Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4453.497ON1123112356640.0
Suva_7.4223.497ON1127113045370.0
YGR134W (CAF130)3.497ON1122112544600.0
Smik_6.2303.497ON1124112544270.0
ZYRO0D09790g3.497ON1180119423600.0
NCAS0E007703.497ON1150115622690.0
TDEL0D056503.497ON1077111322500.0
KAFR0C020003.497ON1066106722380.0
SAKL0F02596g3.497ON1132112721090.0
Kpol_480.123.497ON1114114319530.0
KNAG0B007703.497ON1038109619080.0
KLTH0G02442g3.497ON1113110818950.0
AFR316W3.497ON1191120918980.0
Kwal_47.188863.497ON1105115018770.0
Ecym_12323.497ON1204117918550.0
NDAI0G009003.497ON127988918200.0
CAGL0I10428g3.497ON1163111216780.0
TBLA0C045103.497ON1307127216880.0
TPHA0A056803.497ON107484614800.0
KLLA0E03961g3.497ON113210209691e-112
Suva_2.4088.467ON54940735.6
YDR242W (AMD2)8.467ON54952736.4
YHL003C (LAG1)2.501ON41157719.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.445
         (1123 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...  2186   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...  1752   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...  1722   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...  1709   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   913   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   878   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   871   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   866   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   816   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   756   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   739   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   734   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   735   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   727   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   719   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   705   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   650   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   654   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   574   0.0  
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   377   e-112
Suva_2.408 Chr2 (726244..727893) [1650 bp, 549 aa] {ON} YDR242W ...    33   5.6  
YDR242W Chr4 (946807..948456) [1650 bp, 549 aa] {ON}  AMD2Putati...    33   6.4  
YHL003C Chr8 complement(100648..101883) [1236 bp, 411 aa] {ON}  ...    32   9.3  

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score = 2186 bits (5664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1081/1123 (96%), Positives = 1081/1123 (96%)

Query: 1    MTKKKIATNDVERQLLLGDNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNESIL 60
            MTKKKIATNDVERQLLLGDNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNESIL
Sbjct: 1    MTKKKIATNDVERQLLLGDNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNESIL 60

Query: 61   DDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQGW 120
            DDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQGW
Sbjct: 61   DDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQGW 120

Query: 121  KDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKD 180
            KDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKD
Sbjct: 121  KDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKD 180

Query: 181  YLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSD 240
            YLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSD
Sbjct: 181  YLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSD 240

Query: 241  NFDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIP 300
            NFDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIP
Sbjct: 241  NFDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIP 300

Query: 301  NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQL 360
            NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQL
Sbjct: 301  NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQL 360

Query: 361  FLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHW 420
            FLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHW
Sbjct: 361  FLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHW 420

Query: 421  RTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVI 480
            RTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVI
Sbjct: 421  RTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVI 480

Query: 481  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFM 540
            LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFM
Sbjct: 481  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFM 540

Query: 541  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 600
            SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED
Sbjct: 541  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 600

Query: 601  YNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGX 660
            YNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISG 
Sbjct: 601  YNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGN 660

Query: 661  XXXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYY 720
                         IPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYY
Sbjct: 661  SNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYY 720

Query: 721  SPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFA 780
            SPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFA
Sbjct: 721  SPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFA 780

Query: 781  EIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLM 840
            EIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLM
Sbjct: 781  EIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLM 840

Query: 841  CTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRK 900
            CTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRK
Sbjct: 841  CTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRK 900

Query: 901  NEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXXXXXXISLYSLGLV 960
            NEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFL              ISLYSLGLV
Sbjct: 901  NEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEEENEDGEKISLYSLGLV 960

Query: 961  KLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEEXXXX 1020
            KLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEE    
Sbjct: 961  KLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEEDSDK 1020

Query: 1021 XXXXXXXXXXLEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDT 1080
                      LEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDT
Sbjct: 1021 DGQQNDDNKDLEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDT 1080

Query: 1081 QITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE 1123
            QITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE
Sbjct: 1081 QITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE 1123

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score = 1752 bits (4537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 857/1130 (75%), Positives = 959/1130 (84%), Gaps = 10/1130 (0%)

Query: 1    MTKKKIATNDVERQLLLG--DNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNES 58
            M KKK ATND E Q+L    ++S  +  RY QF+ LQ LLKD++Y PS+ENLEKLLY+E+
Sbjct: 1    MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET 60

Query: 59   ILDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQ 118
            IL+DQ+IR  +LFEALS+ LFTTKSGKSILQ ++AST KE+K W +S  + DSNYAS+++
Sbjct: 61   ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR 120

Query: 119  GWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNML 178
             WK++DVL LKFLRF+LANKTT LQID+YNLP+YKLPLSFLIVSK+N PSIILNEG+NML
Sbjct: 121  SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML 180

Query: 179  KDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEF 238
            KDYLY++SGR++ LI  NS   +SA + K  L+ YDR++EF N YFWYSF+ E +   + 
Sbjct: 181  KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL 240

Query: 239  SDNFDLLMNSPEDHADG-GVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTL 297
            + N +LLM+S ED+ DG   +DD  KSDN QK  K+TII RT+NDQEQIYSFEL+QDGTL
Sbjct: 241  NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL 300

Query: 298  QIPNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFL 357
            QIPN+MEHSL+RHELLFKILNL  VLTPLLE QF  LCGLVDPL QP+PND+ +ISIDFL
Sbjct: 301  QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360

Query: 358  FQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSV 417
            +QLFLGLMYPSIK+SQEHN+HYDWKFY CFNMQKIIDATMLRLNC  FE+LNS+NNTD  
Sbjct: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT 420

Query: 418  IHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLS 477
            +HWRTQLH WLPHGLNTQDLELLYMIDILA+YTIYKLYE+IPIQLNPFLFSLLSLWKNLS
Sbjct: 421  VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS 480

Query: 478  CVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLN 537
            CVILLALEIDRIEEE GTYETPLMVRATIRGAAALRSVIA+VLNGLVKSNDHDFKHESLN
Sbjct: 481  CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN 540

Query: 538  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 597
            TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE
Sbjct: 541  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 600

Query: 598  CEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEI 657
            CEDYNE FS+  DE+L E  NS  K K+S  NGFYQRRCNCIFNDDKLVAEDG N +   
Sbjct: 601  CEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANAS--- 657

Query: 658  SGXXXXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFN 717
            +                 +TA TN+N   SSINP SVRSRSTFEFDYSGEDWRDVPKDFN
Sbjct: 658  TNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFN 717

Query: 718  MYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGS 777
            +YYSPSYSFIQEPKLD+IFNLTLRGATEKL+R++S++LV SVASCVKNEQDQMIL+DLGS
Sbjct: 718  IYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGS 777

Query: 778  NFAEIDENPEAKSSNNIT-KTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMD 836
            NF  I EN E   +   + KTN+EELRRTTPDDIYEIWSEESAFERML VNHDVAWRLMD
Sbjct: 778  NFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMD 837

Query: 837  EMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILK 896
            EMLMCTGYRRILIWFLTHLELKHSLIYYVFEL+MGLRG PFSGEASDQDRKDDMIYEILK
Sbjct: 838  EMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILK 897

Query: 897  KKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXXXXXXISLYS 956
            KK+KNE+ SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFL              +SLYS
Sbjct: 898  KKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSLYS 957

Query: 957  LGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEE 1016
            LGLVKLICYMVQTLIANDKF FTKSECTFELQTLLMTWIG+LPEAKDLFFQIK+RLAMEE
Sbjct: 958  LGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEE 1017

Query: 1017 XXXXXXXXXXXXXX---LEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFI 1073
                             L+  ++P+TKS S+LN+K+L+LFPSNP  N+DNSAISTLRSFI
Sbjct: 1018 DGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFI 1077

Query: 1074 TDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE 1123
            TDY FDTQ+  PGR+VVF+D KILPL KADKPIPLHEYITLAE+D+G+SE
Sbjct: 1078 TDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE 1127

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score = 1722 bits (4460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 849/1125 (75%), Positives = 955/1125 (84%), Gaps = 5/1125 (0%)

Query: 1    MTKKKIATNDVERQLLLGDNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNESIL 60
            MTKKK ATN  ERQ L  ++SS D++ ++ F+PLQ LLKDKNYVPS+ENLEK+LYNE++ 
Sbjct: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF 60

Query: 61   DDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQGW 120
            +DQKI  ++L EAL I LFTT SGKS L+ +Q S+LKE+K WAQS  ++ S+YAS+V  W
Sbjct: 61   NDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSW 120

Query: 121  KDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKD 180
            KDND+L LKFLRFLLANKT  LQI++YNLPEYKLPLSFLIVSKI  PSI+LNE +N+LKD
Sbjct: 121  KDNDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKD 180

Query: 181  YLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSD 240
            YLYS++GRI+ LI  +S   + ALVV+KILKDY+R++E  N YFWYSFN EN VN  FSD
Sbjct: 181  YLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTFSD 240

Query: 241  NFDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIP 300
            N  LLM + E +A  G+ D R    + QK  +  I+ RTINDQEQIYSFEL+QDGTL+IP
Sbjct: 241  NISLLMENDEGNAGSGLDDSRF---DHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIP 297

Query: 301  NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQL 360
            N+MEHSL+RHELLFKILNL +VLTPLLELQF  LCGLVDPLMQP+PND+ +ISIDFLFQL
Sbjct: 298  NVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQL 357

Query: 361  FLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHW 420
            FLGLM  SIK+SQEHNDHYDWKFY CFNMQKIIDATMLRLNC DF+ LNSVNNTD+ +HW
Sbjct: 358  FLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHW 417

Query: 421  RTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVI 480
            +TQLH+WLPHGLNTQDLELLYMIDILA+YTIYKLYEKIPIQLNPFLFSL+SLWKNLSCVI
Sbjct: 418  KTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVI 477

Query: 481  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFM 540
            LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIA+VLNGLVK+NDHDFKHESLNTFM
Sbjct: 478  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFM 537

Query: 541  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 600
            SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED
Sbjct: 538  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 597

Query: 601  YNEPFSESDDEQLNED-ANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISG 659
            Y+E FSESD   L+E   N   KI S S+N F++RRCNCIFNDDKLVAEDG NEAF  + 
Sbjct: 598  YDESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTN 657

Query: 660  XXXXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMY 719
                          + +  T  S+   +S NPLSVRSRSTFEFDYSGEDWRDVP+DFNMY
Sbjct: 658  SENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMY 717

Query: 720  YSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNF 779
            YSPSYSFI EPKLDVIF+LTLRGATEKLN+++SI+LV SVASCV+NEQDQMIL+DL SNF
Sbjct: 718  YSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNF 777

Query: 780  -AEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM 838
             A I+ + E + +  ++K +NE+LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM
Sbjct: 778  SASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM 837

Query: 839  LMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKK 898
            LMCTGYRRILIWFLTHLELKHSLIYYVFEL+MGLRGKPFSGEASDQD+KDDMIYEILKKK
Sbjct: 838  LMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKK 897

Query: 899  RKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXXXXXXISLYSLG 958
            +KNED SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFL              ISLYSLG
Sbjct: 898  QKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNNEEENEDGEKISLYSLG 957

Query: 959  LVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEEXX 1018
            LV+LICYMVQTLIANDKF FTKSECTFELQTLLMTWIG+LPEAKDLFF+IKTRLAMEE  
Sbjct: 958  LVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEED 1017

Query: 1019 XXXXXXXXXXXXLEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPF 1078
                         ++E++ + K  SELN+KLLNLFPS PA  +D+S I+TLRSFI DY F
Sbjct: 1018 SADTMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYSF 1077

Query: 1079 DTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE 1123
            DTQ+ PPGR+VVFYDGKILPL KADKPIPLHEYITLAE+DVG+SE
Sbjct: 1078 DTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE 1122

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score = 1709 bits (4427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 836/1125 (74%), Positives = 957/1125 (85%), Gaps = 3/1125 (0%)

Query: 1    MTKKKIATNDVERQLLLGDNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNESIL 60
            MTKKK   N V++ +L G + S  ++  E+FVPLQ LLKDKNYVPS+ENLEK+L +E++L
Sbjct: 1    MTKKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDETML 60

Query: 61   DDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQGW 120
            +DQK+R S+LFEAL+I LFTT SGKSILQ++Q  T K++KLWAQS  +++SNYAS+V  W
Sbjct: 61   NDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSW 120

