHKFFDXXXXXXXXXXXXXXXXXXXXQSPDGSWYGSWGICFTYAGMFAMEALH 603
           SVLGL+++ K+ D                    Q  DGSWYG WGIC+TYAGMFA+EALH
Sbjct: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601

Query: 604 TVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIALF 663
             GE+Y +S  V+KGC+FLVSKQ+ DGGW E+MKSSELH+YV   +S VVQ+AWALI L 
Sbjct: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661

Query: 664 FAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMYA 723
            A+YP+++VIDRGI+LLK RQ  SGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+Y+
Sbjct: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721

Query: 724 KAYEQPGL 731
           K Y +  L
Sbjct: 722 KKYAKDAL 729

>TPHA0D02200 Chr4 complement(454720..456270) [1551 bp, 516 aa] {ON}
           Anc_5.372 YDR329C
          Length = 516

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 24/124 (19%)

Query: 191 SPHWGKIWLSALNLYKWEGVNPAPPETWLLPYS-LPMHPGRWWV-----------HTRGV 238
           SP   K  LS+    + E +  A  +T L+  +        WW+            TR V
Sbjct: 245 SPDDNKDKLSS----EGENIEAADSKTKLMYINEQAFLSTSWWILNNGYLVFSELATRKV 300

Query: 239 ------YIPVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHS 292
                 Y P   LSL++FS  M+ +   I KE++T    +I+ S   N +   D++ P  
Sbjct: 301 DEYFSNYNPKDTLSLMEFSNNMSNIFHSINKELFTNNISEIETSQPINNIS--DIFLPED 358

Query: 293 RTLD 296
             +D
Sbjct: 359 SKID 362

>Smik_14.60 Chr14 (92155..95394) [3240 bp, 1079 aa] {ON} YNL278W
           (REAL)
          Length = 1079

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 41/102 (40%), Gaps = 18/102 (17%)

Query: 227 HPGRWWVHTRGVYIPVSYL-----SLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNT 281
           H  R W    GV I           L +FS P  P+ E+  KEI +KP            
Sbjct: 95  HAARKWKDVYGVLIGTQLALWDAKELAEFSDPSCPVSEKKLKEIASKP------------ 142

Query: 282 VCGVDLYYPHSRTLDIANNFVVFYEKYLRNRFIYSLSKRKVY 323
              ++L     RTLD ++N V+   K L N  + S + +  Y
Sbjct: 143 -TYINLTDATLRTLDTSDNIVMECGKNLTNALVVSTTLKNRY 183

>KNAG0E01270 Chr5 complement(247055..252427) [5373 bp, 1790 aa] {ON}
           Anc_5.14 YMR306W
          Length = 1790

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 192 PHWG-KIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVSYLSLVKF 250
           PH+  KI L    + K E +    P   +L Y   +HP  W    R   + +S L++ K 
Sbjct: 733 PHYAEKIMLELREIIKEESLKSKMP---VLEYLKQLHPKEWECFIRDTKLLMSELNISKD 789

Query: 251 SCPMTPLLEEIRKEIYTKPFDKIDFSNHRNT 281
             P T    E+R E   K F ++D +NH  T
Sbjct: 790 FLPKTD--SEVRIEA-AKQFSEVDSANHLET 817

>TPHA0A03110 Chr1 (684324..686762) [2439 bp, 812 aa] {ON} Anc_7.309
           YDL194W
          Length = 812

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 51/115 (44%), Gaps = 10/115 (8%)

Query: 98  QYKGPMFLTIGYVAVNYIAGVQIPEHERIEIIRYIVNTAHPVDGGWGLHSVDKST--VFG 155
           Q+ G  F  I Y  VN+ +   IP   RI  I Y VN A  V G + +    + T  ++G
Sbjct: 430 QFSGINF--IFYYGVNFFSRSGIPNSYRISFITYAVNVAFNVPGMFLVDYSGRRTLLIYG 487

Query: 156 TVL----NYVILRLLGLPKDHPVCTKARGTLLRLGGAIGSPHWGK-IWLSALNLY 205
            ++    N+VI   +G   D  V  K     + L  A  +  WG  +W+ +  LY
Sbjct: 488 GIVMAVSNFVIAG-VGTAVDTIVADKVMVAFICLFIASFACTWGSTVWVISAELY 541

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,268,399
Number of extensions: 3388393
Number of successful extensions: 7005
Number of sequences better than 10.0: 25
Number of HSP's gapped: 7062
Number of HSP's successfully gapped: 25
Length of query: 731
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 614
Effective length of database: 40,065,477
Effective search space: 24600202878
Effective search space used: 24600202878
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)