Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4433.494ON28726613890.0
Smik_6.2283.494ON28726613710.0
YGR132C (PHB1)3.494ON28726613650.0
Suva_7.4203.494ON28726613560.0
CAGL0I10472g3.494ON28826312371e-173
NCAS0E007903.494ON32726312341e-172
NDAI0G009203.494ON29626112241e-171
KLTH0F14872g3.494ON28026211901e-166
KAFR0C019803.494ON28326011901e-166
SAKL0F02728g3.494ON28226011901e-166
TPHA0D032903.494ON28526111891e-165
TDEL0D056203.494ON27926111871e-165
Kpol_1017.53.494ON28326211811e-164
Kwal_55.212403.494ON28326211721e-163
TBLA0D029503.494ON28225811421e-158
ZYRO0D09900g3.494ON28326311411e-158
KNAG0B007903.494ON28426011261e-156
Ecym_12353.494ON28326010611e-146
AFR313C3.494ON28326410061e-138
KLLA0D16302g3.494ON2262139521e-130
YGR231C (PHB2)5.98ON3102417482e-98
KAFR0B042505.98ON3102417457e-98
Skud_7.5655.98ON3102417457e-98
Suva_7.5235.98ON3102417449e-98
Smik_16.755.98ON3102417431e-97
CAGL0L06490g5.98ON3132507431e-97
SAKL0G15510g5.98ON3082417403e-97
TBLA0H022205.98ON3072387395e-97
Kwal_27.127475.98ON3072387352e-96
TPHA0A050905.98ON3102377352e-96
ADL141W5.98ON3072387334e-96
NDAI0D025305.98ON3162377336e-96
Kpol_1050.615.98ON3102377319e-96
KNAG0A015805.98ON2882377253e-95
KLTH0C01672g5.98ON3072387273e-95
NCAS0F006005.98ON3132387266e-95
TDEL0G012105.98ON3092377204e-94
ZYRO0B15136g5.98ON3102377153e-93
KLLA0E15731g5.98ON3082347134e-93
KLTH0F18546g7.518ON277784693.4
KNAG0A074703.410ON18517649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.443
         (287 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   539   0.0  
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   532   0.0  
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   530   0.0  
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   526   0.0  
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   481   e-173
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     479   e-172
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     476   e-171
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   462   e-166
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   462   e-166
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   462   e-166
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   462   e-165
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   461   e-165
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   459   e-164
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   456   e-163
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   444   e-158
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   444   e-158
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   438   e-156
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   413   e-146
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   392   e-138
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   371   e-130
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   292   2e-98
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   291   7e-98
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   291   7e-98
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   291   9e-98
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   290   1e-97
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   290   1e-97
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   289   3e-97
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   289   5e-97
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   287   2e-96
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   287   2e-96
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   286   4e-96
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   286   6e-96
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   286   9e-96
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   283   3e-95
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   284   3e-95
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   284   6e-95
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   281   4e-94
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   280   3e-93
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   279   4e-93
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    31   3.4  
KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3....    29   9.6  

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/266 (100%), Positives = 266/266 (100%)

Query: 1   MSNASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60
           MSNASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV
Sbjct: 1   MSNASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60

Query: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120
           PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV
Sbjct: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120

Query: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180
           LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE
Sbjct: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180

Query: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240
           FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI
Sbjct: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240

Query: 241 RRLEASKDIAQTLANSSNVVYLPSQH 266
           RRLEASKDIAQTLANSSNVVYLPSQH
Sbjct: 241 RRLEASKDIAQTLANSSNVVYLPSQH 266

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/266 (97%), Positives = 265/266 (99%)

Query: 1   MSNASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60
           MSN SRLID+ITKVALPIGI+A+GIQY+MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV
Sbjct: 1   MSNPSRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60

Query: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120
           PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLP+IYQNLGLDYDERV
Sbjct: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERV 120

Query: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180
           LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE
Sbjct: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180

Query: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240
           FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI
Sbjct: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240