Query: 121  KDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKD 180
            KDND+L LKF+RFLLANKT  L+ID+YNLPE+KLPLSFLIVSKIN PSI+LNEG+N+LKD
Sbjct: 121  KDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKD 180

Query: 181  YLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSD 240
            YLYS++GRI+ L+  +   ++ ALVVK+ LKDYDR++E  N Y WY FN EN  + +F D
Sbjct: 181  YLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKFDD 240

Query: 241  NFDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIP 300
            N   LM S E++ + G+ D R  ++N  K  K+ ++ RTINDQEQIYSFEL+ DGTL+IP
Sbjct: 241  NIACLMGS-ENNTENGLGDSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTLEIP 299

Query: 301  NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQL 360
            N+M+HSL+RHELLFKILNL  V TPLLELQF  LCGLVDPLMQP+PND+ +ISIDFLF+L
Sbjct: 300  NVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKL 359

Query: 361  FLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHW 420
            FLGLMYP+IKSSQ HNDHYDWKFYTCFNMQKIIDATM RLNC DF  LNSVNNTDS +HW
Sbjct: 360  FLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHW 419

Query: 421  RTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVI 480
            RTQLH+WLPHGLNTQDLELLYMIDILA+YTIYKLYEK+PIQLNPFLFSL+SLWKNLSCVI
Sbjct: 420  RTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVI 479

Query: 481  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFM 540
            LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIA++LNGLVK+N+HDFKHESLNTFM
Sbjct: 480  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFM 539

Query: 541  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 600
            SPYGRKL HGALYADLRSH+ASLLA G SIEDVTDLFADLQSGDRFDEDIRYMFDYEC D
Sbjct: 540  SPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECAD 599

Query: 601  YNEPFSESDDEQLNED-ANSRGKIKSSSSNG-FYQRRCNCIFNDDKLVAEDGTNEAFEIS 658
            Y+E FSESDDE L E   N+R KIKSS+ N  F QRRCNCIFNDDKLVAEDG NE FE +
Sbjct: 600  YDESFSESDDEGLEEGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFEST 659

Query: 659  GXXXXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNM 718
                           + +TA T SN  ++SINP SVR+RSTFEFDYSGEDWRDVP+DFNM
Sbjct: 660  CNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNM 719

Query: 719  YYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSN 778
            YYSPSY FI +PKLDVIFNLTLRGATEKLNR++SI+LV SVASCVKNEQDQM+L+DL +N
Sbjct: 720  YYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTN 779

Query: 779  FAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM 838
               I ++ E ++S +I+KT+NEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM
Sbjct: 780  LTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM 839

Query: 839  LMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKK 898
            LMCTGYRRILIWF THLELKHSLIYYVFEL+MGLRGK FSG+ASDQD+KDDMIYEILKKK
Sbjct: 840  LMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKK 899

Query: 899  RKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXXXXXXISLYSLG 958
            +KN+D S LPFSRQGPI+LSDIETKMLLQEFFMNAAIFL              ISLYSLG
Sbjct: 900  QKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLSSNNSEEENEDGEKISLYSLG 959

Query: 959  LVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEEXX 1018
            LV+LICYMVQTLI NDKF FTKSECTFELQTLLMTWIG+LPEAKDLFF+IKTRLAMEE  
Sbjct: 960  LVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEEDN 1019

Query: 1019 XXXXXXXXXXXXLEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPF 1078
                        L++E++ +TK  S+LN+KLL+LFPSN A N +NSAI+TLR+FITDY F
Sbjct: 1020 DTGTMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSF 1079

Query: 1079 DTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE 1123
            DTQ+ PPGRKVVFYDGKILPL+KADKPIPLHEYITLAE+DVG+SE
Sbjct: 1080 DTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE 1124

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/1194 (42%), Positives = 725/1194 (60%), Gaps = 106/1194 (8%)

Query: 1    MTKKKIATNDVERQLLLGDNSSNDALRYEQFVPLQVLLKDKN------------------ 42
            M KK+ +  +         N + + +  E+++PL  L KD++                  
Sbjct: 1    MVKKRKSKTNSSNVTESAFNGNGNNINKEEYIPLGAL-KDEDMLDLKMISLEELLAEREL 59

Query: 43   -YVPSLENLEKLLYNESILDDQKIRLSILFEALSIILFTTKSGKSILQAVQAS------- 94
             Y    E L++LL +     D +++ S+L E + + L TT++G S+L  ++ S       
Sbjct: 60   DYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIP 119

Query: 95   -TLKEKKLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYK 153
              +  ++ W   +      ++ ++  W+ +D +FLKFL FLL N+   L  +  N  E+K
Sbjct: 120  KCISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWK 179

Query: 154  LPLSFLIVSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDY 213
            +PLSFLI SK     +IL+  +N+L DY  ++    +  +R  +I+  + + +K+ + +Y
Sbjct: 180  VPLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLR-RAISYGNGVHLKRTVINY 238

Query: 214  DRIVEFHNLYFWYSFN--------VENDVNFEFSDNFDLLMNS-----PEDHADGGVIDD 260
            +R+ +F   + WY+          V   + F+  D+ D  + +       D  +   I D
Sbjct: 239  NRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIID 298

Query: 261  RCKS------------------DNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIPNI 302
            + +S                  D       +      +N  EQ++SF+L+QDG+L++PN+
Sbjct: 299  QIRSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNL 358

Query: 303  MEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFL 362
            M H+ +RHE+L K+L L +  +PLL+LQF  + GLVDPL QP+PND+ VIS+D L+Q+FL
Sbjct: 359  MSHAAVRHEILMKVLKLNNSSSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFL 418

Query: 363  GLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHWRT 422
            G + P I+ + E  +  DW+F+ CFNMQKIIDA+++RLN  DFERLNS+NN+D  + WR+
Sbjct: 419  GFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRS 478

Query: 423  QLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILL 482
            QL KWLPHG NTQDLEL+ M+DI+A+YTIYKLYE +PIQLNPFL SL+SLWKNL+CVILL
Sbjct: 479  QLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILL 538

Query: 483  ALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSP 542
             LEIDRIEEE  T++TPLMVRATIRGAAALR+++A+VLNG V++  HD KHESLNTFMSP
Sbjct: 539  GLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSP 598

Query: 543  YGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYN 602
            +GRKLC GALYA+LRSH A+LLALG+ +EDVT LF+DLQ GDRFDED+RYMF+YE EDYN
Sbjct: 599  HGRKLCQGALYAELRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYN 658

Query: 603  EPFS-ESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGXX 661
            +  S E D    ++  +     K+ +  GF  RRCNCIF+          +E  E     
Sbjct: 659  DLSSREEDYSGFDKYDDYTDSSKTHARKGF-GRRCNCIFD---------DDEMLEDEDYE 708

Query: 662  XXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYS 721
                        +P    T S   +++  P ++RS  +FEFDYSG+DWRD+P+  N+YYS
Sbjct: 709  NEYEGHKAPKQILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYS 768

Query: 722  PSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAE 781
            P+Y F+++   + I +LT +   + L++ +S++L+ SVA+CVKNEQD+++L     N  E
Sbjct: 769  PNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVL----GNITE 824

Query: 782  IDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMC 841
            +     ++ S  I K     L+  +PDDIYE+W ++S FE+M+  NH+VAWRLMDEMLMC
Sbjct: 825  LHHQNGSRGSQVIDK-----LKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMC 879

Query: 842  TGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKN 901
            +G+RR+LIWF+TH+EL HSLI+Y+FELVMGLR K F  E ++ D  D+ I E+ K+    
Sbjct: 880  SGFRRVLIWFITHMELNHSLIHYIFELVMGLR-KSFD-ENNENDNGDESISEMTKEAP-- 935

Query: 902  EDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXX------------XXXXXXXX 949
            E  + LPFSRQG I LS IETKMLLQEFF NAAIFL                        
Sbjct: 936  EVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPMEDEATINDGEN 995

Query: 950  XXISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIK 1009
              +SLY++GL+KLIC MV+  I   KF F +SEC FELQTLLM WI ++PEAKDLFF++K
Sbjct: 996  GNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELK 1055

Query: 1010 TRLA------MEEXXXXXXXXXXXXXXLEVERRPHTKSN----SELNVKLLNLFPSNPAG 1059
              +A      M++                +    +   N    SE N KL++L       
Sbjct: 1056 ALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHR 1115

Query: 1060 NNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHEYIT 1113
              +N+A+  LR+FI  Y FDT +   GRKVV+   +ILPL +++ P+ L +Y+ 
Sbjct: 1116 KEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYLV 1169

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1156 (42%), Positives = 700/1156 (60%), Gaps = 109/1156 (9%)

Query: 31   FVPLQVLLKDKNYVPSLENLEKLLYNESILDDQKI--RLSILFEALSIILFTTKSGKSIL 88
            + PL+ L  ++NY PSL  L  LL ++++L++       S+L E + I   +T+SGK + 
Sbjct: 31   YTPLRELFAERNYQPSLSQLLNLLSDDALLNNLTPIQEHSLLVECVIIGFLSTRSGKLLQ 90

Query: 89   QAV-----QASTLKEK--KLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTS 141
             A+     Q  T  E   K W  S     + +  + + W  N + FLKF +FLL N   +
Sbjct: 91   SALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNKLYFLKFTKFLLVNADGN 150

Query: 142  LQIDKYNLPEYKLPLSFLIVSKINF-PSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITS 200
            + +DKY  P YKLPL+FL     N  P+ IL+  +N+L+DY+Y+    + C+++ +++ +
Sbjct: 151  INVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYACGPLLKCVMK-DTLEN 209

Query: 201  RSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSDNFDLLMNSPEDHADGGVIDD 260
               L +  I   Y   ++    Y WY                DLL    E H +    ++
Sbjct: 210  GICLDLPGI---YKLDIDLQFPYPWY----------------DLLPPMHEGHLNATKQNN 250

Query: 261  RCKSDN---PQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHELLFKIL 317
               S+N     + +  T      N+ + +YSF+L+ D T ++ N++ H+  RH +L +++
Sbjct: 251  --NSNNIPLTMQPSIKTNNNGANNNNQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLI 308

Query: 318  NLPSV-LTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHN 376
            N   +  TPLL LQF  + GLVDPL QP PN++QVIS+  L+ +F+GLMYP++K     N
Sbjct: 309  NNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNAN 368

Query: 377  DHYDWKFYTCFNMQKIIDATMLRLNCSDFERL------------NSVNNTDSVIHWRTQL 424
            D ++WKF+ CFNM K+I+ +M+ L C +F +L             + N+ D    W+ +L
Sbjct: 369  DGFNWKFHICFNMVKLINNSMVILKCDNFNKLNDIINSNNDNDEGTENDDDDA--WKLKL 426

Query: 425  HKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLAL 484
            ++W+PHG+NTQDLEL+YMI+I+A+YTIY+LY  +PIQ+NPFL  L++LWKNLS +ILL L
Sbjct: 427  NEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGL 486

Query: 485  EIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYG 544
            +IDR EE   T+ TPL+VRATIRGAA+LR+V+A++LN  V  N+HDFKHE LNTFMSP+G
Sbjct: 487  DIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHG 546

Query: 545  RKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNEP 604
            RKLC GALYAD+RSH A++LALGA +EDVTDL  DLQ+GDRFDEDIRYMFDYE +DYN+ 
Sbjct: 547  RKLCQGALYADIRSHAAAILALGAELEDVTDLLTDLQAGDRFDEDIRYMFDYEYDDYND- 605

Query: 605  FSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGXXXXX 664
            F +  +EQ           +     G + RRCNCIF DD ++ +D  N            
Sbjct: 606  FKDDVEEQ-----------EEMEIMGSFPRRCNCIFEDDNIINDDTDNINENDEDDDDEQ 654

Query: 665  XXXXXXXXXIPSTATTNSNRFASSI-----NPLSVRSRSTFEFDYSGEDWRDVPKDFNMY 719
                     +      N+     +I     +P S RS+S+FEFDY G+DWRD+P+ FN+Y
Sbjct: 655  EEYVDAIEGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLY 714

Query: 720  YSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNF 779
            YSPSY FI+ P ++ I  LT +   EKL  +DS +L+ +VASC+K EQD+MI        
Sbjct: 715  YSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISK------ 768

Query: 780  AEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEML 839
             E+ ++   K  +     ++ + +  TPDDIY++WSEES FERML +N DVAWRLMDEML
Sbjct: 769  -ELLKHNTVKHPHAAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEML 827

