Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4443.495ON1621628581e-119
Smik_6.2293.495ON1651627073e-96
Suva_7.4213.495ON1651626986e-95
YGR133W (PEX4)3.495ON1831616998e-95
CAGL0I10450g3.495ON1621664348e-55
NDAI0G009103.495ON1631584043e-50
TPHA0D042603.495ON1581583922e-48
ZYRO0D09878g3.495ON1531563861e-47
NCAS0E007803.495ON1711623862e-47
SAKL0F02706g3.495ON1611603852e-47
TDEL0D056303.495ON1501563817e-47
Kwal_55.212463.495ON1601613704e-45
KLTH0F14894g3.495ON1661603671e-44
Kpol_480.133.495ON1571573633e-44
TBLA0C045003.495ON1651593332e-39
Ecym_12343.495ON1611593305e-39
AFR314W3.495ON1551613243e-38
KNAG0B007803.495ON1531282973e-34
KAFR0C019903.495ON1511552941e-33
KLLA0E04027g3.495ON1581602628e-29
TBLA0H031308.375ON2141382041e-19
ZYRO0C03784g8.375ON2181382041e-19
CAGL0E00671g8.375ON2131381971e-18
Kpol_1030.108.375ON2151381962e-18
KLLA0C18656g8.375ON2281061962e-18
Suva_2.3438.375ON2151381935e-18
Smik_4.4258.375ON2151381935e-18
Skud_4.4418.375ON2151381935e-18
Ecym_60388.375ON2111381935e-18
Kwal_14.18286.109ON152991896e-18
YDR177W (UBC1)8.375ON2151381936e-18
NDAI0A011608.375ON2161081927e-18
NDAI0E038707.54ON1641141897e-18
KLTH0A07546g8.375ON2151071919e-18
KAFR0B060608.375ON2131081911e-17
TPHA0L008508.375ON2161071901e-17
ZYRO0D04466g7.54ON1591141862e-17
SAKL0A00396g8.375ON2151381892e-17
KLTH0H06732g6.109ON160991862e-17
NCAS0B031508.375ON2141071892e-17
NCAS0D032206.109ON171991862e-17
Skud_15.5047.54ON1561011852e-17
Smik_15.5177.54ON1561011852e-17
KNAG0A048108.375ON2141081892e-17
KNAG0F025706.109ON151991852e-17
ADR169C8.375ON2111381882e-17
TPHA0J017506.109ON169991853e-17
TDEL0G036106.109ON169991853e-17
YGL058W (RAD6)6.109ON172991853e-17
ZYRO0C04950g6.109ON168991853e-17
Smik_7.2226.109ON171991853e-17
AAR156C6.109ON170991853e-17
Suva_7.2136.109ON173991853e-17
SAKL0A07260g6.109ON169991853e-17
Ecym_30776.109ON170991853e-17
Kpol_461.86.109ON167991843e-17
KAFR0A047006.109ON153991834e-17
CAGL0I00352g6.109ON167991844e-17
TDEL0H039707.54ON1561141835e-17
KLLA0C05632g6.109ON164991835e-17
TBLA0F024406.109ON174991811e-16
Kwal_23.64858.375ON2151071841e-16
Suva_8.3897.54ON1561041791e-16
YOR339C (UBC11)7.54ON1561041782e-16
NDAI0I016506.109ON176991793e-16
KAFR0C002703.308ON1471511773e-16
Kpol_1065.127.54ON1591141773e-16
Skud_7.2226.109ON170991783e-16
Suva_4.3263.308ON1481511755e-16
Suva_2.2183.308ON1481511755e-16
Skud_4.3143.308ON1481511755e-16
YDR059C (UBC5)3.308ON1481511755e-16
TDEL0F049908.375ON2171081796e-16
Smik_4.2973.308ON1481511756e-16
Skud_2.2073.308ON1481511731e-15
Smik_2.2193.308ON1481511731e-15
YBR082C (UBC4)3.308ON1481511731e-15
CAGL0E04752g3.308ON1471511703e-15
KLTH0D01760g7.54ON1611141704e-15
CAGL0M03399g1.436ON2141211735e-15
SAKL0B10582g7.54ON1611141696e-15
Kwal_26.70097.54ON1611141643e-14
KNAG0J023403.308ON1611231643e-14
Kpol_1056.52.569ON1651291643e-14
NDAI0A054903.308ON1471511634e-14
NCAS0A108003.308ON1481511634e-14
NDAI0D011401.436ON2451111684e-14
KAFR0H029601.436ON1871191654e-14
TPHA0I024602.569ON1671391634e-14
KLLA0A11198g1.436ON2021211655e-14
Suva_5.531.436ON2151181656e-14
Ecym_74313.308ON1471531616e-14
KLTH0E14300g3.308ON1471531616e-14
SAKL0B06512g3.308ON1471531616e-14
AER173C3.308ON1471531616e-14
TDEL0F021003.308ON1471531616e-14
Smik_5.981.436ON2151181656e-14
KNAG0H018701.436ON2101091647e-14
Kwal_34.161741.436ON2131201657e-14
KLTH0H13816g1.436ON2331091657e-14
YEL012W (UBC8)1.436ON2181181649e-14
Skud_5.871.436ON2101181631e-13
Ecym_13481.436ON2111021631e-13
KLLA0E12563g3.308ON1481531591e-13
AGR121C8.230ON1541021591e-13
KLLA0E07745g2.569ON1651221601e-13
ZYRO0G12870g3.308ON1471531591e-13
NCAS0G031301.436ON2311091622e-13
Kpol_1030.181.436ON2231191612e-13
SAKL0D10560g1.436ON2071091603e-13
Kpol_1052.23.308ON1481531573e-13
AEL045W1.436ON2111211603e-13
TDEL0B056701.436ON2031191594e-13
TDEL0B065702.569ON1651451574e-13
TBLA0I021303.308ON1481531564e-13
TBLA0A012901.436ON2191111595e-13
Ecym_45782.569ON1651151565e-13
TPHA0O009201.436ON2261091587e-13
TPHA0A038503.308ON1481531547e-13
ABR059W2.569ON1651151558e-13
SAKL0D13552g2.569ON1651151558e-13
TBLA0H026102.569ON1651251558e-13
CAGL0D06468g4.49ON1871201559e-13
Kwal_27.124013.308ON2361231571e-12
KAFR0A021602.569ON1651141541e-12
KNAG0M021502.569ON1701151541e-12
NCAS0A059404.49ON1931311551e-12
NDAI0B015202.569ON1651141522e-12
ZYRO0E06358g2.569ON1651151522e-12
ZYRO0E03806g1.436ON2091191542e-12
CAGL0M07568g2.569ON1651491504e-12
Kwal_26.82242.569ON1651491504e-12
KLTH0D07986g2.569ON1651491495e-12
CAGL0G08063g8.230ON1491021461e-11
Kwal_56.234828.230ON1491011461e-11
NCAS0A127402.569ON1651141461e-11
Suva_13.1892.569ON1651141461e-11
Ecym_55638.230ON1641011461e-11
Smik_13.1862.569ON1651141462e-11
TPHA0B034108.230ON1521091442e-11
Skud_13.1762.569ON1651141452e-11
YMR022W (UBC7)2.569ON1651141452e-11
KLLA0C17622g8.230ON1591111442e-11
SAKL0H17930g8.230ON1531271442e-11
TDEL0A013408.230ON1571011443e-11
KLTH0G14366g8.230ON1491011433e-11
NDAI0J015408.230ON154991433e-11
Suva_2.2538.230ON1431091415e-11
KNAG0H029808.230ON1521171425e-11
Kpol_1075.1b8.230ON152991415e-11
NCAS0B040108.230ON1531111408e-11
ZYRO0B11682g8.230ON1511011391e-10
Skud_4.3528.230ON1431091381e-10
Smik_4.3358.230ON1431091381e-10
Kpol_483.164.249ON122941371e-10
YDR092W (UBC13)8.230ON1531091381e-10
KAFR0H012303.308ON1101061352e-10
KAFR0A024208.230ON1471091372e-10
TDEL0E012204.249ON157941363e-10
TBLA0F037908.230ON1511111337e-10
SAKL0H03058g4.249ON157941338e-10
YDL064W (UBC9)4.249ON157941338e-10
CAGL0D00814g4.249ON1571001331e-09
TPHA0B007704.249ON1571111321e-09
Smik_4.1714.249ON157941321e-09
Kwal_23.42274.249ON122941301e-09
Suva_4.1864.249ON157941321e-09
Skud_4.1914.249ON157941321e-09
KLTH0D14344g4.249ON1571001303e-09
Smik_12.3894.49ON1871301304e-09
Skud_12.3894.49ON1871281296e-09
Ecym_32704.249ON157941277e-09
ZYRO0B12386g4.249ON157941269e-09
NCAS0A024904.249ON1571001261e-08
KLLA0E05039g4.249ON1571041242e-08
KAFR0F030404.49ON1691121252e-08
Kpol_YGOB_414.24.49ON1931151252e-08
NDAI0D043804.249ON1571041232e-08
Kpol_414.2singletonOFF1921151252e-08
KNAG0D043904.249ON1571001232e-08
KNAG0I029404.49ON1971061243e-08
AER056C4.249ON157941224e-08
TBLA0E015704.49ON1941091234e-08
Suva_10.4014.49ON1871071225e-08
TBLA0I029604.249ON1571111206e-08
TDEL0E055604.49ON1871071191e-07
YLR306W (UBC12)4.49ON1881311182e-07
SAKL0H24112g4.49ON1851071173e-07
KLLA0E20395g7.392ON2511181183e-07
KAFR0G032404.249ON157941136e-07
TBLA0D006007.392ON2561171141e-06
KLLA0E19119g6.187ON139651111e-06
Ecym_83714.49ON2671071132e-06
Skud_5.2257.392ON2501231112e-06
YGL087C (MMS2)6.187ON137771082e-06
TPHA0F003904.49ON1931171103e-06
Suva_7.1826.187ON137771083e-06
YER100W (UBC6)7.392ON2501231103e-06
KLTH0H09504g4.49ON1841121093e-06
Smik_5.2467.392ON2501231104e-06
Suva_5.2197.392ON2491231104e-06
ADL035C4.49ON200931094e-06
ZYRO0B03344g7.392ON250901095e-06
Skud_7.1956.187ON100731037e-06
NDAI0A016507.392ON2511171087e-06
Ecym_46837.392ON2431231079e-06
KLTH0C06688g7.392ON2461231071e-05
CAGL0I05478g7.392ON2461171042e-05
KLLA0C17248g4.49ON184831023e-05
KNAG0B023607.392ON2511251033e-05
Kpol_1045.397.392ON2531171033e-05
TDEL0C015507.392ON2481241024e-05
TPHA0M012803.301ON4351161025e-05
KLTH0H04796g6.187ON13899995e-05
NCAS0A143907.392ON2401061015e-05
NCAS0D036606.187ON13861987e-05
NCAS0E026007.392ON2551251008e-05
AFL064W6.187ON13861979e-05
Kpol_1065.453.301ON3231161001e-04
CAGL0H03157g6.187ON139107961e-04
NDAI0D029104.49ON189103981e-04
KAFR0L017507.392ON251125981e-04
SAKL0F12474g7.392ON251124981e-04
SAKL0D02530g3.301ON272114981e-04
Kwal_27.108377.392ON246112972e-04
Smik_7.1966.187ON10073932e-04
TDEL0G015806.187ON13878952e-04
AGR372W7.392ON242124972e-04
TBLA0G032703.301ON330114972e-04
Kwal_27.111826.187ON10174922e-04
TPHA0K008207.392ON25790963e-04
NCAS0A107703.301ON273114963e-04
KNAG0H010403.301ON296112954e-04
NDAI0E041707.392ON257114954e-04
SAKL0A05192g6.187ON14072924e-04
NDAI0A055303.301ON273114954e-04
Skud_4.3063.301ON297114954e-04
ZYRO0G08228g6.187ON13893925e-04
AGL203C3.301ON270114945e-04
TPHA0J022506.187ON13792925e-04
Smik_4.2903.301ON297114945e-04
KLLA0D09196g3.301ON292114946e-04
TDEL0D032603.301ON289114936e-04
YDR054C (CDC34)3.301ON295114937e-04
KAFR0H012703.301ON287114938e-04
Suva_2.2113.301ON29789938e-04
Kwal_27.104443.301ON278114929e-04
CAGL0E04598g3.301ON295118920.001
Ecym_26693.301ON26889910.001
KLTH0C04818g3.301ON27589910.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.444
         (162 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   335   e-119
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   276   3e-96
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   273   6e-95
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   273   8e-95
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   171   8e-55
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   160   3e-50
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   155   2e-48
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   153   1e-47
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   153   2e-47
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   152   2e-47
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   151   7e-47
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   147   4e-45
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   145   1e-44
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   144   3e-44
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   132   2e-39
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   131   5e-39
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   129   3e-38
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   119   3e-34
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   117   1e-33
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   105   8e-29
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    83   1e-19
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    83   1e-19
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    80   1e-18
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    80   2e-18
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    80   2e-18
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    79   5e-18
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    79   5e-18
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    79   5e-18
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    79   5e-18
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    77   6e-18
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    79   6e-18
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      79   7e-18
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    77   7e-18
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    78   9e-18
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    78   1e-17
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    78   1e-17
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    76   2e-17
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    77   2e-17
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    76   2e-17
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      77   2e-17
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      76   2e-17
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    76   2e-17
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    76   2e-17
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    77   2e-17
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    76   2e-17
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    77   2e-17
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    76   3e-17
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    76   3e-17
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    76   3e-17
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    76   3e-17
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    76   3e-17
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    76   3e-17
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    76   3e-17
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    76   3e-17
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    76   3e-17
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    75   3e-17
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    75   4e-17
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    75   4e-17
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    75   5e-17
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    75   5e-17
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    74   1e-16
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    75   1e-16
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    74   1e-16
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    73   2e-16
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      74   3e-16
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    73   3e-16
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    73   3e-16
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    73   3e-16
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    72   5e-16
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    72   5e-16
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    72   5e-16
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    72   5e-16
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    74   6e-16
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    72   6e-16
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    71   1e-15
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    71   1e-15
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    71   1e-15
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    70   3e-15
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    70   4e-15
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    71   5e-15
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    70   6e-15
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    68   3e-14
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    68   3e-14
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    68   3e-14
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    67   4e-14
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    67   4e-14
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    69   4e-14
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    68   4e-14
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    67   4e-14
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    68   5e-14
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    68   6e-14
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    67   6e-14
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    67   6e-14
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    67   6e-14
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    67   6e-14
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    67   6e-14
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    68   6e-14
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    68   7e-14
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    68   7e-14
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    68   7e-14
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    68   9e-14
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    67   1e-13
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    67   1e-13
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    66   1e-13
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    66   1e-13
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    66   1e-13
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    66   1e-13
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                67   2e-13
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    67   2e-13
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    66   3e-13
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    65   3e-13
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    66   3e-13
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    66   4e-13
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    65   4e-13
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    65   4e-13
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    66   5e-13
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    65   5e-13
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    65   7e-13
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    64   7e-13
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    64   8e-13
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    64   8e-13
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    64   8e-13
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    64   9e-13
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    65   1e-12
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    64   1e-12
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    64   1e-12
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     64   1e-12
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    63   2e-12
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    63   2e-12
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    64   2e-12
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    62   4e-12
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    62   4e-12
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    62   5e-12
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    61   1e-11
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    61   1e-11
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    61   1e-11
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    61   1e-11
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    61   1e-11
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    61   2e-11
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    60   2e-11
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    60   2e-11
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    60   2e-11
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    60   2e-11
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    60   2e-11
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    60   3e-11
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    60   3e-11
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    60   3e-11
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    59   5e-11
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    59   5e-11
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    59   5e-11
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    59   8e-11
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    58   1e-10
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    58   1e-10
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    58   1e-10
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    57   1e-10
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    58   1e-10
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    57   2e-10
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    57   2e-10
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    57   3e-10
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    56   7e-10
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    56   8e-10
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    56   8e-10
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    56   1e-09
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    55   1e-09
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    55   1e-09
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    55   1e-09
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    55   1e-09
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    55   1e-09
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    55   3e-09
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    55   4e-09
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    54   6e-09
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    54   7e-09
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    53   9e-09
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    53   1e-08
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    52   2e-08
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    53   2e-08
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    53   2e-08
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    52   2e-08
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    53   2e-08
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    52   2e-08
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    52   3e-08
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    52   4e-08
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    52   4e-08
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    52   5e-08
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    51   6e-08
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    50   1e-07
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    50   2e-07
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    50   3e-07
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    50   3e-07
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    48   6e-07
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    49   1e-06
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    47   1e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    48   2e-06
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    47   2e-06
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    46   2e-06
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    47   3e-06
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    46   3e-06
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    47   3e-06
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    47   3e-06
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    47   4e-06
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    47   4e-06
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    47   4e-06
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    47   5e-06
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    44   7e-06
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    46   7e-06
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    46   9e-06
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    46   1e-05
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    45   2e-05
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    44   3e-05
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    44   3e-05
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    44   3e-05
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    44   4e-05
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    44   5e-05
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    43   5e-05
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    44   5e-05
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    42   7e-05
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    43   8e-05
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    42   9e-05
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    43   1e-04
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    42   1e-04
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       42   1e-04
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    42   1e-04
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    42   1e-04
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    42   1e-04
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    42   2e-04
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    40   2e-04
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    41   2e-04
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    42   2e-04
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    42   2e-04
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    40   2e-04
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    42   3e-04
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    42   3e-04
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                41   4e-04
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    41   4e-04
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    40   4e-04
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    41   4e-04
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    41   4e-04
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    40   5e-04
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    41   5e-04
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    40   5e-04
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    41   5e-04
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    41   6e-04
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    40   6e-04
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    40   7e-04
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                40   8e-04
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    40   8e-04
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    40   9e-04
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    40   0.001
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    40   0.001
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    40   0.001
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    40   0.001
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    39   0.001
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    39   0.002
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    39   0.002
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    38   0.003
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                39   0.003
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    37   0.006
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    37   0.008
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    35   0.029
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    33   0.094
Kwal_14.2523 s14 complement(798584..800005) [1422 bp, 473 aa] {O...    30   2.2  
TBLA0C01460 Chr3 (337725..339455) [1731 bp, 576 aa] {ON} Anc_1.4...    29   5.7  
NDAI0C05320 Chr3 (1232721..1234361) [1641 bp, 546 aa] {ON} Anc_8...    29   5.9  
TPHA0M01140 Chr13 complement(228715..229656) [942 bp, 313 aa] {O...    29   6.0  
ADL147W Chr4 (431885..433765) [1881 bp, 626 aa] {ON} Syntenic ho...    28   8.9  