Query: 840  MCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKR 899
            MC GYRR+LIWF+TH+EL HSLI Y+FELVMGLRG PFSGE  + D K+D+++EI+  + 
Sbjct: 828  MCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQV 887

Query: 900  KNEDV----SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXX-------- 947
            KN+++    + LPFSRQGP++LS+IE KMLLQEFF NAAI+                   
Sbjct: 888  KNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSNNEGTTNNDNGEGI 947

Query: 948  --XXXXISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLF 1005
                   S+YS GLVKLIC+MVQ+L+ N+KF F KSECTFELQTLLM WIG++PEA+DLF
Sbjct: 948  DEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLF 1007

Query: 1006 FQIKTRLAMEEXXXXXX-------------------XXXXXXXXLEVERRPHTKSNSELN 1046
            F +K+ ++                                     + +  P   + S  N
Sbjct: 1008 FTLKSGVSSSSTKTGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSP--PNESIFN 1065

Query: 1047 VKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPI 1106
             +L++L P      ++N+A+STLR FI  Y FD +    GRKVV+ D  +LPL  AD+PI
Sbjct: 1066 KRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPI 1125

Query: 1107 PLHEYITLAEIDVGES 1122
              HEY+T  + ++ E+
Sbjct: 1126 SFHEYLTELDDEIREN 1141

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1113 (44%), Positives = 676/1113 (60%), Gaps = 96/1113 (8%)

Query: 33   PLQVLLKDKNYVP--SLENLEKLLYNESILDDQKIRLSILFEALSIILFTTKSGKSILQA 90
            PL  LL + N  P   +E L + L  E +L + + R S++ E L I LFTT++G S+L  
Sbjct: 11   PLHELLVEANLQPLKGVEGLAEALREEKVLKNDQWRPSLICETLIIALFTTRAGISLLPL 70

Query: 91   VQASTLKEKKLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLP 150
               S  K K++  + L             W +++ L L+F  ++L N+++ ++   +   
Sbjct: 71   FSESA-KRKRVGPRVLE------------WHNDEELMLRFFSYILENRSSRIEPRLFEKA 117

Query: 151  EYKLPLSFLIVSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKIL 210
             +KLPL FLI SK    S++L++ +N+L DY+++++  I   +         A       
Sbjct: 118  RWKLPLFFLIESKFLAASMVLDQNYNLLLDYVHTITPMIKRWVH-------RAFTQGTFF 170

Query: 211  KD----YDRIVEFHNLYFWYSFNVENDVNFEFSDNFDLLMNSPEDHADGGVIDDRCKSDN 266
            KD    Y+R+ E  +   WYSF  +   N E       L  + E   D     +  +  N
Sbjct: 171  KDTVVCYNRVYELKDSSEWYSFGTKKS-NEERRAIQQFLRENSEQVLD--TYHEMVRPSN 227

Query: 267  PQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHELLFKILNLPSVLTPL 326
             +           I+  E +YSF+++QDG+L+IPNIM H+ +RH++L  ++ LP   +PL
Sbjct: 228  ERAINDTASYHHRISQHENVYSFDINQDGSLEIPNIMSHASVRHDILQNLMRLPLCDSPL 287

Query: 327  LELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTC 386
            L+ QF  + GLVDPL QP PND+ +IS+D L+Q+ LGLM P+I S+   +D  DWKF+ C
Sbjct: 288  LQWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQMLLGLMEPAI-SNTLGSDGCDWKFHLC 346

Query: 387  FNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDIL 446
            FNMQKII A++ RLN  DF+ LNS+NN+D  + WR  LH WLPHGLNTQ+LEL+YMIDIL
Sbjct: 347  FNMQKIIQASLKRLNLQDFDTLNSINNSDEDVSWRDNLHSWLPHGLNTQNLELIYMIDIL 406

Query: 447  AIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATI 506
            A+YTIYKLYE +P+QLNPFL  ++SLWKNL+CVILL LEIDR EEE+ T+ETP++VRATI
Sbjct: 407  AVYTIYKLYEDLPVQLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFETPVLVRATI 466

Query: 507  RGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLAL 566
            RGAAALR+V+A++LNG V +  HDF HE LNTFMSP+GRKLC GALYADLRSH A+LLAL
Sbjct: 467  RGAAALRAVVATILNGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLRSHAAALLAL 526

Query: 567  GASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSS 626
            G  +EDVT+L ADLQ+GDRFDED+RYMF+YEC++YNE  SES+ +         GK+   
Sbjct: 527  GTELEDVTNLLADLQAGDRFDEDVRYMFEYECDNYNEGDSESEKD---------GKLAVE 577

Query: 627  SSNGFYQRRCNCI---FNDDKLVAEDGTN-EAFEISGXXXXXXXXXXXXXXIPSTATTNS 682
                  QRRCNCI       +    DG N EAF                  I       S
Sbjct: 578  QPK-ILQRRCNCIFDDDEMAEDEDFDGENDEAF-------------FSKHLILQQNAQTS 623

Query: 683  NRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRG 742
               +SS  P +VRS   FEFDYSG+DWRD+P+  N YYSP + FI+ P L  +  LT + 
Sbjct: 624  LSMSSSGKPRAVRSGGAFEFDYSGKDWRDIPRGSNFYYSPDFEFIESPSLSSLLALTKKA 683

Query: 743  ATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNNEEL 802
            ++EKL   +S+ L+ SVASCVKNEQD++ L +L     +   + E+++++ I        
Sbjct: 684  SSEKLVEKESLTLLRSVASCVKNEQDEITLGNLIDPHQDSQADEESRNADKI-------- 735

Query: 803  RRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLI 862
                PDDIYE+W E S FE+++  NH +AW+LMDEML+C GYRR+LIWF+TH+EL HSLI
Sbjct: 736  ---EPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLI 792

Query: 863  YYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIET 922
            +Y+FELVMGLRG      + + DR  D+    L+   K +    + FSRQG + LS IET
Sbjct: 793  HYIFELVMGLRGN-----SDENDRDVDLAGPPLQDVDKVKGELSVGFSRQGALQLSTIET 847

Query: 923  KMLLQEFFMNAAIFLXXXXXXXXXXX--------------XXXISLYSLGLVKLICYMVQ 968
            KMLLQEFF NAAIF+                            +SLY++GL+KLIC+MV+
Sbjct: 848  KMLLQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGNSENVSLYAMGLMKLICFMVR 907

Query: 969  TLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLA------MEEXXXXXX 1022
            T I  +KF F++SEC FELQ LLM WIG++PEAK LFF++K+ +A        +      
Sbjct: 908  TFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGFSTATSVQEQKNAE 967

Query: 1023 XXXXXXXXLEVERRPHTKSNS---ELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFD 1079
                    +  E+ P   SN+   E N KL+ L P       +N+A+ TLRSFI    F 
Sbjct: 968  VKNDTQEDVPKEQSPVRVSNTAGFEFNRKLMTLLPPLVKNKEENAAMQTLRSFIKTSSFL 1027

Query: 1080 TQITPPGRKVVFYDGKILPLSKADKPIPLHEYI 1112
              +   GRK+V+ D KILPL K+D P+ LHEYI
Sbjct: 1028 NTVPVIGRKIVYEDDKILPLPKSDVPLALHEYI 1060

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1067 (46%), Positives = 671/1067 (62%), Gaps = 95/1067 (8%)

Query: 68   SILFEALSIILFTTKSGKSILQAVQ-----ASTLKEKKLWAQSLRDDDSNYASVVQG-WK 121
            S+L E L I LFTTKSG SIL  +      +   +    W +S    D NY  +    W+
Sbjct: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLES-SSGDLNYKYLKHELWQ 109

Query: 122  DNDVLFL-KFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILN-EGHNMLK 179
             N   +L +F +FLL N+     ++ Y+L +YKL L  LI S+ N  S+ILN + +N+L 
Sbjct: 110  SNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSDNYNLLL 169

Query: 180  DYLY----SMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVN 235
            D++      M+  I  ++ GN           +I+  Y+RI E +  + WY+  + ++ +
Sbjct: 170  DFIMFFQPYMNDLISYIVEGNKFF--------EIIAKYNRIYELNGFHTWYTLTIASNTS 221

Query: 236  FEFSDNFDLLMNSPEDHADGGVIDDRCKS---DNPQKHAKNTII---KRTINDQEQIYSF 289
                   D+L   P       +I D+  S   D   + ++ T++   ++T  D + I+SF
Sbjct: 222  IAVRYLNDVLSIDP-------MITDQFTSNYRDKAFQESEETLLMSQQQTAKD-DIIFSF 273

Query: 290  ELDQDGTLQIPNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDE 349
            +L++ G L  PN+++HS MRH++++ ILNL  + +P L+ QF  +CGLVDPL QP PN+E
Sbjct: 274  DLNETGDL--PNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQPNNE 331

Query: 350  QVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLN 409
             +ISID ++QLF+GLMY    +     D     F  CFNMQKII  +++ LNC+D++ L+
Sbjct: 332  HIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLS 391

Query: 410  SVNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSL 469
            ++ N D    ++T L+KWLPHG+NTQDLEL+YMI+I+AIYTIYKLY  +PIQLNPFL +L
Sbjct: 392  TILN-DFPNDYKTALNKWLPHGINTQDLELIYMINIIAIYTIYKLYSNLPIQLNPFLQTL 450

Query: 470  LSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDH 529
            +SLWK LS ++L+ LEIDRIEE N TY+TP++VRATIRGAAALR+VIA++LN  V + +H
Sbjct: 451  VSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEH 510

Query: 530  DFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALG-ASIEDVTDLFADLQSGDRFDE 588
            DFKHES NTFMSP+GRKLC GAL ADLRSH A++LALG   + DVT+L ADLQ+GDRFDE
Sbjct: 511  DFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDE 570

Query: 589  DIRYMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAE 648
            D++Y+F+YE +DYNE   E  DEQ NE       ++        +RRCNCIF DDK++ +
Sbjct: 571  DVKYIFEYEYQDYNELGEE--DEQTNE-------LEELEKRSVKKRRCNCIFEDDKMLED 621

Query: 649  DGTNEAFEISGXXXXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGED 708
                E +E+                       N     S  NP SVR  S FEFDYSG+D
Sbjct: 622  ---YEYYEVGNE--------------SRREDMNLESDKSRTNPYSVRVNSIFEFDYSGKD 664

Query: 709  WRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQD 768
            WRDVP+ FN+YYSPSY FI+ PKL  + + TL+  TEKL+ +DS++L+ SVASCVK EQ+
Sbjct: 665  WRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLLQSVASCVKLEQE 724

Query: 769  QMILSDLGSNFAEIDENPEAKSSNNITKTNNEEL-RRTTPDDIYEIWSEESAFERMLNVN 827
            +MIL +                SN    +  E+L R  TPDD+YEIW EESAFERM+ +N
Sbjct: 725  KMILENY---------------SNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLN 769

Query: 828  HDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDR- 886
             +VAWRLMDEMLMC GYRR+L+WF+TH+E+ HSL++Y+FELVMGLRG+         DR 
Sbjct: 770  KEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRL 829

Query: 887  KDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXX-XXXXX 945
            K  ++ +++  K+ +E V   PFSRQG I+LS+IETKMLLQEFF NAAIF          
Sbjct: 830  KSLLLQDMMTDKKGSEKV---PFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMS 886

Query: 946  XXXXXXISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLF 1005
                  +SLY++GLVKLIC+MV+TL+ NDKF F+KSECTFELQTLLM WIG++PEA++LF
Sbjct: 887  SNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELF 946

Query: 1006 FQIKTRLAMEEXXXXXXXXXXXXXXLEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSA 1065
            F +K  +                   E+         S  N KLL L PS      +N A
Sbjct: 947  FTLKANVGEPSMEGKSDSDGTDSNEGEL---------SWYNSKLLALLPSPTNSGLENPA 997

Query: 1066 ISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHEYI 1112
            I TLRSF+  Y F  ++   GRKV++ D KILP+ K  +PI L E I
Sbjct: 998  IETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELI 1044

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1127 (41%), Positives = 653/1127 (57%), Gaps = 86/1127 (7%)

Query: 41   KNYVPSLENLEKLLYNESILDDQKIRLSILFEALSIILFTTKSGKSILQ-----AVQAST 95
            K+Y P   NL       +I   ++   +++ E L + LF T  G SIL+     +     
Sbjct: 27   KDYYPDQRNL-------TIPHVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVD 79

Query: 96   LKEKKLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLP 155
            L   K W  S       Y  +V+ W  + ++ L+F   LL NK   L+  K+N  EYKL 
Sbjct: 80   LSSYKQWQHSQVRSTDGYKKLVKRWSTSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLS 139

Query: 156  LSFLIVSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDR 215
            L FL+  +  F  +IL+  +N+L DYL      I+ ++ GN      ALV +     Y++
Sbjct: 140  LIFLLDKQNEF--LILDPDYNLLLDYLLHAKPMIESILLGNIPGLLKALVYQ-----YNK 192

Query: 216  IVEFHNLYFWYSFNVENDVNFEFSDNFDLLMNS---------PEDHA---------DGGV 257
            + EF+  + WY+F        E    F + +           PE            D G 
Sbjct: 193  LPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGC 252

Query: 258  I-----DDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHEL 312
            I     DD   S       ++   ++  N QEQ+YSFEL++DGTL+IPN+  H+  RH+ 
Sbjct: 253  IKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDA 312

Query: 313  LFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSS 372
            L+K+L L    TPLL+  F   C L DP+ QP PND+ ++S+D L  +FLGLMYP I + 
Sbjct: 313  LYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITAD 372

Query: 373  QEHNDHYD-WKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHG 431
                 + D W  + CFN+QKII+AT+ RLNC DF RLN +NN+D  + WR  L+KWLP G
Sbjct: 373  LVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQG 432

Query: 432  LNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEE 491
            LNTQDLEL+YM+DILA YTIYKLY   PIQ+NPFL  ++SLWKNL+CV+LL LEIDR+EE
Sbjct: 433  LNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEE 492

Query: 492  ENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGA 551
            E  T+ TP+MVRATIRGA+ALRSV+A+++NG  +   HDFKHE +N FMSP+GRKLC+GA
Sbjct: 493  EQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGA 552

Query: 552  LYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNEPFSE--SD 609
            LYADLRSH A++LALG  +E +TDL +DLQ GDRFDED++YMFDYE +DYNE  +E  +D
Sbjct: 553  LYADLRSHAATMLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTELMAD 612

Query: 610  DEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGXXXXXXXXXX 669
            DE   ED  SR +IK     G+Y +RC+C+F+DD LV E+      E             
Sbjct: 613  DEL--EDIESRERIK--EVRGYY-KRCHCVFDDDSLVPENEDGGGEEGDQEDTKKHLQDS 667

Query: 670  XXXXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQE 729
                +P          +++  PL+VRSR T EFD++G DWRD+P+  N YY+ +Y F+ +
Sbjct: 668  HEDQLPPQQNV---VMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTK 724

Query: 730  PKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMIL-SDLGSNFAEIDENPEA 788
               DV+  L      +KL R+ +  ++ S+A+CVK EQ++ I+   LG+   +       
Sbjct: 725  LHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGD------- 777

Query: 789  KSSNNIT-KTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRI 847
            KSSN  T KT NE     T D IYE W E+S FE+M+  N D+ WR+MDEMLMC+GYRR+
Sbjct: 778  KSSNATTIKTENE----LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRV 833

Query: 848  LIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVSGL 907
            LIWF+THLE+ HS+I+Y+FELVMGLRG     +  ++ +  D +  + +    +E    L
Sbjct: 834  LIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSE--LTL 891

Query: 908  PFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXXXXX------------XISLY 955
            PFSRQGPI+LS IE  MLLQEFF NAAIF                           +  +
Sbjct: 892  PFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRESFDSENEELDENFEDEDEFSVPPH 951

Query: 956  SLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAME 1015
             +GL+KL+C+MV TL+   KF FT SE  FELQTLLM WIG++PEA+DLFF++K+++   
Sbjct: 952  VIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVAT 1011

Query: 1016 EXXXXXXXXXXXXXXLEVERRPHT----KSNSELNVKLLNLFPSNPAGNNDNSAISTLRS 1071
                            +    P T     + SE N KL+ L P  P   N+ +A++ LR 
Sbjct: 1012 SQDTQEQGTPVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIP--PGTTNERNALTALRG 1069

Query: 1072 FITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEID 1118
            FI  Y    +    GRK+++ D +I+ +   DK +   E++    ID
Sbjct: 1070 FIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGID 1116

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1143 (40%), Positives = 661/1143 (57%), Gaps = 125/1143 (10%)

Query: 42   NYVPSLENLEKLLYNES----ILDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLK 97
            NY PS+  LE+LL +E+    +L D +++ S + E   I LFTT+ G S+L  +  +   
Sbjct: 20   NYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNF-- 77

Query: 98   EKKLWAQSLRDDDSNY---------ASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYN 148
                    + +D+ ++           +   W  ++++ +KFLRF++ N+   +     N
Sbjct: 78   -------GIDEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKN 130

Query: 149  LPEYKLPLSFLIVSKI-NFPSI-ILNEGHNMLKDYLYSMSGRIDCLIR------GNSITS 200
                KL L FLI ++  +F S+ +L    +++++YL ++  ++  +I+         I  
Sbjct: 131  DILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDC 190

Query: 201  RSALVVKKILKDYDRIVE--FHNLYFWYSFNVENDVNFEFSDNFDLLMNSPEDHADG--- 255
              +  V+ IL  Y R+ E   H  ++ YS    N          D+ + +   H  G   
Sbjct: 191  EDSFFVRTILS-YKRLYETLLHFEFYDYSSMKTNGS--------DIYVKALMKHLTGLSN 241

Query: 256  -------------GVIDDRCKSDNPQKHAKNTIIKRTI--NDQEQIYSFELD---QDGTL 297
                           ID++  S NP K      I  ++  +D E   + E D   Q   L
Sbjct: 242  FSFQLFKLSGYFYNTIDNQ--SYNPSKFG---FIPLSVDPDDGEVEENQETDNILQPSLL 296

Query: 298  QIPNIMEHSLMRHELLFKILNLPSVL------TPLLELQFCNLCGLVDPLMQPSPNDEQV 351
              P++M  +  RH  L K++ + S L      +PLL++Q+  L  L+DPL QP PND  V
Sbjct: 297  DFPDLMNETAKRHLALSKLI-IDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHV 355

Query: 352  ISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSV 411
            ISID L  +FLGLM P I +   ++D  DW+F+ CFNMQ+II A++  LNC+DFERL +V
Sbjct: 356  ISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV 415

Query: 412  NNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLS 471
            + +     WR+QLH WLP GLNTQ+LEL+YM  ILA+YTIYKLY   P+  NPFL SL+S
Sbjct: 416  DESKD---WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLIS 472

Query: 472  LWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDF 531
            LWK+L+CV+L  L+IDR+EE N +++TP++VRATIRGAAALRS++A+VLN  ++   HDF
Sbjct: 473  LWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDF 532

Query: 532  KHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIR 591
             HESLNTFMSP+GRKLC GALYADL+++TAS+LALGA  ++VTDL + LQ+GD+FDED++
Sbjct: 533  IHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVK 592

Query: 592  YMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGT 651
            YMF+YE EDYNE +         ED+++  +        F +RRCNCIF+DD L+ E+  
Sbjct: 593  YMFEYEYEDYNEIY---------EDSSNENEENEEIDYAFNKRRCNCIFSDDNLIEEEED 643

Query: 652  NEAFEISGXXXXXXXXXXXXXXIPSTATTNSNRFASS--INPLSVRSRSTFEFDYSGEDW 709
            +E                      +  T  S+   S+    P +VRS+S FEFDYSG+DW
Sbjct: 644  DEEESDVEKTSDIDGEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDW 703

Query: 710  RDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQ 769
            RD+P+++N+YYSP Y+FI  P L+ +F LTL+  +EKL ++++ +L+CSVAS VKNEQD+
Sbjct: 704  RDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVASTVKNEQDR 763

Query: 770  MILSDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHD 829
            MI      N  E D++  A    +  K         TPDDIYEIW EESAFER+L+ N D
Sbjct: 764  MIF----GNLLEQDKSSTADEHEDTKK-------EATPDDIYEIWCEESAFERILHFNPD 812

Query: 830  VAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDD 889
            +AW+LMDEMLMC+GYRR+LIWF+TH+EL HSLI Y+F+L+MG RG   +   + ++ K  
Sbjct: 813  LAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRG--INKTDTSKNVKST 870

Query: 890  MIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXXXX 949
             I E +     N     L FSR G + LS++ET+M+LQE F NAAI+             
Sbjct: 871  FITENISDSNSN----SLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSNQSIL 926

Query: 950  X----------------XISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMT 993
                               S+YS+GL+KLIC MV  LI N KF   +S+C FELQTLLM 
Sbjct: 927  TPDYSTEEEEFDEENEGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMG 986

Query: 994  WIGVLPEAKDLFFQIKTRLAMEEXXXXXXXXXXXXXXLEVERRPHTKSNSE---LNVKLL 1050
            WI +LPEAK+L F+I + L+                  +  ++   K NSE    N  LL
Sbjct: 987  WISILPEAKELSFKINSSLSEFSHVENSELASIEGASTKSHKQLVDK-NSESYKYNEILL 1045

Query: 1051 NLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHE 1110
             L P    G  +N   +T R +I DY FD++++   RK++    +ILPL  ++KP   H+
Sbjct: 1046 KLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHD 1105

Query: 1111 YIT 1113
            Y+T
Sbjct: 1106 YLT 1108

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/1096 (38%), Positives = 632/1096 (57%), Gaps = 109/1096 (9%)

Query: 60   LDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQ- 118
            +D +  +   L E   + LFTT  G+ + Q      L++  L   SL    S     V+ 
Sbjct: 1    MDSRVPQFDSLLEECVVTLFTTYRGQHVCQ-----MLEQLDLGVFSLSKTPSRIVQQVRT 55

Query: 119  GWKDNDV--LFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHN 176
             W +  +      F + +  +      I +YN P +KL +S L  S+ +   ++LN  ++
Sbjct: 56   AWTEEALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYD 115

Query: 177  MLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNF 236
            +L D++ ++  ++  LIR     +    +V  I++ Y R+ EFH+ + W++ + +     
Sbjct: 116  VLLDFVNTVRPQLKGLIR----QAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKK----- 166

Query: 237  EFSDNFDLLMNSPEDHADGGVIDDRCKSDNPQKH-----------AKNTIIKRTINDQEQ 285
            +F++   L++N          I+  C       H             N +  + +   E 
Sbjct: 167  KFANRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEH 226

Query: 286  IYSFELDQD-----GTLQIP-NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVD 339
            +Y F+LD++     G   +  ++M+ S  RHE+L ++LNL  + +P L  QF  +  LVD
Sbjct: 227  VYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMISLVD 286

Query: 340  PLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLR 399
            PL QP P+D  V+S+D L++LFL  + P  + + E ND     F  CFNMQKII  T+ R
Sbjct: 287  PLTQPPPSDTYVVSLDLLYKLFLAFL-PKNQDT-EQND----TFLLCFNMQKIITRTLWR 340

Query: 400  LNCSDFERLNSVNNT-----DSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKL 454
            L C D+ +L S++       +S  ++R  L +W+P+GLNTQDLELLYM+DI+A+YTIY  
Sbjct: 341  LKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNA 400

Query: 455  YEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRS 514
            Y  +PIQLNPFL  L+SLWKNLS V+LL+LE+DR EE N T++TPL+VRATIRGA+ALR+
Sbjct: 401  YSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRA 460

Query: 515  VIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVT 574
            V+A VLNG V+ N+HDFKHE LNTFMSP+GRKLC G+LYADLRSH A++L+LG  +EDVT
Sbjct: 461  VVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVT 520

Query: 575  DLFADLQSGDRFDEDIRYMFDYECEDYNEPFSESDDE------QLNEDANSRGKIKSSSS 628
            +L +DLQ GDRFDEDIRYMF+YE EDYN    E +DE           + +     +  +
Sbjct: 521  ELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDAAAAATTATASAAAITAANEGT 580

Query: 629  NGFYQRRCNCIFNDDKLVAEDGTNEAFEISGXXXXXXXXXXXXXXIPSTATTNSNRFASS 688
                +RRCNCIF DDK++  D +  +                            NR    
Sbjct: 581  GASQKRRCNCIFTDDKIIQSDESKVSL-----------------------GGGKNR---- 613

Query: 689  INPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLN 748
              P SVR++S+FEFDYSG DWRDVP+  N+Y+ PSY F+  P L    N++ + A  KLN
Sbjct: 614  --PYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKAAGGKLN 671