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  335 bits (858), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/162 (100%), Positives = 162/162 (100%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
           RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162
           RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN
Sbjct: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  276 bits (707), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 129/162 (79%), Positives = 146/162 (90%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSRI KEY  I KTLAS+DPIVNPY+G+I SLNPIDETDLS+WEA I GP+HTPYE+Y+F
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            ILIDVPSSYPM PP I F++N+ILHCN+KS TGEICLDILKPEDWTPVWDLLHCVHA+W
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162
           RLL+EPV DSPLDVDMGNIIRC D  AYQGI++YFLAER+R+
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERS 162

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  273 bits (698), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 143/162 (88%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSRI KEY  I+KTLAS+DP VNPY+G+IESLNP DETDLSKWEA I GP HTPYE Y+F
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
           R+LIDVP SYPMAPP I F+++ ILHCNI S TGEICLDILK +DWTPVWDLLHCVHA+W
Sbjct: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162
           RLL+EPV DSPLDVDMGNIIRCGD  AYQGI++YFLAER+RN
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERN 162

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  273 bits (699), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 146/161 (90%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSRI KEY  I KTLAS+DPI NPY+G+IESLNPIDETDLSKWEAII GP+ TPYE+++F
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
           RILI+VPSSYPM PP I F +NNILHCN+KS TGEICL+ILKPE+WTPVWDLLHCVHA+W
Sbjct: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDR 161
           RLL+EPV DSPLDVD+GNIIRCGD  AYQGI++YFLAER+R
Sbjct: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERER 179

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  171 bits (434), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 109/166 (65%), Gaps = 12/166 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           M+RI+KE   I+K L   D         +  L P+D++DLS+W A+I GP  TPY  Y F
Sbjct: 1   MARISKELLKIRKALEHGD------SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEF 54

Query: 61  RILIDVPSSYPMAPPNIRFDRNNIL------HCNIKSPTGEICLDILKPEDWTPVWDLLH 114
           ++ I+VP+SYPM PP I+F  +         HCN+   TGEICLDILKPE W+P+WD+LH
Sbjct: 55  KLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILH 114

Query: 115 CVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERD 160
            V AI  LL+EPV DSPLDVDM NI++  D  AY GIIRYFL E D
Sbjct: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  160 bits (404), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 80/158 (50%), Positives = 106/158 (67%), Gaps = 2/158 (1%)

Query: 1   MSRIAKEYGDIQKTLASN-DPIVNPYQGLIESLNPID-ETDLSKWEAIIIGPTHTPYEHY 58
           MSRI KEY  IQK L +N +   + +  +I SL PID + DL+KWEA+I GP  TPY  +
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 59  RFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHA 118
            F + I +P  YP  PP   F   ++ HCN+   TGEICLDILK + WTPVW+L+  + A
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120

Query: 119 IWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           IW LLK+PV +SPL+VD+ N++R GD  AY G+I Y+L
Sbjct: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYL 158

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  155 bits (392), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 108/158 (68%), Gaps = 7/158 (4%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + R+ KE   I+K L+        Y   IE L P+   +  KW A++ GP +TPY  + F
Sbjct: 3   LKRLLKEKRLIEKELSG-------YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSF 55

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
           ++LI++PS YP+ PP I F+  ++ HCN++  TG+ICL+IL+ E W+PVW+L++ + A++
Sbjct: 56  KLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAE 158
           +LL+EPV DSPL++D+ NI+R GDT AY G+I Y+L E
Sbjct: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  153 bits (386), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (64%), Gaps = 5/156 (3%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR AKEY  I K L   D +   Y  LI  + P  + DL++WEA+I GP+ TPYE   F
Sbjct: 1   MSRAAKEYKTITKVLKEGDEV---YSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNF 55

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
           R+ + +P  YPM+PP ++F+   + H N+   TGEICLDIL  + W+P WDLLH V AI 
Sbjct: 56  RLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           +LL EPV  SPL+VD+ NI++  D  AY G++ Y++
Sbjct: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  153 bits (386), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 105/162 (64%), Gaps = 5/162 (3%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVN-----PYQGLIESLNPIDETDLSKWEAIIIGPTHTPY 55
           MSR+ KEY  IQ TL+ N    N      +  +I  L+PI  +DL+ W+A I GP  TPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 56  EHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHC 115
            ++ F++ I+ P +YP+ PP I F   ++ HCN+   TG ICLDIL+ + WTP W+L+  
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 116 VHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLA 157
           + AIW LLK+PV DSPL+VD+ NI+R  D  AY G++ Y+L+
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  152 bits (385), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 103/160 (64%), Gaps = 8/160 (5%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE+  ++KTLA +     P    I  L P D  ++  W A I GP  TPY    F
Sbjct: 3   LQRITKEFKSVRKTLAED-----PSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVF 57

Query: 61  RILIDVPSSYPMAPPNIRF---DRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVH 117
            + +++P  YP+ PP ++F    RNNI HCN+   TGEICLDIL  E W+PVWDL+H +H
Sbjct: 58  ALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIH 117

Query: 118 AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLA 157
           AIW LL EPV +SPL+VD+ N+++ GD  AY+G+I+Y++ 
Sbjct: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  151 bits (381), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 98/156 (62%), Gaps = 8/156 (5%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           M+RIA+EY  IQ TL S          L+ SL PID  DLS+W   I GPT TPYE + F
Sbjct: 1   MARIAREYKHIQATLGSE-------SSLVVSLEPID-GDLSRWAGEIRGPTGTPYEGHTF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + + +   YP  PP + F R ++ HCN+   TG ICL+IL PE W+P WDLLH + AI 
Sbjct: 53  SLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           +LL +P  DSPLD+D+ NI+R  D  AY G++ Y+L
Sbjct: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  147 bits (370), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 99/161 (61%), Gaps = 5/161 (3%)

Query: 2   SRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFR 61
            R+AKEY  + KTL  +     P    I  L P+ + +L  WEA I GP+ TPY+ + F 
Sbjct: 3   QRLAKEYKTLLKTLKED-----PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFS 57

Query: 62  ILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWR 121
           +LI +PS+YP+ PP ++F+   + HCN+   +G IC+++L+   W+P WDLLH VHAIW 
Sbjct: 58  LLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWL 117

Query: 122 LLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162
           LL  P  DSPLDVD+  + R GD  A+ G++ Y+L    R 
Sbjct: 118 LLANPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRG 158

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  145 bits (367), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 94/160 (58%), Gaps = 5/160 (3%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R+AKEY  + KTL  +     P    I SL P+ E +L KWE++I GP  TPY  + F +
Sbjct: 4   RLAKEYRALSKTLGRD-----PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTL 58

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I+   +YP+ PP ++F    + HCN+   +G ICL +L    WTP WDLLH VHAIW L
Sbjct: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLL 118

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162
           L  P  DSPLDVD+  ++R GD  A+  +I Y+L    R 
Sbjct: 119 LASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRG 158

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  144 bits (363), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 7/157 (4%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R+ KEY  ++K L +       ++ +I SL PID  DL+ W A I+GP +TPY  + F +
Sbjct: 5   RLLKEYQVVKKELGN-------HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDL 57

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I +   YP+ PP + F    + HCNI+  TG+ICL+IL   +W+PVW+LL  V AI++L
Sbjct: 58  RIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAER 159
           L +PV DSPL++D+ NI++  DT AY G+I Y+L  +
Sbjct: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNK 154

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  132 bits (333), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/159 (42%), Positives = 102/159 (64%), Gaps = 11/159 (6%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDE--TDLSKWEAIIIGPTHTPYEHY 58
           MSRI KEY  I+K        +N     + +L+P+    +DLS W +II+GP  +PY + 
Sbjct: 1   MSRIIKEYNHIRK--------LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNK 52

Query: 59  RFRILIDVPSSYPMAPPNIRFDRNNIL-HCNIKSPTGEICLDILKPEDWTPVWDLLHCVH 117
            F + I +P+ YP  PP I+F++N+I  HCN+   TGEICL+ILK E+W+PVW+LL+ V 
Sbjct: 53  SFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112

Query: 118 AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           AI +LL  P   SPL++D+  ++   D+ AY  +I+Y+L
Sbjct: 113 AIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  131 bits (330), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 95/159 (59%), Gaps = 10/159 (6%)

Query: 2   SRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPI-DETDLSKWEAIIIGPTHTPYEHYRF 60
           SR+  EY  I++ L S++ I+         L P  D   LSKWEA   GP +TPY  + F
Sbjct: 10  SRMLAEYKQIREQLQSHESIL--------MLCPAGDGGSLSKWEAQFCGPENTPYADFTF 61