Query: 749  RDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPD 808
              +S  L+  VAS +K EQ+ +I   +G+ + +         +  I   ++  L   TPD
Sbjct: 672  PMESQQLLKLVASAIKIEQECII---MGTVYPQ---------TEGIAVGDDGLL---TPD 716

Query: 809  DIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFEL 868
            +IY+ W ++  F+R+L +N ++AW+LMDE+LMC GYRR+L+WF+TH+EL HS+I+Y+FEL
Sbjct: 717  NIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFEL 776

Query: 869  VMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQE 928
            VMGLRG+  S + + ++++   ++ +++    N     L FSRQG + LS+IE KMLLQE
Sbjct: 777  VMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGT--LMFSRQGNLALSEIEVKMLLQE 834

Query: 929  FFMNAAIFLXXXXXXXXXXXXXXISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQ 988
            FF NAAIFL              +SLYS+GLVKLIC+MV+TLI N KF F+KSECTFELQ
Sbjct: 835  FFTNAAIFLSASESEEPESETSDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQ 894

Query: 989  TLLMTWIGVLPEAKDLFFQIKTRLA----------MEEXXXXXXXXXXXXXXLEVERRPH 1038
            TLLM W+G++P+A++LFF +K  ++                            + +    
Sbjct: 895  TLLMNWLGIVPDAQELFFLLKKNISDTKTATTTTTTTSALGAPGDIFPTLTDADDDNNAV 954

Query: 1039 TKSNSELNVKLLNLFP--SNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKI 1096
             ++ SE N KL+ L P  +   G   + AI  LR+F+  +   ++I   GR++V    +I
Sbjct: 955  AENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQI 1014

Query: 1097 LPLSKADKPIPLHEYI 1112
            LP +  ++ + L EY+
Sbjct: 1015 LPQATPERTVTLREYL 1030

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1108 (38%), Positives = 635/1108 (57%), Gaps = 122/1108 (11%)

Query: 72   EALSIILFTTKSGKSILQ------AVQASTLKEKKLWAQS--LRDDDSNYASVVQGWKDN 123
            E L + LFTT+ G S L+        + + L+ KK W QS   R  D+ Y  +V+ W  +
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKK-WQQSKPQRVSDAAYKRMVKRWTSS 109

Query: 124  DVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKDYLY 183
                   +   L N   +L    +  P +KL ++FL+  +     +++++ +N+L D+  
Sbjct: 110  TEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEV--LVIDDEYNLLLDFAL 167

Query: 184  SMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVEN-----DVNFEF 238
                 ++ L+    + S    ++ K    + R+ +    Y WY+F+ E      D+ +++
Sbjct: 168  QCRALVEQLLNQIDLPS----LLAKCAYGHGRLFQLCGRYVWYTFSAEQFDEAQDICYKY 223

Query: 239  ----SDN--------------FDLLMNSPEDHADGGVIDDRCKSDNPQKHA---KNTIIK 277
                +D               F+++ +S   H    V  D   ++NP+  +    +   +
Sbjct: 224  LSVLTDKLTAQQDLIPQIQPLFEIISSSKASH---WVYGDGLFTENPESDSNSDSDHWPQ 280

Query: 278  RTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHELLFKILNLPSVLT-PLLELQFCNLCG 336
            + ++ QE++YSF+L  DGTL+  N+   +  RH+ L+++LNL    T PLL  QF  LC 
Sbjct: 281  KRLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFTLCA 340

Query: 337  LVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDAT 396
            LVDP+ QP+PND  ++SID L  +FLGL+Y  I        H DW+F+ CFN+QKI+ AT
Sbjct: 341  LVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINEL-----HIDWRFHVCFNLQKIVQAT 395

Query: 397  MLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYE 456
            + RLNC DF+RLNSVNN+D  I WR  LHKWLP GLNTQDLEL+YMIDILAIY I+KLY 
Sbjct: 396  LPRLNCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAIYIIHKLYR 455

Query: 457  KIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVI 516
             +P Q+NPFL S++SLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG++ALRSV+
Sbjct: 456  DLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVV 515

Query: 517  ASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDL 576
            A++LNG V+   HDF+HE +N FMSP+GRKLCHGALY D+RSH A++LALG  +EDVT+L
Sbjct: 516  ATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNL 575

Query: 577  FADLQSGDRFDEDIRYMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRC 636
             +DLQ GDRFDED++YMFDYE ++YNE  +E  DE   ED  SR +IK   +   Y +RC
Sbjct: 576  LSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRERIKEMRA---YYKRC 632

Query: 637  NCIFNDDKLVAEDGTNEAFEISGXXXXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRS 696
            +C F+DD+L+ ED  +   + S                      N+ + +++  P+++RS
Sbjct: 633  HCQFDDDELLPEDEEDGRPDASPYRVTR-----------DAPPDNNVKLSNTSKPMALRS 681

Query: 697  -RSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVL 755
             + + EFD++G DWR +P+  N Y++ +Y F +        +L    A +KL  ++   L
Sbjct: 682  QKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLEEGTQL 741

Query: 756  VCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWS 815
            +  +A+CV  EQ+  +L     +   + E PE  S N+ T   + +L   T D +YE W 
Sbjct: 742  LRVIATCVAKEQELTVL----RSALLLGETPE--SENHSTLVADGDL---TTDFVYEKWC 792

Query: 816  EESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGK 875
            E S FE++L  N  + WR+MDEMLMC+GYRR+LIWF+THLE+ +S+I Y++ LV+G RG 
Sbjct: 793  ENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRG- 851

Query: 876  PFSGEASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAI 935
                                +K   + D + +PFSRQG IVLSDIE KMLLQEFF NAAI
Sbjct: 852  --------------------EKAASDGDYAKVPFSRQGAIVLSDIEIKMLLQEFFTNAAI 891

Query: 936  FLXXXXXXX-----------XXXXXXXISLYSLGLVKLICYMVQTLIANDKFLFTKSECT 984
            F                          IS + +GL+KL+CYMV++L+  + F F   +  
Sbjct: 892  FFSKQLRESLGDGEDDEDQGDDEKGSGISPHVVGLMKLVCYMVKSLMQKEMFDFKDPDYI 951

Query: 985  FELQTLLMTWIGVLPEAKDLFFQIKT-------RLAMEEXXXXXXXXXXXXXXLEVERRP 1037
            FELQTLLM+WI +LPEA+DLFF +++        + +E                ++ +  
Sbjct: 952  FELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLESESIASACEPDSQSEPQLPQGT 1011

Query: 1038 H-------TKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVV 1090
            H       T + S  N KL++L P  PA   +NSAI+ LRSFI+ +   T+    GR+V+
Sbjct: 1012 HAELEPEATHAVSIYNKKLMSLLP--PAAGTENSAITALRSFISKHSLTTKTALFGRRVI 1069

Query: 1091 FYDGKILPLSKADKPIPLHEYITLAEID 1118
              D  I+P+  +D+ +   +++    ID
Sbjct: 1070 SQDDTIMPMYMSDREMDNRQFLAEFGID 1097

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1209 (36%), Positives = 660/1209 (54%), Gaps = 190/1209 (15%)

Query: 43   YVPSLENLEKLLYNESILDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKL- 101
            Y PS+++L +L   E    D    L I+ E + + LF T+ G SIL  +   +    KL 
Sbjct: 25   YKPSIQSLLELNVQEG---DPHFELMIV-EKVVVTLFMTRGGNSILHLLYDLSCGRIKLS 80

Query: 102  -WAQSL--RDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSF 158
             + QSL  R +   + +  + W        +FL F L N+  +L   +Y     KLPL F
Sbjct: 81   EYRQSLKVRSNVHQWKTCYKEWGSRRDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQF 140

Query: 159  LIVSKINFPSIILNEGHNMLKDYLYSMSGRI---DCLIRGNSITSRSALVVKKILKDYDR 215
            L+ + ++  + +L+EG+N+L DY+  ++ R+   + LI+G         ++ ++++DY+R
Sbjct: 141  LLPAGLH--AYVLDEGYNLLLDYI--INSRLMWEELLIQG------IPRLLPELIEDYNR 190

Query: 216  IVEFHNLYFWY------------SFNVENDVNFEFSDNFDLL------MNS-------PE 250
            + EF+  Y WY            +  +   V +   D   +       +N+       P 
Sbjct: 191  VFEFNGYYTWYGGAPSGAGAANSTRELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPP 250

Query: 251  DHADGGV------------IDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQ 298
             +   G+             D   + D+  +H  +         +EQ+Y+FEL++DG+L+
Sbjct: 251  MYHKHGINEFSNEEEDLYDFDSELEGDSWPQHKSSA--------KEQVYTFELNRDGSLE 302

Query: 299  IPNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLF 358
             PN+  H+  RHE L++IL LP+   PLL  QF  LC LVDP+ QP P ++ +ISID ++
Sbjct: 303  FPNVFLHTRRRHETLYRILGLPNRECPLLRAQFMTLCALVDPITQPPPTEKHIISIDLIY 362

Query: 359  QLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVI 418
            Q+FLG +   ++SS    D   W+F+ C N+QKII ATM RLNC D E LNS+NN+D  +
Sbjct: 363  QMFLGSISSLLESSLRGQD---WRFHVCHNLQKIILATMKRLNCHDSEVLNSINNSDETV 419

Query: 419  HWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSC 478
            HW   + KW P GLNTQDLELLYM+D+L IYTIY+LY  +P+Q+NPFL     LWKNL+ 
Sbjct: 420  HWNVNIGKWTPRGLNTQDLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTN 479

Query: 479  VILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNT 538
            V+LL LEIDR EE+  T+ TP++VRATIRG+AALRSV+A+++N      +HDFKHE +N 
Sbjct: 480  VLLLGLEIDRFEEDRETFSTPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINL 539

Query: 539  FMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYEC 598
            FMSP+GRKLC GALYAD+RSH A++LALG  + DVTDL +DLQ GDRFD+D++YMFDYE 
Sbjct: 540  FMSPHGRKLCQGALYADVRSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDYEY 599

Query: 599  EDYN----EPFSESDDEQLN--EDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTN 652
            +DYN    E   + ++E L   E+   R +IK     G+Y +RC+C+F+DD+L++++   
Sbjct: 600  DDYNAIDPEQLYDENEEDLERLEEIQQRERIK--DMRGYY-KRCHCVFDDDELLSDEEGT 656

Query: 653  EAFEISGXXXXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDV 712
            +  E +               +   +T+   + A       VRSR   EFD++G+DWRD+
Sbjct: 657  DTGEHTDNHITETVQSAPLNLVTGVSTSGPQKVA-------VRSRDYVEFDFNGKDWRDI 709

Query: 713  PKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMIL 772
            P+  N YY   Y F+ +   DV+  L     ++KL  + S  ++ SVA+C+K EQ++ ++
Sbjct: 710  PRGMNFYYVEDYVFVNKLHADVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMV 769

Query: 773  SDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAW 832
             D  + F   D++P       ++ + +E     T D IYE W E++ FE+M+  N+D+ W
Sbjct: 770  HD--AIFKSKDKSP-------LSASGSEGSNGLTSDFIYEKWCEDALFEKMMYYNNDLVW 820

Query: 833  RLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIY 892
            R+MDEMLMC+GYRR+LIWF+THLEL HS+I+Y+FELVMG+RG       + +D +++ I 
Sbjct: 821  RMMDEMLMCSGYRRVLIWFITHLELSHSVIHYIFELVMGMRGN-----VAYKDLEEEYII 875

Query: 893  EILKKKRKNEDV------------SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXX 940
                   +N D+            + +PFSRQGPIVLS IE  MLLQEFF+NAAI+    
Sbjct: 876  ------NRNLDLLDSFSLGSSCIPASIPFSRQGPIVLSTIEVNMLLQEFFINAAIYFSNY 929

Query: 941  XXXXXXXXXXXI-------------------------SLYSLGLVKLICYMVQTLIANDK 975
                       +                         S + LGL+KL+C+MV  LI   K
Sbjct: 930  LRDTASYEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVLGLMKLLCFMVDMLIEKKK 989

Query: 976  FLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRL------------AMEEXXXXXXX 1023
              FT SE  FELQTLLM WIG++PEA+ LFF++K+ L             +E        
Sbjct: 990  LDFTDSEYLFELQTLLMNWIGLVPEARTLFFKLKSTLLNSSALNGSALSHLEGELASNDN 1049

Query: 1024 XXXXXXXLEVERRPHTKSN-----------------------------SELNVKLLN--- 1051
                      +  P  KSN                             SE N+   N   
Sbjct: 1050 DDSEPVDTAEDAGPMDKSNGLDGLPLCDIGALTNGQPTSAANSAPNGMSESNISYCNQML 1109