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I++P  YP  PPN RF  N+I H NIK  TGE+CLD+LK E W+P+++LL  V AI 
Sbjct: 62  TLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIR 121

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAER 159
            LL EP  DSPLDVD+  +    D  AYQG++ Y L  R
Sbjct: 122 TLLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCSR 159

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  129 bits (324), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 95/161 (59%), Gaps = 11/161 (6%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDET--DLSKWEAIIIGPTHTPYEHY 58
           M RI +EY  +QK LA +  ++        SL P+ E   DL +WEA   GP +TPY  +
Sbjct: 1   MRRILREYKQLQKQLALHPAVL--------SLAPVGEENGDLHRWEAHFQGPENTPYAGF 52

Query: 59  RFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHA 118
            F + I+VP +YP  PP   F  ++I H NIK  TGE+CLD+LK E W+PV++LL  V A
Sbjct: 53  TFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEA 112

Query: 119 IWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAER 159
           I  LL EP  DSPLDVD+  +    D  AY G++ Y L  R
Sbjct: 113 ISTLLAEPGVDSPLDVDLSRLY-TTDRAAYDGVVNYRLRTR 152

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  119 bits (297), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 1/128 (0%)

Query: 30  ESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNI 89
            +L+P D  DL+ WEA + GP  TPYE + F + + VP  YP  PP++ F +  + H N+
Sbjct: 22  SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNV 81

Query: 90  KSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQ 149
           K  TGE+CLD L    WTPV DL + V A+ RLL EP  +SPL++++  + R GD  AY 
Sbjct: 82  KWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYD 140

Query: 150 GIIRYFLA 157
           GII+Y LA
Sbjct: 141 GIIKYRLA 148

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  117 bits (294), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 94/155 (60%), Gaps = 11/155 (7%)

Query: 2   SRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFR 61
           SRI KEY D  ++L S           I +L+PI   DL+ WE  I GP H+P+ ++ F+
Sbjct: 3   SRILKEYKD-SRSLQSQ---------YILALDPISTDDLTHWECTIKGPLHSPFANHTFK 52

Query: 62  ILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWR 121
           + ID+P +YP+  P  +F+   + H N+   TGEICLDIL   +W+PV+++ + V AI  
Sbjct: 53  LRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111

Query: 122 LLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           LL EP + SPL++D+ N++R  D  AY  +I Y L
Sbjct: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  105 bits (262), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 91/160 (56%), Gaps = 10/160 (6%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSRI KEY  +QK L +      P    I  L P+D+ DLS+W     GP+ +P+E +  
Sbjct: 1   MSRIVKEYMGLQKRLQT------PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFEL 54

Query: 61  RILIDVP-SSYPMAP-PNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHA 118
            + I +    YP++  P + F+   + H N+K  TGEICLD+LK + WTP++ LL  V A
Sbjct: 55  GLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGA 113

Query: 119 IWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAE 158
           I  LL +P  DSPLD+D+  I    D  AY  I+RY L E
Sbjct: 114 IRDLLADPGLDSPLDLDIAQIYD-ADYEAYVQIVRYRLEE 152

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 74/138 (53%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   ++Q     +DP  N       +L+ ++E+D+   +   +GP  TPYE  RF
Sbjct: 1   MSRAKRIMKEMQAV--KDDPAANI------TLDFVNESDIHHLKGSFLGPPGTPYEGGRF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            I I+VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  MIDIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 73/138 (52%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   ++Q     +DP  N       +L  I E+D+ + +   +GP  TPY+  RF
Sbjct: 1   MSRAKRLMKELQAV--RDDPAANI------TLEFISESDIHRLKGSFLGPPETPYQGGRF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            I I+VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  IIDIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 73/138 (52%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   ++Q     +DP  N       SL  + E+D+   +   +GP  TPYE  +F
Sbjct: 1   MSRAKRIMKELQAV--KDDPEANI------SLEFVSESDIHHLKGSFLGPPGTPYEGGKF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I+VP  YP  PP ++FD + + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  IVDIEVPMEYPFKPPKMKFD-SKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 72/138 (52%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   ++Q     +DP  N       +L  + E+D+   +   +GP  TPY+  RF
Sbjct: 1   MSRAKRIMKEMQAV--KDDPAANI------NLEFVSESDIHHLKGSFLGPPETPYQGGRF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I+VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  IVDIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 32  LNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKS 91
           L  ++E+D+   +   IGP+ TPYE  +F + I++P  YP  PP ++FD   + H N+ S
Sbjct: 24  LKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPYKPPQMKFD-TKVYHPNVSS 82

Query: 92  PTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            TG ICLDILK   WTPV  L   + ++  LL+ P  + P D  + 
Sbjct: 83  VTGAICLDILK-NAWTPVITLKSALISLQALLQSPEPNDPQDAQVA 127

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 72/138 (52%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   +IQ     +DP  +       +L  + E+D+   +   +GP  TPYE  +F
Sbjct: 1   MSRAKRIMKEIQAV--KDDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I+VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  VVDIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 72/138 (52%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   +IQ     +DP  +       +L  + E+D+   +   +GP  TPYE  +F
Sbjct: 1   MSRAKRIMKEIQAV--KDDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I+VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  VVDIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 72/138 (52%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   +IQ     +DP  +       +L  + E+D+   +   +GP  TPYE  +F
Sbjct: 1   MSRAKRIMKEIQAV--KDDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I+VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  VVDIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 71/138 (51%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   +IQ     +DP  N       SL+ + E+D+   +   +GP  TPY   +F
Sbjct: 1   MSRAKRLMKEIQSV--KDDPDANI------SLSFVSESDIHHLKGTFLGPPGTPYHGGKF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  VVDIQVPLEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAK 128

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + I H N+ +  GEICLDIL+
Sbjct: 21  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEIFHPNVYA-NGEICLDILQ 78

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 79.0 bits (193), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 72/138 (52%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   +IQ     +DP  +       +L  + E+D+   +   +GP  TPYE  +F
Sbjct: 1   MSRAKRIMKEIQAV--KDDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I+VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  VVDIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 78.6 bits (192), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 2/108 (1%)

Query: 31  SLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIK 90
            L  ++E+D+   +    GP  TPYE  +F I I+VP  YP  PP ++FD   + H NI 
Sbjct: 23  GLEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPMEYPFKPPKMKFD-TKVYHPNIS 81

Query: 91  SPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
           S TG ICLDILK   W+PV  L   + ++  LL+ P  + P D ++  
Sbjct: 82  SVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (60%), Gaps = 5/114 (4%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           +++P  GL  S  P DE DL+ W AII GP  TPY+  RF++      SYP APP ++F 
Sbjct: 29  MMSPTPGL--SAFPNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKF- 85

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
            + + H N+   +G ICLDILK + W+ V+++   + ++  LL+EP   SPL+ 
Sbjct: 86  ISPMWHPNVDM-SGNICLDILK-DQWSAVYNVETILLSLQALLEEPNNSSPLNA 137

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 78.2 bits (191), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 32  LNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKS 91
           L  ++E D+   +   +GP  TPYE+ +F + I+VP  YP  PP ++FD   + H N+ S
Sbjct: 24  LQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPMEYPFKPPKMKFD-TKVYHPNVSS 82

Query: 92  PTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
            TG ICLDILK   W+PV  L   + ++  LL+ P  + P D ++  
Sbjct: 83  VTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 61/108 (56%), Gaps = 2/108 (1%)

Query: 31  SLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIK 90
           +L  + E+D+   +   IGP  TPYE+  F + I+VP  YP  PP ++FD   + H NI 
Sbjct: 23  TLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEVPMEYPFKPPQMKFD-TKVYHPNIS 81

Query: 91  SPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
           S TG ICLDILK   W+PV  L   + ++  LL+ P  + P D ++  
Sbjct: 82  SVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 2/107 (1%)

Query: 32  LNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKS 91
           L  + E D+   +   +GP  TPYE  +F + I+VP  YP  PP ++FD   + H NI S
Sbjct: 24  LEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPMEYPFKPPKMKFD-TKVYHPNISS 82

Query: 92  PTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
            TG ICLDILK   W+PV  L   + ++  LL+ P  + P D ++  
Sbjct: 83  VTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 68/114 (59%), Gaps = 5/114 (4%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           +++P  GL  S  P +E DL  W  +I+GP  TPYE  +F+I +  P SYP  PP ++F 
Sbjct: 25  MMSPTPGL--SAFPNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKF- 81

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
            + + H N+   +G ICLDILK + W+ V+++   + ++  L +EP   SPL+ 
Sbjct: 82  ISPMWHPNVDM-SGNICLDILK-DQWSAVYNVQTILLSLQSLFEEPNNSSPLNA 133

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 71/138 (51%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   +IQ   A +DP  N       +L+ + E+D+   +    GP  TPYE   F
Sbjct: 1   MSRAKRIIKEIQA--AKDDPEANI------TLSFVSESDIHHLKGSFYGPPGTPYEGGNF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  IVDIQVPLEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 32  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 89

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 90  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 32  LNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKS 91
           L  ++E+D+   +   +GP  TPYE  +F + I+VP  YP  PP ++FD   + H NI S
Sbjct: 24  LEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPMEYPFKPPMMKFD-TKVYHPNISS 82

Query: 92  PTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
            TG ICLDILK   W+PV  L   + ++  LL+ P  + P D ++  
Sbjct: 83  VTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 62/101 (61%), Gaps = 3/101 (2%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P+D+ DL+ W   I+GP  TPY   +F+I ++ P +YP  PP ++F  + + H N+   +
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKF-VSPMWHPNVDK-S 89

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
           G ICLDILK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P+D+ DL+ W   I GP  TPY   +F+I ++ P +YP  PP I+F  + + H N+   +
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKF-VSPMWHPNVDK-S 89

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
           G ICLDILK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLNA 129

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 2/108 (1%)

Query: 31  SLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIK 90
           +L  ++E+D+   +    GP  TPY+  +F + I+VP  YP  PP ++FD   + H N+ 
Sbjct: 23  TLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPMEYPFKPPKMKFD-TKVYHPNVS 81

Query: 91  SPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
           S TG ICLDILK   W+PV  L   + ++  LL+ P  + P D ++  
Sbjct: 82  SVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 78

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 69/138 (50%), Gaps = 10/138 (7%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           MSR  +   +IQ     +DP  N       SL  + E+D+   +   +GP  TPY    F
Sbjct: 1   MSRAKRLMKEIQSV--KDDPDANI------SLAFVSESDIHHLKGTFLGPPGTPYHGGTF 52

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I VP  YP  PP ++FD   + H NI S TG ICLDILK   W+PV  L   + ++ 
Sbjct: 53  IVDIQVPLEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQ 110

Query: 121 RLLKEPVYDSPLDVDMGN 138
            LL+ P  + P D ++  
Sbjct: 111 ALLQSPEPNDPQDAEVAK 128

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP+ TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKF-ISEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-VSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 78

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 75.5 bits (184), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 5/114 (4%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           +++P  GL  S  P  E DL++W  +I+GP  TPYE+ +FR+ +     YP  PP + F 
Sbjct: 22  MMSPTPGL--SAFPASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTF- 78

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
            + + H N+   +G ICLDILK + W+ V+++   + ++  LL+EP   SPL+ 
Sbjct: 79  VSPMWHPNVDM-SGNICLDILK-DQWSAVYNVQTILLSLQALLEEPNNGSPLNA 130

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 74.3 bits (181), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP+ TPYE   FR++++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 131

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 61/107 (57%), Gaps = 2/107 (1%)

Query: 32  LNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKS 91
           L  ++E D+   +   +GP  TPYE+ ++ + I+VP  YP  PP ++F +  + H N+ S
Sbjct: 24  LQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPMEYPFKPPKMKF-QTKVYHPNVSS 82

Query: 92  PTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
            TG ICLDILK   W+PV  L   + ++  LL+ P  + P D ++  
Sbjct: 83  VTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 31  SLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIK 90
           S  P D+ DL+ W   I GP  TPY   +F+I ++ P SYP  PP ++F  + + H N+ 
Sbjct: 29  SAFPEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKF-VSPMWHPNVD 87

Query: 91  SPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
             +G ICLDILK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 88  M-SGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 31  SLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIK 90
           S  P+D+ DL+ W   I GP  TPY   +F++ +  P +YP  PP I+F  + + H N+ 
Sbjct: 29  SAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKF-LSPMWHPNVD 87

Query: 91  SPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
             +G ICLDILK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 88  K-SGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 73.6 bits (179), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  TPYE   FR+L++    YP+  P+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 76/151 (50%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RI+KE  D++K     DPI +   G      P+ + DL  W+A I+GP  +PY    F +
Sbjct: 5   RISKELNDLRK-----DPITSFSAG------PVGD-DLFHWQASIMGPPDSPYAGGVFFL 52

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   L   + +I  L
Sbjct: 53  SIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++ +I +  D   Y+   R
Sbjct: 110 LTDANPDDPLVPEIAHIYKT-DRSKYETTAR 139

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 65/114 (57%), Gaps = 5/114 (4%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           I++P  GL  S  P  E +L+KW   I GP  +PY   RF+I +  P  YP  PP ++F 
Sbjct: 25  IMSPTPGL--SAFPDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKF- 81

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
            + + H N+   +G ICLD+LK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 82  VSPMWHPNVDL-SGNICLDVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNA 133

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 58/99 (58%), Gaps = 3/99 (3%)

Query: 43  WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILK 102
           W A+IIGP  T YE   FR+L++    YP  PP+++F  + + H N+ +  GEICLDIL+
Sbjct: 36  WNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNVYA-NGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
              WTP +D+   + +I  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+++     DP  +   G      P+ + DL  W+A I+GP  +PY    F +
Sbjct: 6   RIAKELSDLER-----DPPTSCSAG------PVGD-DLYHWQASIMGPADSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   L   + +I  L
Sbjct: 54  SIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++ +I +  D   Y+   R
Sbjct: 111 LTDANPDDPLVPEIAHIYKT-DRSKYEATAR 140

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+ +     DP  +   G      P+ + DL  W+A I+GP+ +PY    F +
Sbjct: 6   RIAKELSDLGR-----DPPASCSAG------PVGD-DLYHWQASIMGPSDSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP + F    I H NI S +G ICLDILK + W+P   L   + +I  L
Sbjct: 54  SIHFPTDYPFKPPKVNF-TTKIYHPNINS-SGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++  I +  D   Y+   +
Sbjct: 111 LTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+ +     DP  +   G      P+ + DL  W+A I+GP+ +PY    F +
Sbjct: 6   RIAKELSDLGR-----DPPASCSAG------PVGD-DLYHWQASIMGPSDSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP + F    I H NI S +G ICLDILK + W+P   L   + +I  L
Sbjct: 54  SIHFPTDYPFKPPKVNF-TTKIYHPNINS-SGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++  I +  D   Y+   +
Sbjct: 111 LTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+ +     DP  +   G      P+ + DL  W+A I+GP+ +PY    F +
Sbjct: 6   RIAKELSDLGR-----DPPASCSAG------PVGD-DLYHWQASIMGPSDSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP + F    I H NI S +G ICLDILK + W+P   L   + +I  L
Sbjct: 54  SIHFPTDYPFKPPKVNF-TTKIYHPNINS-SGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++  I +  D   Y+   +
Sbjct: 111 LTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 73.6 bits (179), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 60/108 (55%), Gaps = 2/108 (1%)

Query: 31  SLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIK 90
           +L  + E+D+   +   +GP  TPY+   F + I+VP  YP  PP ++FD   + H N+ 
Sbjct: 23  NLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPMEYPFKPPKMKFD-TKVYHPNVS 81

Query: 91  SPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
           S TG ICLDILK   W+PV  L   + ++  LL+ P  + P D ++  
Sbjct: 82  SVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+ +     DP  +   G      P+ + DL  W+A I+GP+ +PY    F +
Sbjct: 6   RIAKELSDLGR-----DPPASCSAG------PVGD-DLYHWQASIMGPSDSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP + F    I H NI S +G ICLDILK + W+P   L   + ++  L
Sbjct: 54  SIHFPTDYPFKPPKVNF-TTKIYHPNINS-SGNICLDILK-DQWSPALTLSKVLLSVCSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++  I +  D   Y+   +
Sbjct: 111 LTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+++     DP  +   G      P+ + DL  W+A I+GP  +PY    F +
Sbjct: 6   RIAKELSDLER-----DPPTSCSAG------PVGD-DLYHWQASIMGPADSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   L   + +I  L
Sbjct: 54  SIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++ +I +  D   Y+   R
Sbjct: 111 LTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+++     DP  +   G      P+ + DL  W+A I+GP  +PY    F +
Sbjct: 6   RIAKELSDLER-----DPPTSCSAG------PVGD-DLYHWQASIMGPADSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   L   + +I  L
Sbjct: 54  SIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++ +I +  D   Y+   R
Sbjct: 111 LTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+++     DP  +   G      P+ + DL  W+A I+GP  +PY    F +
Sbjct: 6   RIAKELSDLER-----DPPTSCSAG------PVGD-DLYHWQASIMGPADSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   L   + +I  L
Sbjct: 54  SIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++ +I +  D   Y+   R
Sbjct: 111 LTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RIAKE  D+ +     DP  +   G      P+ + DL  W+A I+GP  +PY    F +
Sbjct: 5   RIAKELSDLGR-----DPPTSCSAG------PVGD-DLYHWQASIMGPPDSPYAGGVFFL 52

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   L   + +I  L
Sbjct: 53  SIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++ +I +  D   Y+   R
Sbjct: 110 LTDANPDDPLVPEIAHIYKT-DRAKYEATAR 139

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (60%), Gaps = 5/114 (4%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           +++P  GL  S  P DE DL+KW  II GP  TPYE  RF+I ++   +YP   P +RF 
Sbjct: 27  MLSPSPGL--SAFPEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRF- 83

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
            + + H N+   +G ICLDILK + W+ V+++   + ++  LL+EP   SPL+ 
Sbjct: 84  VSPMWHPNVDM-SGNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 71.2 bits (173), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 67/121 (55%), Gaps = 4/121 (3%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E  + ++     GP  TPYE   +R+ +++P +YP   P+I F  N I H NI   +G I
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 85

Query: 97  CLDILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYF 155
           CLD++    W+P++DLL+ V   +  LLKEP    PL+ +  N ++  D   Y+  +R +
Sbjct: 86  CLDVINST-WSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVREY 143

Query: 156 L 156
           +
Sbjct: 144 I 144

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 69.7 bits (169), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (59%), Gaps = 5/114 (4%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           +++P  GL  S  P +E DL+KW  II GP  TPYE  RF+I +  P SYP   P + F 
Sbjct: 27  MMSPSPGL--SAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTF- 83

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
            + + H N+   +G ICLDILK + W+ V+++   + ++  LL+EP   SPL+ 
Sbjct: 84  VSPMWHPNVDM-SGNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 68/114 (59%), Gaps = 5/114 (4%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           +++P  GL  S  P  E DL+KW  II GP  TPYE  RF+I ++   +YP   P +RF 
Sbjct: 27  MMSPSPGL--SAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRF- 83

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDV 134
            + + H N+   +G ICLDILK + W+ V+++   + ++  LL+EP   SPL+ 
Sbjct: 84  VSPMWHPNVDM-SGNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 63/123 (51%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIK 90
           S  P+ + DL  W+A I+GP  +PY    F + I  P+ YP  PP I F    I H NI 
Sbjct: 36  SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 93

Query: 91  SPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQG 150
           +  G ICLDILK + W+P   L   + +I  LL +   D PL  ++ +I +  D   Y+ 
Sbjct: 94  A-NGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEA 150

Query: 151 IIR 153
             R
Sbjct: 151 TAR 153

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 62/129 (48%), Gaps = 20/129 (15%)

Query: 25  YQGLIES------LNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIR 78
           YQ LI          P +E DL  W+ +I GP  TPYEH  F   +  P  YP++PP + 
Sbjct: 13  YQQLIRDSPPGIVAGPANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFPRDYPLSPPTLT 72

Query: 79  FDRNNILHCNIKSPTGEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEP 126
           F    ILH NI  P GE+C+ I            L  E W+PV  +   + ++  +L EP
Sbjct: 73  FT-PAILHPNIY-PNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEP 130

Query: 127 VYDSPLDVD 135
             +S  ++D
Sbjct: 131 NVESGANID 139

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 73/151 (48%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RI KE  D+ +     DP  +   G      P+ + DL  W+A I+GP  +PY    F +
Sbjct: 5   RITKELSDMGR-----DPPTSCSAG------PVGD-DLYHWQASIMGPPDSPYAGGVFFL 52

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   L   + +I  L
Sbjct: 53  SIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++ +I +  D   Y+   R
Sbjct: 110 LTDANPDDPLVPEIAHIYKT-DRPKYEATAR 139

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 73/151 (48%), Gaps = 16/151 (10%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           RI KE  D+ +     DP  +   G      P+ + DL  W+A I+GP  +PY    F +
Sbjct: 6   RITKELSDMGR-----DPPTSCSAG------PVGD-DLYHWQASIMGPPDSPYAGGVFFL 53

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122
            I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   L   + +I  L
Sbjct: 54  SIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           L +   D PL  ++ +I +  D   Y+   R
Sbjct: 111 LTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 69.3 bits (168), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 49  GPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTP 108
           GP  TPYE+  +R+ +++P +YP   P+I F  N I H NI   +G ICLD++    W+P
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 113

Query: 109 VWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAE 158
           ++DLL+ V   I  LLKEP    PL+ +    +   D   Y+  I+ ++A+
Sbjct: 114 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEYIAK 163

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 68.2 bits (165), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 67/119 (56%), Gaps = 4/119 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           ++ ++     GP  TPYEH  +R+ +++P +YP   P+I F  N I H NI   +G ICL
Sbjct: 28  NMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDVASGSICL 86

Query: 99  DILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           D++    W+P++DL++ V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 87  DVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYEQKIKEYI 143

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 68/139 (48%), Gaps = 20/139 (14%)

Query: 21  IVNPYQGLIES------LNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAP 74
           ++  YQ LI          P DE ++ +W+ +I GP  TPYE+  F   +  P  YP++P
Sbjct: 11  LLKEYQQLIRESPPGIVAGPSDENNMFEWDCLISGPPETPYENGVFNATLLFPKDYPLSP 70

Query: 75  PNIRFDRNNILHCNIKSPTGEICLDI------------LKPEDWTPVWDLLHCVHAIWRL 122
           P + F   ++LH NI  P GE+C+ I            L  E W+PV  +   + ++  +
Sbjct: 71  PKLTFTP-SLLHPNIY-PNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 128

Query: 123 LKEPVYDSPLDVDMGNIIR 141
           L EP  +S  ++D   + R
Sbjct: 129 LSEPNIESGANIDASILYR 147

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 68.2 bits (165), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 66/121 (54%), Gaps = 4/121 (3%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E  + ++     GP  TPYE   +R+ +++P +YP   P+I F  N I H NI + +G I
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 85

Query: 97  CLDILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYF 155
           CLD++    W+P++DLL+ V   I  LLKEP    PL+ +    ++  D   Y+  I  +
Sbjct: 86  CLDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKDKDMYEQKIHEY 143

Query: 156 L 156
           +
Sbjct: 144 I 144

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 68.2 bits (165), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 67/118 (56%), Gaps = 4/118 (3%)

Query: 40  LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLD 99
           + ++    +GP  TPYE+  +R+ +++P +YP   P+I F  N I H NI   +G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++    W+P++DL++ V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 88  VINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + DL  W+A I+GP  +PY    F
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 51  FLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ +I +  D   Y+   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + DL  W+A I+GP  +PY    F
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 51  FLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ +I +  D   Y+   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + DL  W+A I+GP  +PY    F
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 51  FLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ +I +  D   Y+   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + DL  W+A I+GP  +PY    F
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 51  FLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ +I +  D   Y+   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + D+  W+A I+GP  +PY    F
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DIYHWQASIMGPPDSPYAGGVF 50

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 51  FLSIHFPTDYPFKPPKIAF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ +I +  D   Y+   R
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAR 139

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 68.2 bits (165), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 67/118 (56%), Gaps = 4/118 (3%)

Query: 40  LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLD 99
           + ++    +GP  TPYE+  +R+ +++P +YP   P+I F  N I H NI   +G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++    W+P++DL++ V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 88  VINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 67.8 bits (164), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 49  GPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTP 108
           GP  TPYE+  +R+ +++P +YP   P+I F  N I H NI   +G ICLD++    W+P
Sbjct: 39  GPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSICLDVINST-WSP 96

Query: 109 VWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++DLL+ V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 97  LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYI 144

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 68.2 bits (165), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 40  LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLD 99
           + ++     GP  TPYE   +R+ +++P +YP   P+I F  N I H NI + +G ICLD
Sbjct: 17  MQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLD 75

Query: 100 ILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAE 158
           ++    W+P++DLL+ +   I  LLKEP    PL+ +    ++      Y+  IR F+ +
Sbjct: 76  VINSA-WSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAA-TLQLKSKELYERKIREFIDQ 133

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 68.2 bits (165), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 49  GPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTP 108
           GP  TPYE   +R+ +++P +YP   P+I F  N I H NI + +G ICLD++    W+P
Sbjct: 38  GPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVINST-WSP 95

Query: 109 VWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++DL++ V   I  LLKEP    PL+ +    ++  +   Y+  IR F+
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEQKIREFI 143

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 67.8 bits (164), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 67/118 (56%), Gaps = 4/118 (3%)

Query: 40  LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLD 99
           + ++    +GP  TPYE+  +R+ +++P +YP   P+I F  N I H NI   +G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++    W+P++DL++ V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 88  VINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 67/118 (56%), Gaps = 4/118 (3%)

Query: 40  LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLD 99
           + ++    +GP  TPYE+  +R+ +++P +YP   P+I F  N I H NI   +G ICLD
Sbjct: 28  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 86

Query: 100 ILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++    W+P++DL++ +   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 87  VINST-WSPLYDLINILEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 142

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (58%), Gaps = 3/102 (2%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           ++ ++    +GP  TPYE   +R+ +++P +YP   P+I F  N I H NI + +G ICL
Sbjct: 28  NMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 86

Query: 99  DILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNI 139
           D++    W+P++DL++ V   I  LLKEP    PL+ +   +
Sbjct: 87  DVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL 127

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + D+  W+A I+GP  +PY    F
Sbjct: 4   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DVYHWQASIMGPPDSPYAGGVF 51

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 52  FLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ ++ +  D   Y+   R
Sbjct: 109 SLLTDANPDDPLVPEIAHLYKT-DRAKYEATAR 140

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (53%), Gaps = 3/102 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  ++  I GP  +PYEH  FR+ + +P  YPM PP +RF    I H NI    G I
Sbjct: 29  EDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
           CLD+LK  +W+P   +   + +I  LL  P  + PL  D+  
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 67/122 (54%), Gaps = 16/122 (13%)

Query: 26  QGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNIL 85
           +G++ S  PID+++L +W+ +I+GP  + YE   F   +D P  YP+ PP + F + +IL
Sbjct: 22  EGILAS--PIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPLNPPKLTF-QPSIL 78