Query: 1052 --LFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLH 1109
              L P  P   ++N+A++ LRSFI  +P  T+    GR+V++ D  I+ L  ADK +   
Sbjct: 1110 IKLLP--PHSADENAAVTALRSFIAKHPLTTKTAIFGRRVIYQDNAIMGLYMADKELQQR 1167

Query: 1110 EYITLAEID 1118
            E++    ID
Sbjct: 1168 EFLAEFGID 1176

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1150 (39%), Positives = 648/1150 (56%), Gaps = 135/1150 (11%)

Query: 37   LLKDKNYVPSLENLEKLL-----YNESILDDQKIRLSILFEALSIILFTTKSGKSILQ-- 89
            L+ D     SLE L KL+      +E+   +    LSI  E L I LFTTK G SIL+  
Sbjct: 9    LVNDPERRSSLETLPKLVDPKPNESEARGTNSYASLSIQ-EKLVIGLFTTKPGLSILKLY 67

Query: 90   ----AVQASTLKEKKLWAQSLRDD--DSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQ 143
                  + + L+ KK W QS      D+ Y  +V+ W  +       + +LL N +TSL 
Sbjct: 68   YELSCGRINLLRYKK-WQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYLLRNDSTSLD 126

Query: 144  IDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSA 203
               +   EYKL ++FL+        +I+++ +N+L D+L      ++ L+    + S   
Sbjct: 127  YVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLLLDFLLQTRASVEELLSQADLPS--- 181

Query: 204  LVVKKILKDYDRIVEFHNLYFWYSFNVE-----NDVNFEF----SDN------------- 241
            L+ K  L  + R+ +    Y WY+F+ E      D+ +++    +D              
Sbjct: 182  LIAKSALSHH-RLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQIQP 240

Query: 242  -FDLLMNSPEDH--------ADGGVIDDRCKSDN-PQKHAKNTIIKRTINDQEQIYSFEL 291
             FD + +S   H        ++G   D    SD+ PQK          ++  E+IYSF+L
Sbjct: 241  LFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQK---------KLSAHERIYSFDL 291

Query: 292  DQDGTLQIPNIMEHSLMRHELLFKILNLPSV-LTPLLELQFCNLCGLVDPLMQPSPNDEQ 350
              DGTL+ PN+   +  RH+ L+++L L     +P L+ QF  LC LVDP+ QP+PND  
Sbjct: 292  KDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSH 351

Query: 351  VISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNS 410
            +ISID L  +F+GL++  IK        ++W+F+ CFN+QKI+ +T+ RLNC DF++LNS
Sbjct: 352  IISIDLLSDMFIGLLHSEIKQLP-----FNWRFHICFNLQKILQSTLPRLNCHDFQQLNS 406

Query: 411  VNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLL 470
            VNN+D  I WR  LHKWLP GLNTQDLEL+YMIDILAIY I+KLY   P+Q+NPFL S++
Sbjct: 407  VNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMI 466

Query: 471  SLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHD 530
            SLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG++ALRSV+A+VLNG V+   HD
Sbjct: 467  SLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHD 526

Query: 531  FKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDI 590
            F+HE +N FMSP+GRKLCHGALY D+RSH A++LALG  +EDVT+L +DLQ GDRFDED+
Sbjct: 527  FQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDV 586

Query: 591  RYMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDG 650
            +YMFDYE ++YNE  +E  DE+  ED  SR +IK   +   Y +RC+C F+DD+L+ E+ 
Sbjct: 587  KYMFDYEYDNYNEVGTEDMDEEELEDVESRERIKEMRA---YYKRCHCQFDDDELLPEEE 643

Query: 651  TNEAFEISGXXXXXXXXXXXXXXIPSTATTNSNRFASSINPLSVRSRS-TFEFDYSGEDW 709
                  IS                P T    SN    +  P+++R++  T EFD++G DW
Sbjct: 644  EESGIPISHTRISKELP-------PDTNVKLSN----TAKPVALRNKKDTIEFDFNGRDW 692

Query: 710  RDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQ 769
            RD+P+  N Y++ +Y F +  K      L    A  +L++++++ L+  V++CV  EQ+ 
Sbjct: 693  RDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEH 752

Query: 770  MILSDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHD 829
             +L    S FA  D    +  S  +   +       T D IYE W ++S F++ML  N  
Sbjct: 753  TVLR---SAFAADDSQALSCQSTLVADGD------LTTDYIYENWCQDSLFDKMLFHNET 803

Query: 830  VAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDD 889
            + WR+MDEMLMC+GYRR+LIWF+THLE+  S+I Y++ LVMG RG+  + E +       
Sbjct: 804  LVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKLANEET------- 856

Query: 890  MIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXX----- 944
                             LPFSRQG IVLS+IE KMLLQEFF NAAIF             
Sbjct: 857  -------------PFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDEE 903

Query: 945  -XXXXXXXISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKD 1003
                    IS Y +GL++L+C+MV++LI  + F F   +  FEL+TLLM+WI +LPEA+D
Sbjct: 904  EEETENLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARD 963

Query: 1004 LFFQIKTRLAMEEXXXXXXXXXXXXXXLEVERRP---------------HTKSNSELNVK 1048
            LFF +++R+  +                 V   P                T S S  N K
Sbjct: 964  LFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNKK 1023

Query: 1049 LLNLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPL 1108
            L++L P  P    +N+A++ LRSFI+ +         GR+V+ +D +I+ +  +DK I  
Sbjct: 1024 LISLLP--PVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDN 1081

Query: 1109 HEYITLAEID 1118
              ++    ID
Sbjct: 1082 RNFLAEFGID 1091

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1179 (36%), Positives = 646/1179 (54%), Gaps = 162/1179 (13%)

Query: 68   SILFEALSIILFTTKSGKSILQAVQASTLKEKKL--WAQSL--RDDDSNYASVVQGWKDN 123
            +++ E + + LF T+SG S+L  +        KL  + QSL  R + S + S  + W   
Sbjct: 46   ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSR 105

Query: 124  DVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKDYLY 183
              +  +FL F L N+  +L   +Y     KLPL FL+   +  P +I +E +N+L DY+ 
Sbjct: 106  RDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLR-PYLIDDE-YNLLLDYMI 163

Query: 184  SMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSDN-- 241
                  + L+     T      + +++ +Y+R  EF+  Y WY     + V  + S    
Sbjct: 164  QSRPMWEMLL-----TQGIPKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKEL 218

Query: 242  --------FDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTII----------------- 276
                    FD L  + E      V         P  + K T++                 
Sbjct: 219  YTKFFYTLFDKLTVTKELLPKLNVA--LWSHSWPASYTKQTLLDLSNDDDDHYDQDVDSE 276

Query: 277  -----KRTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHELLFKILNLPSVLTPLLELQF 331
                 ++ ++ +EQ+++F+L++DGTL+ PN+  H+  RHE+L+++L LP    PLL+ QF
Sbjct: 277  NDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQF 336

Query: 332  CNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQK 391
              L  LVDP+ QP P ++ +ISID +FQ+FLG     I++        DW+F+ C+NMQK
Sbjct: 337  MTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGR-DWRFHVCYNMQK 395

Query: 392  IIDATMLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTI 451
            I+ ATM RLNC D + LN+VNN+D  +HW   L KW P GLNTQDLELLYM+D+L+IY +
Sbjct: 396  IVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAM 455

Query: 452  YKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAA 511
            Y+LY  +P+Q+NPFL   L LWKNL+ V+L  LEIDR EE+  T+ TP++VRA IRG AA
Sbjct: 456  YRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAA 515

Query: 512  LRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIE 571
            LRSV+A+++N    S +HDFKHE +N FMSP+GRKLCHGALYAD+RSH A++L+LG  + 
Sbjct: 516  LRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLN 575

Query: 572  DVTDLFADLQSGDRFDEDIRYMFDYECEDYN----EPFSESDDEQLN--EDANSRGKIKS 625
            DVTDL +DLQ GDRFD+D++YMFDYE +DYN    E   + ++E L   E+   R +IK 
Sbjct: 576  DVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIK- 634

Query: 626  SSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGXXXXXXXXXXXXXXIPST--ATT--- 680
                G+Y +RC+C+F+DD+L++++   E  E +               +PS+  +TT   
Sbjct: 635  -DMRGYY-KRCHCVFDDDELLSDE---EEGETASSNIDRPKYSHNSLNLPSSMLSTTFNG 689

Query: 681  -NSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLT 739
             NS +FA       +RSR   +FD++G+DWRD+P+  N YY+  Y F+ +   DV++ L 
Sbjct: 690  PNSQKFA-------IRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLM 742

Query: 740  LRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNN 799
                T+K+  + +  ++ S+A+C+K EQ++ ++ D+      ++   +  SS+N   +N+
Sbjct: 743  KEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDV------MNGRTDKGSSSN---SNS 793

Query: 800  EELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKH 859
            + +   T D IYE W EES F +M+  N+D+ WR+MDEMLMC+GYRR+LIWF+THLE+ H
Sbjct: 794  DRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISH 853

Query: 860  SLIYYVFELVMGLRGK-PFSGEASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLS 918
            SLI+Y+FELVMG+RG   +  EA D  +  ++          +     +PFSRQGPI+LS
Sbjct: 854  SLIHYIFELVMGMRGNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIKIPFSRQGPIILS 913

Query: 919  DIETKMLLQEFFMNAAIF--------------------------LXXXXXXXXXXXXXXI 952
             IE  MLL EFF+NA I+                          L              +
Sbjct: 914  IIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGV 973

Query: 953  SLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRL 1012
            S + +GL+KL+C+MV  L+   KF FT SE  FELQTLLM WIG++PEA++LFF++K+ +
Sbjct: 974  SPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSI 1033

Query: 1013 AMEEXXXXXXXXXXXXXXLEVERRPHTKS----NSELNVKLLNL--------------FP 1054
               E               E  R+  ++S       +  K++N+              FP
Sbjct: 1034 L--EASSQNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFP 1091

Query: 1055 SNP---------------AGNNDN--------------------SAISTLRSFITDYPFD 1079
              P                 NN+N                    +A++ LRSFIT +   
Sbjct: 1092 PTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNENTAVTALRSFITKHSLT 1151

Query: 1080 TQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEID 1118
             +    GR+V++ D  I+ L  ADK +   E++    ID
Sbjct: 1152 NKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFGID 1190

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/889 (43%), Positives = 554/889 (62%), Gaps = 88/889 (9%)

Query: 283  QEQIYSFELDQDGTLQIP-NIMEHSLMRHELLFKILNLPSV-LTPLLELQFCNLCGLVDP 340
            +E++YSF+L+ DG++ +P N+M ++  RH++L K+LN  S   +PLLELQF  + GLVDP
Sbjct: 394  EEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDP 453

Query: 341  LMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRL 400
            L QP PND+ +IS+D L+QLF+ ++YP+ +  Q +N  ++WK + CF M KII+  M +L
Sbjct: 454  LSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQ-NNLGFNWKTHVCFQMVKIINNCMEKL 512

Query: 401  NCSDFERLNSV------NNTDSVI-------------------HWRTQLHKWLPHGLNTQ 435
            NC+D ++L  +      NN + ++                   +WR+ L +WLPHGLNTQ
Sbjct: 513  NCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGLNTQ 572

Query: 436  DLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGT 495
            DLELLYM+ ILA YT+ KL  +IPIQLNPFL +L++LWK L+ +++L L+IDR EE + T
Sbjct: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632

Query: 496  YETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYAD 555
            Y+TPL+V+ATIRGA+ALRSV+A++LN  ++ NDHDFKHE+LNTFMSP+GRKLC+GALY D
Sbjct: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692

Query: 556  LRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNEPFSESDDE---- 611
            ++   ASL ALG  + ++ +L + L+ GDRFDEDI YMF+YE +DYN    E+ ++    
Sbjct: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKT 752

Query: 612  QLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGXXXXXXXXXXXX 671
              + D NS   + +      YQRRCNCIF       ED      +  G            
Sbjct: 753  LKSNDDNSDIYVLNEVKLDRYQRRCNCIF-------EDDKILQDDDDGNGDEQQGEQEEQ 805

Query: 672  XXIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPK 731
               P    +  +         +VRS++TFEFDYSG+DWRD+P+ FN+YYS SYSFI +  
Sbjct: 806  EGTPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSS 865