Query: 86  HCNIKSPTGEICLDILKP------------EDWTPVWDLLHCVHAIWRLLKEPVYDSPLD 133
           H NI  P GE+C+ IL              E W+PV  +   + ++  +L EP  +S  +
Sbjct: 79  HPNIY-PNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSILSEPNIESGAN 137

Query: 134 VD 135
           +D
Sbjct: 138 ID 139

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + D+  W+A I+GP  +PY    F
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DVYHWQASIMGPPDSPYAGGVF 50

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 51  FLSIHFPTDYPFKPPKIAF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ +I +  D   Y+   R
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEAQAR 139

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 67.0 bits (162), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 61/109 (55%), Gaps = 4/109 (3%)

Query: 49  GPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTP 108
           GP  TPYE   +R+ +++P +YP   P+I F  N I H NI   +G ICLD++    W+P
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINS-TWSP 118

Query: 109 VWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++DLL+ V   I  LLKEP    PL+ +    +   D   Y+  IR ++
Sbjct: 119 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYI 166

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 67/119 (56%), Gaps = 4/119 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           ++ ++     GP  TPYE+  +R+ +++P +YP   P+I F  N I H NI   +G ICL
Sbjct: 29  NMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 87

Query: 99  DILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           D++    W+P++DLL+ V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 88  DVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYI 144

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 49  GPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTP 108
           GP  TPYE   +R+ +++P +YP   P+I F  N I H NI + +G ICLD++    W+P
Sbjct: 26  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVINST-WSP 83

Query: 109 VWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++DL++ V   I  LLKEP    PL+ +    ++  +   Y+  I+ ++
Sbjct: 84  LYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEEKIQEYI 131

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + D+  W+A I+GP  +PY    F
Sbjct: 4   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DVYHWQASIMGPPDSPYAGGVF 51

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 52  FLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ ++ +  D   Y+   +
Sbjct: 109 SLLTDANPDDPLVPEIAHLYKT-DRAKYEATAK 140

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 68/121 (56%), Gaps = 4/121 (3%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           + ++ ++     GP  TPYE   +R+ +++P +YP   P+I F  N I H NI + +G I
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 97  CLDILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYF 155
           CLD++    W+P++DLL+ V   I  LLKEP    PL+ +    ++  +   Y+  I+ +
Sbjct: 85  CLDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNPQMYEEKIQEY 142

Query: 156 L 156
           +
Sbjct: 143 I 143

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           ++ ++     GP  TPYE   +R+ +++P +YP   P+I F  N ILH NI   +G ICL
Sbjct: 16  NMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKILHPNIDVASGSICL 74

Query: 99  DILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           D++    W+P++DL + V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 75  DVINST-WSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 131

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 71/145 (48%), Gaps = 25/145 (17%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R+ KEY  +         I +P  G++ +  P  E++L  W+ +I GP  TPYE   F  
Sbjct: 8   RLLKEYQQL---------IRDPPPGILAA--PKSESNLFLWDCLIQGPPDTPYEGGIFNA 56

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI------------LKPEDWTPVW 110
            +D P  YP++PP + F   +ILH NI    GE+C+ I            L  E W+PV 
Sbjct: 57  RLDFPKDYPLSPPKLTFT-PSILHPNIYH-NGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAIWRLLKEPVYDSPLDVD 135
            +   + ++  +L EP  +S  +VD
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANVD 139

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + D+  W+A I+GP  +PY    F
Sbjct: 4   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DIYHWQASIMGPPDSPYAGGVF 51

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 52  FLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ +I +  D   Y+   +
Sbjct: 109 SLLTDANPDDPLVPEIAHIYKT-DRPKYEATAK 140

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 65.9 bits (159), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (55%), Gaps = 4/111 (3%)

Query: 47  IIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDW 106
             GP  TPYE   +R+ +++P +YP   P+I F  N I H NI   +G ICLD++    W
Sbjct: 36  FFGPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINS-TW 93

Query: 107 TPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           +P++DL++ V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 94  SPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKIKEYI 143

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 64.7 bits (156), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 14/115 (12%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
            P++E ++  W+ +I GP  +PYE   F   +  P+ YP++PP + F   +ILH N+  P
Sbjct: 27  GPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPTDYPLSPPKLTFTP-SILHPNVY-P 84

Query: 93  TGEICLDIL------------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
            GE+C+ IL              E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 85  NGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 65.5 bits (158), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 62/109 (56%), Gaps = 4/109 (3%)

Query: 49  GPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTP 108
           GP  TPYE   +R+ +++P +YP   P+I F  N I H NI   +G ICLD++    W+P
Sbjct: 40  GPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVINST-WSP 97

Query: 109 VWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           ++DLL+ +   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 98  LYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYI 145

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 63.9 bits (154), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + RI KE  D+ +     DP  +   G      P+ + D+  W+A I+GP  +PY    F
Sbjct: 4   LKRITKELNDLGR-----DPPTSCSAG------PVGD-DIYHWQASIMGPPDSPYAGGVF 51

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120
            + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+P   +   + +I 
Sbjct: 52  FLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
            LL +   D PL  ++ ++ +  D   Y+   +
Sbjct: 109 SLLTDANPDDPLVPEIAHLYKT-DRPKYEATAK 140

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 14/115 (12%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
            P+ E +L  W+ +I GP  +PYE   F   +  P  YP++PP + F   +ILH N+  P
Sbjct: 27  GPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPLSPPKLTFT-PSILHPNVY-P 84

Query: 93  TGEICLDIL------------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
            GE+C+ IL              E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 85  NGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 14/115 (12%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
            P  E +L  W+ +I GP  +PYE   F  +++ P  YP++PP + F   +ILH NI  P
Sbjct: 27  GPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPLSPPRLTFT-PSILHPNIY-P 84

Query: 93  TGEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
            GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 85  NGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSMLSEPNVESGANID 139

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 64/125 (51%), Gaps = 16/125 (12%)

Query: 23  NPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRN 82
           +P  G+I +  P  E+DL  W+ ++ GP  TPY    F   +  P+ YP++PP + F   
Sbjct: 19  DPPPGIIAA--PKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPTDYPLSPPTLTF-TP 75

Query: 83  NILHCNIKSPTGEICLDILKP------------EDWTPVWDLLHCVHAIWRLLKEPVYDS 130
           +ILH N+  P GE+C+ IL              E W+PV  +   + ++  +L EP  +S
Sbjct: 76  SILHPNVY-PNGEVCISILHAPGSDPNMYELPEERWSPVQSVEKILLSVVSMLSEPNVES 134

Query: 131 PLDVD 135
             ++D
Sbjct: 135 GANID 139

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 64.3 bits (155), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 14/120 (11%)

Query: 46  IIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPED 105
           III P    Y+  +FR       +YP+ PP +    N I H NI  P G+ICL+IL+ ED
Sbjct: 67  IIIIPDEGFYKGGKFRFTATFLETYPIDPPKV-ICNNKIFHPNI-DPHGKICLNILR-ED 123

Query: 106 WTPVWDLLHCVHAIWRLLKEPVYDSPLD-----------VDMGNIIRCGDTGAYQGIIRY 154
           W+P  DL   V  +  L +EP  + PL+           ++ GN++R   +GA  G   Y
Sbjct: 124 WSPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVRLAMSGAMVGSTYY 183

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 63/123 (51%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIK 90
           S  P+ + DL  W+A I+GP  +PY    F + I  P+ YP  PP I F    I H NI 
Sbjct: 111 SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN 168

Query: 91  SPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQG 150
           +  G ICLDILK + W+P   +   + +I  LL +   D PL  ++ +I +  D   Y+ 
Sbjct: 169 A-NGNICLDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEA 225

Query: 151 IIR 153
             +
Sbjct: 226 TAK 228

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 59/114 (51%), Gaps = 14/114 (12%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P  E ++ +W+ ++ GP  +PYE   F   +D P  YP++PP + F   +ILH NI  P 
Sbjct: 28  PKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 94  GEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 86  GEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 14/115 (12%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
            P DE+DL  W+ ++ GP  +PYE   F   +  P  YP++PP + F   ++LH N+  P
Sbjct: 27  GPQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTF-VPSVLHPNVY-P 84

Query: 93  TGEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
            GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 85  NGEVCISILHAPGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANID 139

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (48%), Gaps = 5/131 (3%)

Query: 24  PYQGLIESLNPIDETDLSK-WEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRN 82
           P   L   ++P D + L      +II P    Y++  FR  ++   +YPM PP +   RN
Sbjct: 50  PTVSLTICISPTDPSSLDNPLLDVIISPDEGYYKNGHFRFSLEFNDNYPMEPPKV-VCRN 108

Query: 83  NILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRC 142
            I H NI    G++CL+IL+ EDW+P  DL   +  +  L  EP    PL+ D   +   
Sbjct: 109 RIYHPNIDV-QGKVCLNILR-EDWSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVF-S 165

Query: 143 GDTGAYQGIIR 153
            D+ A+   +R
Sbjct: 166 KDSNAFAKFVR 176

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 14/114 (12%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P +E +L  W+ ++ GP  T YE   F   +D P  YP++PP + F   +ILH NI  P 
Sbjct: 28  PANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPKDYPLSPPKLTFTP-SILHPNIY-PN 85

Query: 94  GEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 57/115 (49%), Gaps = 14/115 (12%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
            P  E DL  W+ +I GP  TPYE   F   ++ P  YP++PP + F   +ILH NI   
Sbjct: 27  GPRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNIYH- 84

Query: 93  TGEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
            GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  +VD
Sbjct: 85  NGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANVD 139

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 65/119 (54%), Gaps = 4/119 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           ++ ++     GP  TPYE   +R+ +++P +YP   P+I F  N I H NI   +G ICL
Sbjct: 30  NMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 88

Query: 99  DILKPEDWTPVWDLLHCVH-AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156
           D++    W+P++DL + V   I  LLKEP    PL+ +    ++  D   Y+  I+ ++
Sbjct: 89  DVINS-TWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 145

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 74/149 (49%), Gaps = 24/149 (16%)

Query: 1   MSRIAKE--YGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHY 58
           MS+ A++  Y ++Q+ +  + P      G++    P  + +L  W+ +I GP  TPY   
Sbjct: 1   MSKTAQKRLYKELQQLIKDSPP------GIVA--GPKSDDNLFVWDCLIQGPPDTPYAGG 52

Query: 59  RFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDIL------------KPEDW 106
            F   ++ P  YP++PP + F   +ILH NI  P GE+C+ IL              E W
Sbjct: 53  VFNAQLEFPKDYPLSPPKLTF-TPSILHPNIY-PNGEVCISILHSPGDDPNMYESAEERW 110

Query: 107 TPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           +PV  +   + ++  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 75/149 (50%), Gaps = 24/149 (16%)

Query: 1   MSRIAKE--YGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHY 58
           MS+ A++  + ++Q+ L  +       +G++    P  E +L  W+ +I GP  +PY+  
Sbjct: 1   MSKTAQKRLFKELQQLLKDSP------EGIVA--GPKSEDNLFVWDCLISGPPDSPYQGG 52

Query: 59  RFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI------------LKPEDW 106
            F   ++ P  YP++PP + F   +ILH NI  P GE+C+ I            L  E W
Sbjct: 53  VFNATLEFPKDYPLSPPKLLF-TPSILHPNIY-PNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           +PV  +   + ++  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNVESGANID 139

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 75/149 (50%), Gaps = 24/149 (16%)

Query: 1   MSRIAKE--YGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHY 58
           MS+ A++  + ++Q+ L  +       +G++    P  E +L  W+ +I GP  +PY+  
Sbjct: 1   MSKTAQKRLFKELQQLLKDSP------EGIVA--GPRSEDNLFLWDCLISGPPDSPYQGG 52

Query: 59  RFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI------------LKPEDW 106
            F   ++ P  YP++PP + F   +ILH NI  P GE+C+ I            L  E W
Sbjct: 53  VFNATLEFPKDYPLSPPKLLF-TPSILHPNIY-PNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           +PV  +   + ++  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNVESGANID 139

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (52%), Gaps = 3/102 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  ++  I GP+ +PYE   F++ + +P  YPM  P +RF    I H NI    G I
Sbjct: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGN 138
           CLD+LK  +W+P   +   + +I  LL  P  + PL  D+  
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  ++  I GP  +PYE+  F++ + +P  YPM  P +RF    I H NI    G I
Sbjct: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 14/114 (12%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P +E +L  W+ ++ GP  T YE   F   ++ P  YP++PP + F   +ILH NI  P 
Sbjct: 28  PKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 94  GEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANID 139

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P  E ++  W+ +I GP  TPY    F   ++ P  YP++PP + F   +ILH NI  P 
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 94  GEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  ++  I GP  + YE+  FR+ + +P  YPM PP +RF    I H NI    G I
Sbjct: 29  EDNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           CLD+LK  +W+P   +   + +I  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P  E ++  W+ +I GP  TPY    F   ++ P  YP++PP + F   +ILH NI  P 
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 94  GEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L  +   I GP  +PYEH  F + + +P  YPM  P +RF    I H NI    G ICL
Sbjct: 31  NLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRF-LTKIYHPNIDR-LGRICL 88

Query: 99  DILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           D+LK  +W+P   +   + +I  LL  P  + PL  D+       +TGA
Sbjct: 89  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNETGA 136

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P  E ++  W+ +I GP  TPY    F   ++ P  YP++PP + F   +ILH NI  P 
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 94  GEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P  E ++  W+ +I GP  TPY    F   ++ P  YP++PP + F   +ILH NI  P 
Sbjct: 28  PKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 94  GEICLDI------------LKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
           GE+C+ I            L  E W+PV  +   + ++  +L EP  +S  ++D
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 58/111 (52%), Gaps = 4/111 (3%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  ++  I GP  +PYE+  F++ + +P  YPM  P +RF    I H NI    G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNI-IRCGDTG 146
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+    I+  DT 
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHEDTA 136

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 6/127 (4%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           + +P  G+  S  P D+ +L  ++  I GP  +PYE+  F + + +P  YPM  P +RF 
Sbjct: 16  VSDPVPGI--SAEPHDD-NLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRF- 71

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNII 140
              I H NI    G ICLD+LK  +W+P   +   + +I  LL  P  + PL  D+    
Sbjct: 72  LTKIYHPNIDR-LGRICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW 129

Query: 141 RCGDTGA 147
              + GA
Sbjct: 130 IKNEEGA 136

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  ++  I GP  +PYE+  F + + +P  YPM  P +RF    I H NI    G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRF-LTKIYHPNIDK-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  ++  I GP  +PYE   F++ + +P  YPM  P +RF    I H NI    G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 53/99 (53%), Gaps = 3/99 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L  +   + GPT +PYE+  F++ + +P  YPM  P +RF    I H NI    G ICL
Sbjct: 31  NLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRICL 88

Query: 99  DILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           D+LK  +W+P   +   + +I  LL  P  + PL  D+ 
Sbjct: 89  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 58.9 bits (141), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L  ++  I GP  +PYE   F++ + +P  YPM  P +RF    I H NI    G ICL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRICL 78

Query: 99  DILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           D+LK  +W+P   +   + +I  LL  P  + PL  D+       + GA
Sbjct: 79  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGA 126

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 59.3 bits (142), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (52%), Gaps = 6/117 (5%)

Query: 21  IVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD 80
           I +P  G+  +  P D+ +L  +E  + GP  +PYE+  F++ + +P  YPM  P +RF 
Sbjct: 16  ITDPVPGI--TAEPHDD-NLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRF- 71

Query: 81  RNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
              I H NI    G ICLD+LK  +W+P   +   + +I  LL  P  + PL  D+ 
Sbjct: 72  LTKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 58.9 bits (141), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (52%), Gaps = 3/99 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L  +E  I GP  +PYE+  F + + +P  YPM  P +RF    I H NI    G ICL
Sbjct: 31  NLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRICL 88

Query: 99  DILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           D+LK  +W+P   +   + +I  LL  P  + PL  D+ 
Sbjct: 89  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 58.5 bits (140), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 3/111 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  +   + GP  +PYE+  F++ + +P  YPM  P +RF    I H NI    G I
Sbjct: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+       + GA
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAGA 136

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 52/101 (51%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  +   I GP  +PYE+  F + + +P  YPM  P +RF    I H NI    G I
Sbjct: 29  EDNLRYFAVTIEGPEESPYENGVFELELYLPDDYPMEAPKVRF-LTRIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           CLD+LK  +W+P   +   + +I  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L  ++  I GP  +PYE   F + + +P  YPM  P +RF    I H NI    G ICL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRF-LTRIYHPNIDR-LGRICL 78

Query: 99  DILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           D+LK  +W+P   +   + +I  LL  P  + PL  D+       + GA
Sbjct: 79  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGA 126

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L  ++  I GP  +PYE   F + + +P  YPM  P +RF    I H NI    G ICL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRICL 78

Query: 99  DILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           D+LK  +W+P   +   + +I  LL  P  + PL  D+       + GA
Sbjct: 79  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEVGA 126

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 57.4 bits (137), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           DL +WEA I G T T +    + I I+ P  YP  PP + F +    H N+  P+G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPK-GFYHPNV-YPSGTICL 59

Query: 99  DILKPE-DWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL  E DW P   L   V  +  LL  P  +SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L  ++  I GP  +PYE   F + + +P  YPM  P +RF    I H NI    G ICL
Sbjct: 31  NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRICL 88

Query: 99  DILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           D+LK  +W+P   +   + +I  LL  P  + PL  D+       + GA
Sbjct: 89  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGA 136

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 56.6 bits (135), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 53/106 (50%), Gaps = 4/106 (3%)

Query: 48  IGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWT 107
           +GP  +PY    F + I  P+ YP  PP I F    I H NI +  G ICLDILK + W+
Sbjct: 1   MGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNINA-NGNICLDILK-DQWS 57

Query: 108 PVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIR 153
           P   L   + +I  LL +   D PL  ++ +I +  D   Y+   R
Sbjct: 58  PALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 102

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L  ++  I GP  +PYE   F++ + +P  YPM  P +RF    I H NI    G ICL
Sbjct: 27  NLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRICL 84

Query: 99  DILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           DILK  +W+P   +   + ++  LL  P  + PL  D+       + GA
Sbjct: 85  DILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEEGA 132

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L KWEA I G   T ++H  + I I+ P  YP  PP +RF      H NI  P+G +CL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFP-AGFYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L   V  +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 55.8 bits (133), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 37  ETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
           E +L  +   I GP  + YE+  F + + +P  YPM  P +RF    I H NI    G I
Sbjct: 29  EDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           CLD+LK  +W+P   +   + +I  LL  P  + PL  D+       + GA
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEKGA 136

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 55.8 bits (133), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L KWEA I G   T ++   + I I+ P  YP  PP ++F      H NI  P+G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L   V  +  LL  P  DSP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 55.8 bits (133), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           DL KWEA I G   T +    + I ++ P+ YP  PP ++F      H N+  P+G ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L   V  +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
            P    +L KWEA I G   T ++   F I ++ P  YP  PP ++F      H NI  P
Sbjct: 31  GPDGTLNLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPA-GFYHPNI-YP 88

Query: 93  TGEICLDIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
           +G +CL IL + +DW P   L   V  +  LL  P  +SP
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 23  NPYQGLIESLNPIDET-DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDR 81
           +P+    + L   D T DL  WEA I G   T +    + I I+ P  YP  PP ++F  
Sbjct: 20  HPFSFFAKPLKKADGTMDLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFP- 78

Query: 82  NNILHCNIKSPTGEICLDIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
               H NI  P+G +CL IL + +DW P   L   V  +  LL  P  +SP
Sbjct: 79  AGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           DL KWEA I G   T +    + I ++ P+ YP  PP ++F      H N+  P+G ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L   V  +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 54.7 bits (130), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L KWEA I G   T ++   F I I+ P  YP  PP ++F      H NI  P+G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 59

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L      +  LL  P  +SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           DL KWEA I G   T +    + I ++ P+ YP  PP ++F      H N+  P+G ICL
Sbjct: 37  DLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKFP-AGFYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L   V  +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           DL KWEA I G   T +    + I ++ P+ YP  PP ++F      H N+  P+G ICL
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L   V  +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 54.7 bits (130), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
            P    +L KWEA I G   T ++   F I I+ P  YP  PP ++F      H NI  P
Sbjct: 31  KPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKFP-AGFYHPNI-YP 88

Query: 93  TGEICLDIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
           +G +CL IL + +DW P   L      +  LL  P  +SP
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 5/130 (3%)

Query: 28  LIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHC 87
           +I S +  + T   K E I + P    Y H      +D    YP+ PP +   +  I H 
Sbjct: 48  VITSPDSTNRTHSPKLE-ITVNPDEGYYTHGSINFSLDFNEVYPIEPPKVACLKR-IFHP 105

Query: 88  NIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147
           NI    G +CL+IL+ EDW+P  DL   V  +  L  EP  + PL+ D   ++ C D   
Sbjct: 106 NIDF-KGNVCLNILR-EDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL-CQDEKE 162

Query: 148 YQGIIRYFLA 157
           +   +R  ++
Sbjct: 163 FAEAVRSTMS 172

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 54.3 bits (129), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 58/128 (45%), Gaps = 6/128 (4%)

Query: 32  LNPIDETD--LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNI 89
           + P D TD   S    + + P    Y H      +D    YP+ PP +   +  I H NI
Sbjct: 49  ITPPDSTDRMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKVACLKK-IFHPNI 107

Query: 90  KSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQ 149
               G +CL+IL+ EDW+P  DL   +  +  L  EP  + PL+ D   +  C +   + 
Sbjct: 108 DL-KGNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF-CQNEKKFA 164

Query: 150 GIIRYFLA 157
            I+R  ++
Sbjct: 165 EIVRSTMS 172

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L KWEA I G   T ++   + I I+ P  YP  PP ++F      H NI  P+G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   +   +  +  LL  P  DSP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L KWEA I G   T ++   + I I+ P  YP  PP ++F      H NI  P+G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFP-AGFYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L      +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
           +P    +L KWEA I G   T +    + I I+ P+ YP  PP ++    N  H N+  P
Sbjct: 31  HPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLPA-NFYHPNV-YP 88

Query: 93  TGEICLDIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
           +G ICL IL + +DW P   L      I  LL  P  +SP
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 52/104 (50%), Gaps = 7/104 (6%)

Query: 33  NPIDETD----LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCN 88
            P  +TD    L KWEA I G   T +++  + + I+ P  YP  PP ++F      H N
Sbjct: 27  KPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFP-AGFYHPN 85

Query: 89  IKSPTGEICLDIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
           +  P+G ICL IL + +DW P   L   +  +  LL  P  +SP
Sbjct: 86  V-YPSGTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 29  IESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCN 88
           + +L P ++T  S    I I P    Y   RF+  +    SYP+ PP++      I H N
Sbjct: 32  LTTLVPPEDTSRSPLLQITICPDEGFYNGGRFKFNLTTSESYPIDPPSV-VCLQKIYHPN 90

Query: 89  IKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNII 140
           I    G+ICL+IL+ EDW+P  D+   +  +  L  EP    PL+ D  + +
Sbjct: 91  IDL-NGKICLNILR-EDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTL 140

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 45  AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPE 104
            ++I P    Y+  +F+  +    +YP+ PP I    N I H NI    G+ICL+IL+ E
Sbjct: 72  TLLISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNI-DLDGKICLNILR-E 128

Query: 105 DWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAER 159
           DW+P  DL   +  +  L  E     PL+ +  NI+   D   ++  +R  +A +
Sbjct: 129 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILH-SDEDMFRKYVRDSMAGK 182

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 33  NPIDETD----LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCN 88
            P  +TD    L KWEA I G   T +    + I I+ P+ YP  PP ++       H N
Sbjct: 27  KPTKKTDGTMNLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPA-GFYHPN 85

Query: 89  IKSPTGEICLDILKPE-DWTPVWDLLHCVHAIWRLLKEPVYDSP 131
           +  P+G ICL IL  E DW P   L      I  LL  P  +SP
Sbjct: 86  V-YPSGTICLSILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 45  AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPE 104
            ++I P    Y+  +F+  +    +YP+ PP I    N I H NI    G+ICL+IL+ E
Sbjct: 71  TLLISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNI-DLDGKICLNILR-E 127

Query: 105 DWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAER 159
           DW+P  DL   +  +  L  E     PL+ +  NI+   D   ++  +R  +A +
Sbjct: 128 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILH-SDEDMFRKYVRDSMAGK 181

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
            P    DL +WEA I G   T +    + + I+ P  YP  PP ++    N  H N+  P
Sbjct: 31  KPDGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKLP-ANFYHPNV-YP 88

Query: 93  TGEICLDIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
           +G ICL IL + +DW P   L      I  LL  P  +SP
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 57  HYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCV 116
           H+RF+  I+   +YP+ PP +      I H NI   TGEICL+IL+ EDW+P  DL   +
Sbjct: 90  HFRFQFTIN--ENYPIEPPKV-VCLTKIYHPNINR-TGEICLNILR-EDWSPALDLQSVI 144

Query: 117 HAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162
             +  L  EP    PL+    + +   D   ++ I++  +A    N
Sbjct: 145 IGLLFLFIEPNPKDPLNKQAADTL-LHDPAVFKHIVQKSMAGESIN 189

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L KWEA I G   T ++   + I I+ P  YP  PP ++F      H NI  P+G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFP-AGFYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   +   +  +  LL  P  +SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

Query: 33  NPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSP 92
           +PI+    S    I I P    Y+   F   +    SYP+ PP ++F +  I H NI   
Sbjct: 58  SPIEFPAESPELLITIHPDEGIYKDGYFPFSMVFKDSYPIEPPVVKFLKK-IYHPNIDL- 115

Query: 93  TGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
            G+ICL+IL+ EDW+PV DL   +  +  L  EP    PL++  G +++
Sbjct: 116 NGKICLNILR-EDWSPVLDLQSIIIGLMFLFLEPNPRDPLNLKAGELLK 163

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 49/107 (45%), Gaps = 4/107 (3%)

Query: 46  IIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPED 105
           +++ P    Y H      +D    YP+ PP +   +  I H NI    G +CL+IL+ ED
Sbjct: 65  VVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTCLKK-IFHPNIDL-NGNVCLNILR-ED 121

Query: 106 WTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGII 152
           W+P  DL   +  +  L  EP  + PL+ D   +  C D   +   +
Sbjct: 122 WSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLF-CQDQKKFAETV 167

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 23  NPYQGLIESLNPIDET-DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDR 81
           +P+    +    +D + +L  WEA I G   T +    + I I+ P  YP  PP ++F  
Sbjct: 20  HPFGFFAKPTKKVDGSMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFP- 78

Query: 82  NNILHCNIKSPTGEICLDIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
               H NI  P+G +CL IL + +DW P   L   V  +  LL  P  +SP
Sbjct: 79  AGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 49/107 (45%), Gaps = 3/107 (2%)

Query: 34  PIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           P D++       +I+ P    Y    F   +     YP+ PP +R   N I H NI    
Sbjct: 54  PTDQSRDPPLLRLIVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRC-MNQIFHPNIDL-Q 111