Query: 732  LDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSS 791
            LD + NLT + +T+KLN DDSI L+  +AS +K EQ+ MI+ DL     ++  N      
Sbjct: 866  LDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLHSN----II 921

Query: 792  NNITKTNNEELRRT---TPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRIL 848
            N +  +  E+ R T   TPDDI++ W ++  F  ML+ N +++WRLMDEMLMC GYRR+L
Sbjct: 922  NPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVL 981

Query: 849  IWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVSGLP 908
            IW++TH++L HSLI Y+FEL+MGLRG PF   A++ + K+++++E++  K K  D    P
Sbjct: 982  IWYITHMKLNHSLIQYIFELLMGLRGSPF---ANNNECKNELLHELMLGK-KIVDNHTYP 1037

Query: 909  FSRQGPIVLSDIETKMLLQEFFMNAAIF--------------------LXXXXXXXXXXX 948
            FSRQGP++LSDIETKMLLQEFF NAAI+                    +           
Sbjct: 1038 FSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDEIENNE 1097

Query: 949  XXXISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQI 1008
               +S+YS+GL+KLIC MV +LI N KF FTKS+C FELQTLLM WIG+L EAK+LFF++
Sbjct: 1098 NHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFFKL 1157

Query: 1009 KTRLAMEEXXXXXXXXXXXXXXLEVERRPHTKSN-----------SELNVKLLNLFPSNP 1057
            K+ +   E                ++ R  ++SN           ++ N +LL L     
Sbjct: 1158 KSDI---EETSESTDGGDDDDFESIDSRKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIH 1214

Query: 1058 AGNND---NSAISTLRSFITDYPFDTQITP-PGRKVVFYDGKILPLSKA 1102
            +G+ D   ++  +  R  + +Y F ++     GRKVV+ D +ILPL K 
Sbjct: 1215 SGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 109/198 (55%), Gaps = 21/198 (10%)

Query: 39  KDKNYVPSLENLEKLLYNESI-LDDQKIR----LSILFEALSIILFTTKSGKSILQAVQA 93
           K K Y P++ENL+  L +E   L+ +KI+     SI+ E L I  FTTKSG+SIL  +  
Sbjct: 81  KFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFD 140

Query: 94  STLKEKKLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYK 153
           +  K   +  + LR          + W+ N+ L+  F+ FL+ NK   + IDK+N PE K
Sbjct: 141 TKRKPPTVQNKILR----------KTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENK 190

Query: 154 LPLSFLI----VSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKI 209
           L + FL+    +S I  PSIIL+  +NML DYL + S  +  LI+  +I +        I
Sbjct: 191 LSIKFLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKM-TILNVGPFFYNTI 249

Query: 210 LKDYDRIVEFHNLYFWYS 227
           ++ Y+RI +F+  + WY+
Sbjct: 250 IR-YNRIPQFNGHFQWYT 266

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1112 (36%), Positives = 592/1112 (53%), Gaps = 128/1112 (11%)

Query: 68   SILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSN--------YASVVQG 119
            +  +E L+I LFTTK G  IL   + + L        ++  +DS+        Y  +   
Sbjct: 114  NFFYELLTIALFTTKPGNKILHFFKNTGLD------SAIEHNDSDDTLFHSPAYEHLKML 167

Query: 120  WKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKIN--FPSIILNEGHNM 177
            WK  D      L+F+L N+   + +  Y    YK PL+FL+    N      +L+E  N+
Sbjct: 168  WKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTCPNNNIKHRFLLSEEFNI 227

Query: 178  LKDYLYSMSGRIDC--LIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSF-NVEN-- 232
            L++YLY+    I     I   S   +        L  YDR+ E++  Y  Y   + EN  
Sbjct: 228  LEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFTMTLHLYDRVTEYNQSYLRYEITDDENAL 287

Query: 233  --------DVNFEF-----SDNFDLLM------------NSPEDHADGGVIDDRCKSDNP 267
                    DV  EF     +D+ + ++            +S  +  D        +S  P
Sbjct: 288  CQFDESLLDVLLEFERYVTTDDIEAILLQSGRINKVKDISSAIERGDYKWEQGTLRSLTP 347

Query: 268  QKHAKNTIIKRTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHELLFKILNLP--SVLTP 325
              H  +       N++E I SF+++++G  ++PNIM+ S++RH +LF+ L L   + L P
Sbjct: 348  NNHKAD-------NEEEVILSFDINENGLQEVPNIMKDSMLRHSILFEFLGLSQRNTLAP 400

Query: 326  LLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPS-IKSSQEHNDHYDWKFY 384
             LE+QF  L GLVDPL QP+PND  +ISID L  L+ GL++P+ IKS +  N  YDWK+ 
Sbjct: 401  YLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVHPALIKSGKARN--YDWKYL 458

Query: 385  TCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMID 444
              FN+ KI+  ++ +L+CS ++ LN++ N +    WR  L  W+P  LNTQDLELLYMID
Sbjct: 459  CGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQTLEYWIPKNLNTQDLELLYMID 518

Query: 445  ILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTYETPLMVRA 504
            IL++Y IYKLYE  PIQ NPFLF L S+WK ++ +I L L++DRIEE+N + ETPLM+RA
Sbjct: 519  ILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDSEETPLMIRA 578

Query: 505  TIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLL 564
            T+RGA+A R+ + ++LN  +++N+HDFKHE +NTFMSP+GRKLC G+LYAD+R  T   +
Sbjct: 579  TVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYADMRVSTKIFV 638

Query: 565  ALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNEPFSESDDEQLNEDANSRGKIK 624
              G  ++D+T+L  DLQ GDRFDED+ YMFDYE EDYN     SD E ++E A++     
Sbjct: 639  ENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYN---LVSDSEDMDEKADNE---- 691

Query: 625  SSSSNGFYQ----RRCNCIFNDDKLVAEDGTNEAFEISGXXXXXXXXXXXXXXIPSTATT 680
               S+G       RRCNC+F DDK++ E   +    I+               I +    
Sbjct: 692  ---SDGVRPAPIFRRCNCVFEDDKIMDESTIDHQSLITD-------MELENNAISTKDEN 741

Query: 681  NSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTL 740
            +  +  S   P +VR RS F+F+Y G+DWRD+P+  N+YY+  + F+QE       +   
Sbjct: 742  DKIKIISQPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQECSSSEFASYFS 801

Query: 741  RGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNNE 800
            +     L+  +S  L+  VASC++ EQD+M++      +  + + P A    N +K    
Sbjct: 802  KAVNSVLDISESNRLIQLVASCIREEQDRMVI------YHGMSQLPLANGDVNKSK---- 851

Query: 801  ELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHS 860
                 T D+IY+  S  + F +ML  + ++A  LMDE+LM  GYRR+LIWFLTH+ +   
Sbjct: 852  ----LTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLTHINITFP 907

Query: 861  LIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDI 920
            LI+Y+FELVMG R     G+A+  +              K        FSR G + LS I
Sbjct: 908  LIHYIFELVMGYRVGFSDGDANGDN-------------NKKSSTGKCGFSRLGTVALSSI 954

Query: 921  ETKMLLQEFFMNAAIFLXXXXXXXXXXX-----------XXXISLYSLGLVKLICYMVQT 969
            E +MLLQEFF+NA + L                         IS Y++G+V LIC MV+T
Sbjct: 955  EKQMLLQEFFLNATVSLSAKSFESNGTEIDNYDDNADEDNEYISSYAVGIVTLICNMVKT 1014

Query: 970  LIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEEXXXXXXXXXXXXX 1029
            L+   +   +KSE T ELQTLL+ WI ++PEAK+LFF +K      E             
Sbjct: 1015 LVRAGQMDVSKSEYTVELQTLLVNWISLIPEAKELFFFLKQE--AHEFDIQDSLEPINES 1072

Query: 1030 XLEVE---RRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPP- 1085
             L+       P    +  L+  +     S+   +N   A+ST    +     +T + PP 
Sbjct: 1073 ELQTSGNINEPAATDSIPLDDTINTSLTSSTKNSNATDALSTFLETVE----ETSVQPPQ 1128

Query: 1086 -GRKVVFYDGKILPLSKADKPIPLHEYITLAE 1116
             GRKV++   KILPL + ++PIP H     AE
Sbjct: 1129 IGRKVIYKGTKILPLPEQERPIPFHLLFERAE 1160

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/1272 (35%), Positives = 655/1272 (51%), Gaps = 224/1272 (17%)

Query: 43   YVPSLENLEKLLYNESILDDQKIRLSILFEALSIILFTTKSGKSILQ------------- 89
            Y P+++ LE L+  +    D +   S+LFE+L + LFTT  G S+L              
Sbjct: 18   YKPNIQLLETLI--DYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQ 75

Query: 90   ------------AVQASTLKEKKLWAQSLRD---------------DDSNYASVVQGWKD 122
                        AV +   K++ L    +R+                 +++  +++ W++
Sbjct: 76   KKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRN 135

Query: 123  NDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVS----------------KINF 166
            + +  LKF +F+L N    L  + +  P  KLPL FL+++                 I  
Sbjct: 136  DKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYN 195

Query: 167  PSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEF--HNLYF 224
             ++++++ +N+L DYL+  +  +  L+     T+   L+   I+  Y++  E    N   
Sbjct: 196  NTLLMDKNYNLLLDYLHVSTPLLISLLH----TNLDPLLFNNIISSYNKSFELTNDNKCL 251

Query: 225  WYSF-NVENDVNF-----------EFSDNFDLLMNSPEDHADGGVIDDRCKSDNPQKHAK 272
            WY F + ++  NF            F + FD+  N   +      + +   S   + +  
Sbjct: 252  WYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEISNSLFNISSSSTTKSNMH 311

Query: 273  NTIIKRTIN---DQ----EQIYSFELDQD----GTLQIPNIMEHSLMRHELLFKILNLPS 321
            N      +N   D+    E   SF L ++    G L  P++M H   RH++L KILN+  
Sbjct: 312  NENEGADLNLLMDENSMGEHTLSFNLFENNINHGILH-PDLMAHISKRHDILAKILNVGD 370

Query: 322  ----VLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHND 377
                  +PLL LQF  LC LVDPL QP+PN + +ISID LFQLFLG + P +       D
Sbjct: 371  NDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAED 430

Query: 378  HYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHGLNTQDL 437
              +WKF  CFNM+KII++ M +LNC DF  LNS+NN+D  +HWRTQLHKWLP G NTQDL
Sbjct: 431  GTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDL 490

Query: 438  ELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTYE 497
            ELLYM++ILA YTIYKL E +PIQLNPFL S++S WKNLSC ILL LEIDR+EEEN T++
Sbjct: 491  ELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFD 550

Query: 498  TPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHG------- 550
            TPL+VRAT+R + ALRS+IA++LN  V +  HDFKHESLNTFMSPYGRKLC+G       
Sbjct: 551  TPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFR 610

Query: 551  -------ALYADLRSHTASLLA---------------------------LGASIEDVT-- 574
                   AL  DL  H   L++                           LG   ++ +  
Sbjct: 611  SHASTILALTGDLE-HVTQLISDLQPGDRFDEDVKYMFEFEDYNTLPNVLGGEDDETSTD 669

Query: 575  -----DLFADLQSG----DRFDEDIRYMFDYECEDYNEPFSE-------SDDEQLNEDAN 618
                 ++  ++ +G    D  + D R + +Y  +   E           SDDE  +   +
Sbjct: 670  TLKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSDDEIKDTSIS 729

Query: 619  SRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFE---ISGXXXXXXXXXXXXXXIP 675
             +  + +SSSNG   R    + N+      +GTN   +   I                + 
Sbjct: 730  DKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEME 789

Query: 676  STATTNSNRFAS------SINPLSVRSRST---FEFDYSGEDWRDVPKDFNMYYSPSYSF 726
            S   T  N+  +      + NP SV +++    F+FDY+G+DWRD P+  N+YY+ +Y F
Sbjct: 790  SLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNLNYEF 849

Query: 727  IQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSD--LGSNFAEIDE 784
            I++P LD++F LTL+    KL++DDS +L+  VAS VKNEQD++I SD  +     EI E
Sbjct: 850  IEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIME 909

Query: 785  NPE--------AKSSNNITKTNNEE-LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLM 835
              E          + N I   N +E +   TPDDIYEIW EESAFERM+ +N++V +RLM
Sbjct: 910  QNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRLM 969

Query: 836  DEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKD------- 888
            DEMLMC GYRR+LIWF+THLEL HS+I+Y+FELVMG RG      A++    +       
Sbjct: 970  DEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKGNVNE 1029