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNII 140
           G+ICL+IL+ EDW+P  DL   +  I  L  E     PL+    +++
Sbjct: 112 GKICLNILR-EDWSPALDLQSVIIGILFLFLEVSGRDPLNKQAASLL 157

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 5/131 (3%)

Query: 27  GLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILH 86
            +I S +  D +   K E +I+ P    Y +      +D    YP+ PP +   +  I H
Sbjct: 48  NVITSPDSADRSQSPKLE-VIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKK-IFH 105

Query: 87  CNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTG 146
            NI    G +CL+IL+ EDW+P  DL   +  +  L  EP  + PL+ D   ++ C    
Sbjct: 106 PNIDL-KGNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLL-CEGEK 162

Query: 147 AYQGIIRYFLA 157
            +   +R  ++
Sbjct: 163 EFAEAVRLTMS 173

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 51/107 (47%), Gaps = 8/107 (7%)

Query: 32  LNPIDETDLSKWEA-----IIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILH 86
           L P    D S  E+       I P    Y+   FR  +    +YP+ PP ++   N I H
Sbjct: 45  LPPTVSADTSGLESSSTLFFTIHPDEGYYKPGYFRFSLFFKDTYPIEPPAVKC-VNKIYH 103

Query: 87  CNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLD 133
            NI +  G +CL+IL+ EDW+PV DL   V  +  L  EP    PL+
Sbjct: 104 PNIDT-QGNVCLNILR-EDWSPVLDLQSVVIGLLFLFLEPNDKDPLN 148

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 54/118 (45%), Gaps = 13/118 (11%)

Query: 14  TLASNDPIVNPYQGLIESLNPI-----DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPS 68
           ++ +N  +   Y+ ++ +  P       E ++ +W  +I GP  TPYE+ ++   +  PS
Sbjct: 3   SIQANKRLTKEYKNIVNNPPPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTFPS 62

Query: 69  SYPMAPPNIRF-DRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIWRLL 123
            YP  PP IR    N     N +     +CL +    PE W P W ++  ++ +   +
Sbjct: 63  DYPFNPPAIRMITPNGRFKENTR-----LCLSMSDYHPEAWNPAWSVVTILNGLLSFM 115

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 39  DLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICL 98
           +L +WEA I G   T +    + + I+ P  YP  PP ++       H N+  P+G ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLP-AGFYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAIWRLLKEPVYDSP 131
            IL + +DW P   L      I  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 11/117 (9%)

Query: 14  TLASNDPIVNPYQGLIESLNPI-----DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPS 68
           T  ++  +   Y+ ++E+  P      +E+++ +W  IIIGP  TPY+  ++   +  PS
Sbjct: 3   TKQAHKRLTKEYKMMVETPPPYITARPNESNILEWHYIIIGPQDTPYDGGQYHGTLTFPS 62

Query: 69  SYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIWRLL 123
            YP  PP IR    N      K  T  +CL +    P+ W P W +   ++ +   +
Sbjct: 63  DYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
          [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
          Saccharomyces cerevisiae YGL087C MMS2 Protein involved
          in error-free postreplication DNA repair forms a
          heteromeric complex with Ubc13p that has a
          ubiquitin-conjugating activity cooperates with
          chromatin-associated RING finger proteins Rad18p and
          Rad5p
          Length = 139

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 32 LNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKS 91
          L+  D+  ++KW   I+GP H+ +E+  + +LI+   SYP  PP ++F     L C + S
Sbjct: 30 LSDSDDITMTKWNGTILGPPHSNHENRIYSVLIECGPSYPDEPPKVKFVSKINLPC-VNS 88

Query: 92 PTGEI 96
           TGE+
Sbjct: 89 TTGEV 93

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 37  ETDLSKWEAII---IGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPT 93
           ET+    EA +   I P    Y+H  F   +    SYP+ PP ++     I H NI    
Sbjct: 134 ETNSITSEATLYLRISPDEGFYKHGHFGFSVSFKDSYPIDPPIVKC-LTTIYHPNIDY-N 191

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNII 140
           G ICL++L+ EDWTPV DL   V  +  L  EP    PL+    + +
Sbjct: 192 GNICLNVLR-EDWTPVLDLQTIVIGLLFLFLEPNPKDPLNKHAAHTM 237

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 18/123 (14%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R+ KEY    K +  N P   PY      L   +E ++ +W  II GP  TPY+  ++  
Sbjct: 9   RLTKEY----KLMVENPP---PY-----ILARPNEDNILEWHYIITGPAETPYKGGQYHG 56

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIW 120
            +  PS YP  PP IR    N        P   +CL +    P+ W P W +   ++ + 
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRF----KPNTRLCLSMSDYHPDTWNPGWSVSTILNGLL 112

Query: 121 RLL 123
             +
Sbjct: 113 SFM 115

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           D+  ++KW   I+GP H+ +E+  + + ID   +YP +PP + F     L C +   TGE
Sbjct: 34  DDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPC-VNPTTGE 92

Query: 96  ICLDILKPEDWTPVWDL 112
           +  D     DW   + +
Sbjct: 93  VQTDFHTLRDWKRAYTM 109

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 24  PYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNN 83
           P Q  +E  + + + +      + I P   PY    F+  +     YP+ PP+     N 
Sbjct: 51  PPQCTLELQSSLSDMNEQPLITLCISPREGPYLGGAFKFNLKFNEMYPIEPPSA-ICLNK 109

Query: 84  ILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNII 140
           I H NI    G+ICL+IL+ EDW+P  DL   V  +  L  +     PL+     ++
Sbjct: 110 IFHPNIDL-NGKICLNILR-EDWSPALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL 164

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           D+  ++KW   I+GP H+ +E+  + + I+   +YP +PP + F     L C +   TGE
Sbjct: 34  DDITMTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNQTTGE 92

Query: 96  ICLDILKPEDWTPVWDL 112
           I  D     DW   + +
Sbjct: 93  IQTDFHTLRDWKRAYTM 109

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 18/123 (14%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R+ KEY    K +  N P   PY      L   +E ++ +W  II GP  TPY+  ++  
Sbjct: 9   RLTKEY----KLMVENPP---PY-----ILARPNEDNILEWHYIITGPADTPYKGGQYHG 56

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIW 120
            +  PS YP  PP IR     I       P   +CL +    P+ W P W +   ++ + 
Sbjct: 57  TLTFPSDYPYKPPAIRM----ITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLL 112

Query: 121 RLL 123
             +
Sbjct: 113 SFM 115

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query: 34  PIDETDLSKWEA-----IIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCN 88
           P    D+S+ E+     I I P    Y+   F+       +YP+ PP +    + I H N
Sbjct: 47  PCVSIDVSECESNSRLYINITPDEGYYKCGHFKFCATFKDTYPIEPPKVTL-LSKIFHPN 105

Query: 89  IKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNII 140
           I    G +CL+IL+ EDW+PV D+   +  +  L  EP    PL+    +++
Sbjct: 106 IDL-QGNVCLNILR-EDWSPVLDVQSILIGLLMLFLEPNATDPLNKVAADVL 155

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 18/123 (14%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R+ KEY    K +  N P   PY      L   +E ++ +W  II GP  TPY+  ++  
Sbjct: 9   RLTKEY----KLMVENPP---PY-----ILARPNEDNILEWHYIITGPADTPYKGGQYHG 56

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIW 120
            +  PS YP  PP IR    N        P   +CL +    P+ W P W +   ++ + 
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRF----KPNTRLCLSMSDYHPDTWNPGWSVSTILNGLL 112

Query: 121 RLL 123
             +
Sbjct: 113 SFM 115

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 18/123 (14%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R+ KEY    K +  N P   PY      L   +E ++ +W  II GP  TPY+  ++  
Sbjct: 9   RLTKEY----KLMVENPP---PY-----ILARPNEDNILEWHYIITGPADTPYKAGQYHG 56

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIW 120
            +  PS YP  PP IR     I       P   +CL +    P+ W P W +   ++ + 
Sbjct: 57  TLTFPSDYPYKPPAIRM----ITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLL 112

Query: 121 RLL 123
             +
Sbjct: 113 SFM 115

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 46.6 bits (109), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 48  IGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWT 107
           I P    Y    FR  +    +YP+ PP ++   N I H NI   +G ICL++L+ EDW+
Sbjct: 81  ISPEEGVYRGGHFRFSVVFRDTYPIEPPTVKC-LNTIYHPNIDY-SGNICLNVLR-EDWS 137

Query: 108 PVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNII 140
           PV DL   V  +  L  EP    PL+    + +
Sbjct: 138 PVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTM 170

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 6/90 (6%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           +E+++  W  II GP  TPYE+ ++   +  PS YP  PP IR     +           
Sbjct: 30  NESNILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAIRM----VTPSGRFQENTR 85

Query: 96  ICLDI--LKPEDWTPVWDLLHCVHAIWRLL 123
           +CL +    P  W P W +   ++ +   +
Sbjct: 86  LCLSMSDYHPTTWNPGWSVSTILNGLLSFM 115

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 44.3 bits (103), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 40  LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLD 99
           ++KW   I+GP H+ +E+  + + I+   +YP +PPN+ F     L C +   TGE+  +
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLPC-VSQTTGEVQTN 59

Query: 100 ILKPEDWTPVWDL 112
                DW   + +
Sbjct: 60  FHTLRDWKRAYTM 72

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 11/117 (9%)

Query: 14  TLASNDPIVNPYQGLIESLNPI-----DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPS 68
           T  ++  +   Y+ L+ES  P      +E ++ +W  II GP  TPY+  ++   +  P+
Sbjct: 3   TRQAHKRLTKEYKLLVESSPPFILARPNEDNILEWHYIITGPPDTPYDGGQYHGTLTFPN 62

Query: 69  SYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIWRLL 123
            YP  PP IR    N      K  T  +CL +    P+ W P W +   ++ +   +
Sbjct: 63  DYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 54/123 (43%), Gaps = 18/123 (14%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R++KEY    K +  N P   PY   +    P DE  L +W  +I GP  TPYE  ++  
Sbjct: 9   RLSKEY----KMIMENTP---PYIIAV----PNDENIL-EWHYVITGPPDTPYEGGQYHG 56

Query: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIW 120
            +  P  YP  PP IR    N      K  T  +CL +    P+ W P W +   ++ + 
Sbjct: 57  TLHFPPEYPFKPPAIRISTPN---GRFKQHT-RLCLSMSDYHPDTWNPSWSVATILNGLL 112

Query: 121 RLL 123
             +
Sbjct: 113 SFM 115

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 23/123 (18%)

Query: 14  TLASNDPIVNPYQGLIESLNPI-----DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPS 68
           T  +   +   Y+ ++E+  P      +E ++ +W  +I GP  TPYE  ++   +  PS
Sbjct: 3   TRQAQKRLTKEYKSMVENPPPFIIAQPNEDNILEWHYVITGPPDTPYEGGQYHGTLVFPS 62

Query: 69  SYPMAPPNIRFDRNNILHCNIKSPTG------EICLDI--LKPEDWTPVWDLLHCVHAIW 120
            YP  PP IR          + +P+G       +CL +    P+ W P W +   +  + 
Sbjct: 63  DYPFKPPAIR----------MVTPSGRFKEDTRLCLSMSDYHPDTWNPSWSVSTILTGLL 112

Query: 121 RLL 123
             +
Sbjct: 113 SFM 115

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 52/117 (44%), Gaps = 11/117 (9%)

Query: 14  TLASNDPIVNPYQGLIESLNPI-----DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPS 68
           T  +   +   Y+ ++E+  P      +E ++ +W  +I GP  TPY+  ++   +  PS
Sbjct: 3   TKQAQKRLTKEYKMMVENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPS 62

Query: 69  SYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIWRLL 123
            YP  PP IR    N      K  T  +CL +    P+ W P W +   ++ +   +
Sbjct: 63  DYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 58  YRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVH 117
           Y F + I    +YPM PP ++   + I H NI    G +CL++L+ EDWTP  D+   + 
Sbjct: 77  YYFNVFIK--DTYPMEPPVVKC-MHRIYHPNIDI-DGNVCLNLLR-EDWTPALDIQSIII 131

Query: 118 AIWRLLKEPVYDSPLDVDMGNII 140
            I  L  EP    PL+ D    +
Sbjct: 132 GILFLFHEPNGRDPLNKDAAKTL 154

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 55/125 (44%), Gaps = 18/125 (14%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + R+ KEY    K +  N P   PY     +  P +E ++ +W  +I GP  TPYE  ++
Sbjct: 7   LKRLTKEY----KLIVENPP---PYV----TARP-NEDNILEWHYVITGPPETPYEGGQY 54

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHA 118
              +  PS YP  PP IR    N      K  T  +CL +    P+ W P W +   +  
Sbjct: 55  HGTLTFPSDYPYKPPAIRMVTPN---GRFKENT-RLCLSMSDYHPDLWNPGWSVSTILTG 110

Query: 119 IWRLL 123
           +   +
Sbjct: 111 LLSFM 115

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 53/117 (45%), Gaps = 11/117 (9%)

Query: 14  TLASNDPIVNPYQGLIESLNPI-----DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPS 68
           T  ++  +   Y+ ++E+  P      +E+++ +W  +I GP  +PY   ++   +  PS
Sbjct: 3   TKQAHKRLTKEYKMMMENPTPYIIARPNESNILEWHYVITGPPDSPYHDGQYHGTLTFPS 62

Query: 69  SYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIWRLL 123
            YP  PP IR    N      K  T  +CL +    P+ W P W +   ++ +   +
Sbjct: 63  DYPYKPPAIRMVTPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 52/124 (41%), Gaps = 20/124 (16%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R+ KEY    K +  N P   PY      L   +E ++ +W  II GP  TPY   ++  
Sbjct: 9   RLTKEY----KLMVENPP---PY-----ILARPNENNILEWHYIITGPADTPYFEGQYHG 56

Query: 63  LIDVPSSYPMAPPNIRF-DRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAI 119
            +  PS YP  PP IR    N     N +     +CL +    P  W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFRENTR-----LCLSMSDYHPNTWNPSWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 32  LNPIDETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD---------R 81
           +N  D++++  W   +++    + Y    F+  +  P  +P +PP  RF          R
Sbjct: 31  INLEDDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYR 90

Query: 82  NNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           +  L  +I   +G+   D L  E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 91  DGRLCISILHQSGDPMTDELDAETWSPVQSVESVLISIVSLLEDPNISSPANVDAA 146

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 138

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 1  MSRIAKEY---GDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEH 57
          MSR+ + +    +++K      P    Y GL  S    D+  ++ W   I+GP H+ +E+
Sbjct: 1  MSRVPRSFRLLEELEKGEKGMGPESCSY-GLAHS----DDITMTHWNGTILGPPHSNHEN 55

Query: 58 YRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEI 96
            + + I+   +YP  PP IRF     L C +   TGE+
Sbjct: 56 RIYSVAIECGEAYPDQPPKIRFLSKVNLPC-VDQNTGEV 93

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 11/106 (10%)

Query: 25  YQGLIESLNPI-----DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRF 79
           Y+ +IE+  P      +E ++ +W  II GP  TPY   ++   +  PS YP  PP IR 
Sbjct: 14  YKLIIENPTPYILARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFKPPAIRM 73

Query: 80  DRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAIWRLL 123
              N      K  T  +CL +    P+ W P W +   ++ +   +
Sbjct: 74  ITPN---GRFKENT-RLCLSMSDYHPDLWNPGWSVATILNGLLSFM 115

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 36 DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
          D+  ++KW   I+GP H+ +E+  + + I     YP APP I+F     L C +   TGE
Sbjct: 34 DDITMTKWNGTILGPPHSNHENRIYSVAIHCGPHYPDAPPTIKFVSKINLPC-VDEKTGE 92

Query: 96 I 96
          +
Sbjct: 93 V 93

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 55/125 (44%), Gaps = 18/125 (14%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + R+ KEY    K +  N P   PY      L   +E ++ +W  II GP  TPY+  ++
Sbjct: 7   LKRLTKEY----KLMVENPP---PY-----ILARPNEDNILEWHYIITGPPDTPYKDGQY 54

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHA 118
              +  PS YP  PP IR    N      K  T  +CL +    P+ W P W +   ++ 
Sbjct: 55  HGTLTFPSDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDLWNPGWSVNTILNG 110

Query: 119 IWRLL 123
           +   +
Sbjct: 111 LLSFM 115

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa]
          {ON} Syntenic homolog of Saccharomyces cerevisiae
          YGL087C (MMS2); 1-intron
          Length = 138

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 36 DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
          D+  ++ W   I+GP H+ +E+  + ++I+  + YP  PP +RF     L C +   TGE
Sbjct: 34 DDISMTHWNGTILGPPHSSHENRIYSVVIECGAEYPDRPPKVRFISRINLPC-VDPSTGE 92

Query: 96 I 96
          +
Sbjct: 93 V 93

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 32  LNPIDETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFD---------R 81
           +N  D++++  W   +++    + Y    F+  +  P  +P +PP  RF          R
Sbjct: 31  INLEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYR 90

Query: 82  NNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           +  L  +I   +G+   D L  E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 91  DGRLCISILHQSGDPMTDELDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           D+  +++W   I+GP H+ +E+  + + I+    YP  PP I F     L C +   TGE
Sbjct: 34  DDITMTRWNGTILGPPHSNHENRIYSVSIECGPKYPDEPPTITFISKINLPC-VDQSTGE 92

Query: 96  ICLDILKP-EDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
           +  +     +DW  ++++   +  + + +  P     +  + G+  +
Sbjct: 93  VNKEKFNTLKDWKRLYNMETILLDLRKEMASPANKKLVQPEEGSTFK 139

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 4/103 (3%)

Query: 55  YEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLH 114
           Y+   F   ++   +YP+ PP +    + + H NI    G++CL+IL+ EDW+P  D+  
Sbjct: 78  YKGGHFTFKLEFNDAYPIEPPTV-ICTSKLYHPNIDI-DGKVCLNILR-EDWSPALDVQS 134

Query: 115 CVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLA 157
            +  +  LL EP    PL+ D   ++   DT  +  ++   +A
Sbjct: 135 IIIGLLFLLLEPNAKDPLNKDAAMMLST-DTARFASLVNRSMA 176

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 18/125 (14%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
           + R+ KEY    K +  N P   PY  ++   N   E ++ +W  +I GP+ TPY   ++
Sbjct: 7   LKRLTKEY----KLIVENPP---PY--IVARPN---EDNILEWHYVITGPSDTPYSSGQY 54

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHA 118
              +  PS YP  PP IR    N      K  T  +CL +    P+ W P W +   +  
Sbjct: 55  HGTLTFPSDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDLWNPGWSVSTILTG 110

Query: 119 IWRLL 123
           +   +
Sbjct: 111 LLSFM 115

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 51/124 (41%), Gaps = 18/124 (14%)

Query: 2   SRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFR 61
            R+ KEY  I         I NP Q +    N   E ++ +W  II GP  TPY   ++ 
Sbjct: 8   KRLTKEYKAI---------IENPPQFINAQPN---EDNILEWHYIITGPPDTPYTDGQYH 55

Query: 62  ILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAI 119
             +  P+ YP  PP IR    N      K  T  +C+ +    P+ W P W +   +  +
Sbjct: 56  GTLVFPADYPFKPPAIRMITPN---GRFKENT-RLCMTMSDYHPDTWNPAWSVATILMGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PPN RF    I H N+    G
Sbjct: 35  DDSNIFLWNIGVMVLNEDSIYHGGYFKAQMKFPEDFPFSPPNFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDILK-----------PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 93  RLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 23/112 (20%)

Query: 14  TLASNDPIVNPYQGLIESLNPI-----DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPS 68
           T  +   +   Y+ ++E+  P      +E ++ +W  +I GP  TPY   ++   +  PS
Sbjct: 3   TRQAQKRLSKEYKSMVENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPS 62

Query: 69  SYPMAPPNIRFDRNNILHCNIKSPTG------EICLDI--LKPEDWTPVWDL 112
            YP  PP IR          + +P+G       +CL +    P+ W P W +
Sbjct: 63  DYPFKPPAIR----------MVTPSGRFKEDTRLCLSMSDYHPDTWNPSWSV 104

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 40  LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLD 99
           ++KW   I+GP H+ +E+  + + I+   +YP +PP + F     L C +   TGE+  D
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTD 59

Query: 100 ILKPEDWTPVWDL 112
                 W   + +
Sbjct: 60  FHTLRGWKRAYTM 72

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           D+  ++ W   I+GP H+ +E+  + + I+   +YP  PP I+F     + C + S TGE
Sbjct: 34  DDITMTNWNGTILGPPHSNHENRIYSVSIECGPNYPDEPPKIKFVSKVNVPC-VDSTTGE 92

Query: 96  ICLDILKP-EDWTPVWDL 112
           +   +     DW   + +
Sbjct: 93  VKSSVFHTLRDWKRAYTM 110

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 52/124 (41%), Gaps = 20/124 (16%)

Query: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62
           R++KEY    K +  N P   PY      +    E ++  W  +I GP  TPYE  ++  
Sbjct: 9   RLSKEY----KMMTENPP---PY-----IVAAPKEDNILVWHYVITGPPETPYEDGQYHG 56

Query: 63  LIDVPSSYPMAPPNIR-FDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDLLHCVHAI 119
            +  P+ YP  PP IR    N     N +     +CL +    P+ W P W +   +  +
Sbjct: 57  TLVFPNDYPFNPPAIRMLTPNGRFRENTR-----LCLSMSDYHPDTWNPSWSVATILTGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           DE++L  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DESNLFIWNIGVMVLNEDSIYHGGYFKSQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 93  RLCISILHQSGDPTTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 40  LSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLD 99
           ++ W   I+GP H+ +E+  + + ++  ++YP  PP I+F     L C +   TGE+  D
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPC-VNQTTGEVKRD 59

Query: 100 ILKP-EDWTPVWDL 112
                 DW   +++
Sbjct: 60  QFSTLRDWKRSYNM 73

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           +E ++ +W  II GP  +PY   ++   +  PS YP  PP IR    N      K  T  
Sbjct: 30  NEANILEWHYIINGPPDSPYFEGQYHGTLTFPSDYPYKPPAIRMITPN---GRFKENT-R 85

Query: 96  ICLDI--LKPEDWTPVWDLLHCVHAIWRLL 123
           +CL +    P+ W P W +   ++ +   +
Sbjct: 86  LCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D+++L  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 93  RLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 14/112 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNIFVWNVGVMVLNEDSLYHGGYFKAQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDILK-----------PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVD 135
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVD 144

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 49/114 (42%), Gaps = 18/114 (15%)

Query: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60
             R+ KEY    KTL    P   PY      L   +E ++ +W  II GP  +PY   ++
Sbjct: 7   FKRLTKEY----KTLTETPP---PY-----ILARPNEDNILEWHYIITGPPDSPYSEGQY 54

Query: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDI--LKPEDWTPVWDL 112
              +  P+ YP  PP IR    N      K  T  +CL +    P+ W P W +
Sbjct: 55  HGTLTFPTDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDLWNPSWSV 104

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           D+  ++ W   I+GP H+ +E+  + + I+  ++YP  PP I+F     L C +   TGE
Sbjct: 36  DDITMTNWNGTILGPPHSNHENRIYSVAIECGANYPDEPPLIKFVSKINLPC-VDQTTGE 94

Query: 96  ICLDILKP-EDW 106
           +  D      DW
Sbjct: 95  VKHDQFHTLRDW 106

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D+++L  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 93  RLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P  +SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           D+  ++ W   I+GP H+ +E+  + + I+   +YP  PP I+F     L C + S TG+
Sbjct: 34  DDISMTTWNGTILGPPHSNHENRIYSLSIECGPNYPDHPPTIKFISKINLPC-VDSKTGQ 92

Query: 96  ICLDILKP-EDWTPVWDLLHCVHAIWRLLKEPV 127
           +         DW   +++   +  + + +  P 
Sbjct: 93  VTPSTFHTLRDWKRAYNMETILLELRKEMATPA 125

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP+ RF    I H N+    G
Sbjct: 35  DDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPSFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 93  RLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 9/92 (9%)

Query: 36  DETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGE 95
           D+  ++ W   I+GP H+ + +  + + I+   SYP  PP ++F     L+C + S TG 
Sbjct: 34  DDISMTNWNGTILGPPHSNHSNRIYSLSIECGPSYPDEPPTLKFISKINLNC-VDSATG- 91

Query: 96  ICLDILKPEDWTPV--WDLLHCVHAIWRLLKE 125
               ++KP D+ P+  W   + +  I   L++
Sbjct: 92  ----VVKP-DFNPIKNWKRSYTMETILLELRK 118

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P  +SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 34  DDSNIFLWNIGVMVLNEESIYHGGYFKAQMKFPDDFPFSPPTFRF-TPAIYHPNVYR-DG 91

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 92  RLCISILHQSGNPTSDEPDEETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 145

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDILK-----------PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P  +SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDIL-----------KPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 13/89 (14%)

Query: 60  FRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDIL-----------KPEDWTP 108
           F+  +  P  +P +PP  RF    I H N+    G +C+ IL             E W+P
Sbjct: 60  FKAQMRFPEDFPFSPPQFRF-TPAIYHPNVYR-DGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 VWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           V  +   + +I  LL++P  +SP +VD  
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAA 146

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 40.0 bits (92), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNIFLWNVGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPTFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDILK-----------PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD  
Sbjct: 93  RLCISILHTSGDPTSEEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 36  DETDLSKWE-AIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTG 94
           D++++  W   +++    + Y    F+  +  P  +P +PP  RF    I H N+    G
Sbjct: 35  DDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRF-TPAIYHPNVYR-DG 92

Query: 95  EICLDILK-----------PEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIR 141
            +C+ IL             E W+PV  +   + +I  LL++P   SP +VD     R
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFR 150

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 13/89 (14%)

Query: 60  FRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDIL-----------KPEDWTP 108
           F+  +  P  +P +PP+ RF    I H N+    G +C+ IL             E W+P
Sbjct: 60  FKAQMRFPEDFPFSPPSFRF-TPAIYHPNVYR-DGRLCISILHQSGDPTSDEPDSETWSP 117

Query: 109 VWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           V  +   + +I  LL++P   SP +VD  
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 13/89 (14%)

Query: 60  FRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDIL-----------KPEDWTP 108
           F+  +  P  +P +PP  RF    I H N+    G +C+ IL             E W+P
Sbjct: 60  FKAQMRFPEDFPFSPPTFRF-TPAIYHPNVYR-DGRLCISILHTSGDPTSEEPDSETWSP 117

Query: 109 VWDLLHCVHAIWRLLKEPVYDSPLDVDMG 137
           V  +   + +I  LL++P   SP +VD  
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.142    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,131,372
Number of extensions: 925662
Number of successful extensions: 2295
Number of sequences better than 10.0: 270
Number of HSP's gapped: 2047
Number of HSP's successfully gapped: 270
Length of query: 162
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 61
Effective length of database: 41,900,133
Effective search space: 2555908113
Effective search space used: 2555908113
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)