Query: 889  -------DMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXX 941
                   +++  +L    K  D+  LPFSRQG I LS+IE KML+QEF  NAAI      
Sbjct: 1030 LENKNENELVNMLLNDYSKIFDLQ-LPFSRQGNIELSEIERKMLIQEFLTNAAIHFNERN 1088

Query: 942  XXXXXXXXX-----------------XISLYSLGLVKLICYMVQTLIANDKFLFTKSECT 984
                                       ISLYS+GL++LIC+M+Q  + N+K      +  
Sbjct: 1089 NLKHNPNSNDNSNSNEDNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKLKIEVDDSI 1148

Query: 985  FELQTLLMTWIGVLPEAKDLFFQIKTRLA----------------MEEXXXXXXXXXXXX 1028
            FELQTLLM WI ++PEAK LFFQIK  ++                +++            
Sbjct: 1149 FELQTLLMNWITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQTSKD 1208

Query: 1029 XXLEVERRPHTKSNSELNVKLLNLFPSNPAGNN-DNSAISTLRSFITDYPFDTQITPPGR 1087
               +++      SNS  N KL+ LFP     N  +N+AI TL++++  + F  ++   GR
Sbjct: 1209 NNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGR 1268

Query: 1088 KVVFYDGKILPL 1099
            KV++ DGKIL +
Sbjct: 1269 KVIYEDGKILKI 1280

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/846 (39%), Positives = 486/846 (57%), Gaps = 87/846 (10%)

Query: 301  NIMEHSLMRHELLFKILNLPSV--LTP----LLELQFCNLCGLVDPLMQPSPNDEQVISI 354
            ++M+ +  R  +L+K+L    +  + P    L+ L F  +C LVDPL QP PNDE VIS+
Sbjct: 280  DLMKLTERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISL 339

Query: 355  DFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNT 414
            D L+++FL +M P ++   E    YDW++    N+QKI+    L LNC D E+LN V+ T
Sbjct: 340  DLLYKIFLAMMLPHVQVLIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKVDET 399

Query: 415  DSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWK 474
                HW+ QLH WLPHGLN Q+LELLYMI I  +Y I+KLYE  P+  NPFL +LLS WK
Sbjct: 400  K---HWKEQLHLWLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLSTWK 456

Query: 475  NLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHE 534
             L+ V+L  L++DR EEEN ++ TP+MVRATIRGA+ALRSV+AS+LN  +    HDF+HE
Sbjct: 457  KLTYVMLYGLQVDRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQHE 516

Query: 535  SLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMF 594
             LNTFMSP+GRKLC GALYADL+S+TAS+LA G   +D+T+L + LQ GD FDED++YMF
Sbjct: 517  PLNTFMSPHGRKLCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDEDVKYMF 576

Query: 595  DYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEA 654
            +YE +DYNEP  +  DE    + NS   IK +    F +RRC C+F+DD ++     N+A
Sbjct: 577  EYEYDDYNEPEEDESDEDGERN-NSEENIKFN----FNRRRCRCVFSDDDVLEHGDFNDA 631

Query: 655  FEISGXXXXXXXXXXXXXXIPSTATTNSNRFASSINPLSV--RSRSTFEFDYSGEDWRDV 712
                                 S +  NSN   + + P     + ++  EFD+ G+DWR V
Sbjct: 632  -----------------NSEYSNSEENSNDVDNFVLPNDGIDKPKNGVEFDFDGKDWRAV 674

Query: 713  PKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMIL 772
            P+  NM+YS  Y FI+ P   +I +L    +   L++  S +L+ ++AS +K  QD  IL
Sbjct: 675  PRHLNMFYSFDYIFIENPLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDSRIL 734

Query: 773  SDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAW 832
                           +K S N T ++  +   +T D I  I + ++ FE +L  N ++  
Sbjct: 735  G--------------SKRSPNGTDSSKSQNGLSTGDLIKLITAGDT-FENILKFNRELGC 779

Query: 833  RLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIY 892
             LMDE+LM  GYRR+L+WFLTHL L H++IYY+FEL+M  R     G+ SD +R+   + 
Sbjct: 780  FLMDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLMHHR-----GQVSDTEREQSEL- 833

Query: 893  EILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXXX---- 948
                            FSRQG + LSD+E +MLLQEFF NA +F                
Sbjct: 834  -------------SYTFSRQGELRLSDLEREMLLQEFFTNATMFFSSKSVLFASDTGDNN 880

Query: 949  ---------XXXISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLP 999
                         SLY++GL+++ C M+ +L  N  F  + SE  FELQTLLM WI ++P
Sbjct: 881  EINTDVDGEEGLYSLYAVGLMRVTCIMIISLFDNADFDLSSSESIFELQTLLMGWINIIP 940

Query: 1000 EAKDLFFQIKTRLAMEEXXXXXXXXXXXXXXLEVERRPHTKSNSE---LNVKLLNLFPSN 1056
            EAK LFF++K  +                      ++     NSE    N KLL  FP +
Sbjct: 941  EAKLLFFKLKESVK-SFNGIDNPELKSIEESSTTTKKTTIDENSEQYRFNKKLLKTFPKS 999

Query: 1057 PAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHEYIT--- 1113
             +G++ +  + T + F+ +Y FD++    GRKV++   +IL L+  +KPI LH++++   
Sbjct: 1000 FSGDDGDILLKTFKDFLRNYSFDSEPPYIGRKVIYESDEILQLTDIEKPISLHKFLSGEQ 1059

Query: 1114 LAEIDV 1119
            L ++D+
Sbjct: 1060 LYDVDI 1065

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 64/116 (55%), Gaps = 11/116 (9%)

Query: 36  VLLKD--KNYVPSLENLEKLLYN-ESILD---DQKIRLSILFEALSIILFTTKSGKSILQ 89
           V LKD    Y PS+ NL+ LL N E +LD   D   R  +  E + + L  +KSG S+L+
Sbjct: 3   VTLKDILPKYRPSVYNLKNLLRNNELVLDMLADVNERNVLASEVVMMTLLCSKSGSSMLE 62

Query: 90  AVQAS--TLKEKKLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQ 143
              ++  T+ + K    S+   ++   ++   W++NDVL +KFL  LL+N+ T ++
Sbjct: 63  YYMSNIDTIDDYKTSENSIYKKNT---ALALRWENNDVLLIKFLTILLSNRKTLIK 115

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  377 bits (969), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 291/1020 (28%), Positives = 479/1020 (46%), Gaps = 119/1020 (11%)

Query: 60   LDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQS--LRDDDSNYASVV 117
            L D  +  S+L E L I LFTT  G++++  +     +   +      +R +D  + ++ 
Sbjct: 13   LADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVALF 72

Query: 118  QGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNM 177
              W  +  +   FL ++L N+T  + +++Y+   +K+ + FL+ ++    +  L +  N+
Sbjct: 73   GTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNI 132

Query: 178  LKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFE 237
            L DYL++    I+ +++   +     L   + L  Y+R+ EF+  Y W  F      +  
Sbjct: 133  LLDYLHNAKPLIESVLK--KLDGSQFL---QCLMKYNRLYEFNGSYQW--FTPPQSTSHA 185

Query: 238  FSDNFDLLMNSPEDHADGGVIDDRCKSDNPQKHAK---NTIIKRTINDQEQIYSFELDQD 294
             S    L  NS      G   +D  ++ +  K      N++     N            D
Sbjct: 186  ESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPLSKQDD 245

Query: 295  GTLQIPNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISI 354
                 P  +     R  L FK L L     PLL  QF +LC   DP+ QP PND  +IS+
Sbjct: 246  HN---PLNLNGKSDRFNLFFK-LGLHKEPHPLLAEQFNSLCLFADPMTQPPPNDSHIISL 301

Query: 355  DFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNT 414
            D L  L+LG +   I      N    WK +   N++ I  A +  L   D+  L+++ + 
Sbjct: 302  DLLHDLYLGSLTAYIVKLIP-NYQKVWKIHLSANLETITLAILQMLQIWDYRSLDNLKDI 360

Query: 415  D--SVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSL 472
               S   +   +  W+P+ L+  ++E+LYMI  L+ Y+++K++   P +LNPFL  +L  
Sbjct: 361  QARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRA 420

Query: 473  WKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFK 532
            W+ LS  ++L L+IDR EE    Y TP++V A IRGA+ALRS+IA++LNG V    HDFK
Sbjct: 421  WRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFK 480

Query: 533  HESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRY 592
            H+    FMSP+GRKLC+GALY     + A+LL  G   +++ +L  D+Q GDR DED+RY
Sbjct: 481  HQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRY 540

Query: 593  MFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSN-------------GFYQRRCNCI 639
            MFDYE  DYN    ++D  +L +     GK+  +S+              G Y +RC C 
Sbjct: 541  MFDYEYFDYN----DADTSKLTD-----GKLMFTSTKNELEQKNRFRMLRGLY-KRCLCK 590

Query: 640  F------------------NDDKLVAEDGTNEAFEISGXXXXXXXXXXXXXXIPSTATTN 681
            F                  N +K V   G +E  +I+                P T + +
Sbjct: 591  FSDEDDNDDDDDDDDDDDYNGEKSVV--GLDENGQIN------------EAETPQTFSES 636

Query: 682  SNRFASSINPLSVRSRSTF------EFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVI 735
            SN  A +       S++ F       +D +G+DWRD+P+  N+YY   Y F+ +     +
Sbjct: 637  SNAVAFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSL 696

Query: 736  FNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNIT 795
            F L  R     +    +  ++ S+A+CVK EQ+Q++L  + +  AE+D      S++ + 
Sbjct: 697  FELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLITATSAEVDLKVLPFSTDEV- 755

Query: 796  KTNNEELRRTTPDDIYEIWSEESAFERML---NVNHDVAWRLMDEMLMCTGYRRILIWFL 852
                          I  I++++    +       N  + W++ DE++M  G+RR+LI+ L
Sbjct: 756  --------------ITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHL 801

Query: 853  THLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQ 912
            TH     S I+YV+EL+ GLRG P      +  +   +         + E V+ + FSRQ
Sbjct: 802  THRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQ 861

Query: 913  GPIVLSDIETKMLLQEFFMNAAIFLXXXXXXXXXXXXXXISLYSL--------------- 957
            G I LS IE KMLLQEFF+  +  L               +   +               
Sbjct: 862  GVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSR 921

Query: 958  -----GLVKLICYMVQTLIANDKFLFTKSE-CTFELQTLLMTWIGVLPEAKDLFFQIKTR 1011
                 G VK++C++++ ++ + +F F   E   +EL+  LM W     EA  ++  +K++
Sbjct: 922  KAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSK 981

>Suva_2.408 Chr2 (726244..727893) [1650 bp, 549 aa] {ON} YDR242W
           (REAL)
          Length = 549

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 300 PNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVD 339
           P  M  + +RH LLF +LN PS+  P+  +  C + GL+D
Sbjct: 456 PGDMLKTTLRHILLFNVLNFPSLSVPVGTVD-CQMDGLMD 494

>YDR242W Chr4 (946807..948456) [1650 bp, 549 aa] {ON}  AMD2Putative
           amidase
          Length = 549

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 300 PNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQV 351
           P  M  + +R+ LLF +LN PS+  P+  +  C + GL+D     +P D+ +
Sbjct: 456 PGDMLKTTLRYILLFNVLNFPSLSIPVGSVD-CQIDGLMDTTSALNPEDKMI 506

>YHL003C Chr8 complement(100648..101883) [1236 bp, 411 aa] {ON}
           LAG1Ceramide synthase component, involved in synthesis
           of ceramide from C26(acyl)-coenzyme A and
           dihydrosphingosine or phytosphingosine, functionally
           equivalent to Lac1p
          Length = 411

 Score = 32.0 bits (71), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 437 LELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSL-----WKNLSCVILLALEIDR 488
           L ++Y  D L ++    +Y   P+  NPFLF +  L     W   +CV++L LE  R
Sbjct: 191 LYIMYHSD-LWLFKTKPMYRTYPVITNPFLFKIFYLGQAAFWAQQACVLVLQLEKPR 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 124,243,157
Number of extensions: 5821227
Number of successful extensions: 19981
Number of sequences better than 10.0: 55
Number of HSP's gapped: 20410
Number of HSP's successfully gapped: 74
Length of query: 1123
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1003
Effective length of database: 39,721,479
Effective search space: 39840643437
Effective search space used: 39840643437
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)