Query: 241 RRLEASKDIAQTLANSSNVVYLPSQH 266
           RRLEASKDIAQTLANSSNVVYLPSQH
Sbjct: 241 RRLEASKDIAQTLANSSNVVYLPSQH 266

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/266 (97%), Positives = 266/266 (100%)

Query: 1   MSNASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60
           MSN+++LIDVITKVALPIGIIA+GIQY+MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV
Sbjct: 1   MSNSAKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60

Query: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120
           PWLQKAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRPEVLQLP+IYQNLGLDYDERV
Sbjct: 61  PWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERV 120

Query: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180
           LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE
Sbjct: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180

Query: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240
           FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI
Sbjct: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240

Query: 241 RRLEASKDIAQTLANSSNVVYLPSQH 266
           RRLEASKDIAQTLANSSNVVYLPSQH
Sbjct: 241 RRLEASKDIAQTLANSSNVVYLPSQH 266

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/266 (95%), Positives = 264/266 (99%)

Query: 1   MSNASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60
           MSN SR ID+ITKVALPIG++A+G+QY+MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV
Sbjct: 1   MSNPSRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60

Query: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120
           PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV
Sbjct: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120

Query: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180
           LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE
Sbjct: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180

Query: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240
           FTKAVEQKQIAQQDAERAKF+VEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLI
Sbjct: 181 FTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLI 240

Query: 241 RRLEASKDIAQTLANSSNVVYLPSQH 266
           RRLEASKDIAQTLANSSNV+YLPSQH
Sbjct: 241 RRLEASKDIAQTLANSSNVIYLPSQH 266

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  481 bits (1237), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 229/263 (87%), Positives = 251/263 (95%)

Query: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63
           A+  + +ITKVA+P+GI  +G+QY+MYDV+GGSRGVIFDR+ GVK  VVGEGTHFLVPWL
Sbjct: 5   ANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWL 64

Query: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123
           QKAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPS
Sbjct: 65  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPS 124

Query: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183
           IGNEVLKSIVAQFDAAELITQREI+SQKIR+ELS RANEFGI+LEDVSITHMTFGPEFTK
Sbjct: 125 IGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTK 184

Query: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243
           AVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE+ISKAL+KVGDGLLLIRRL
Sbjct: 185 AVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRL 244

Query: 244 EASKDIAQTLANSSNVVYLPSQH 266
           EASK+IAQTLANS+N+ YLPS H
Sbjct: 245 EASKEIAQTLANSNNITYLPSNH 267

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  479 bits (1234), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 226/263 (85%), Positives = 254/263 (96%)

Query: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63
            ++L++VIT+VALP+GI+ATG++Y+MYDVKGGSRGVIFDR++GV+++V+GEGTHFLVPWL
Sbjct: 46  GTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWL 105

Query: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123
           QKA+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+VLPS
Sbjct: 106 QKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPS 165

Query: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183
           IGNEVLKSIVAQFDAAELITQREI+SQ+I+ ELSTRA+EFGI+LEDVSITHMTFGPEFTK
Sbjct: 166 IGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTK 225

Query: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243
           AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLIRRL
Sbjct: 226 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRL 285

Query: 244 EASKDIAQTLANSSNVVYLPSQH 266
           EASKDIAQTLANS N+ YLP Q 
Sbjct: 286 EASKDIAQTLANSPNITYLPGQQ 308

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  476 bits (1224), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/261 (86%), Positives = 247/261 (94%)

Query: 6   RLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQK 65
           +  +++TKVALPIG++ TG+ Y+MYDVKGGSRGVIFDR++GVK  VVGEGTHFLVPWLQK
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 66  AIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIG 125
           A+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 126 NEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAV 185
           NEVLKSIVAQFDAAELITQREI+SQ+I+ ELS RANEFG++LEDVSITHMTFGPEFTKAV
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 186 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 245
           EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 246 SKDIAQTLANSSNVVYLPSQH 266
           SKDIAQTLANS NV YLP Q+
Sbjct: 253 SKDIAQTLANSPNVTYLPGQN 273

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  462 bits (1190), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 217/262 (82%), Positives = 248/262 (94%)

Query: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SRL D + K+ALP+G+ A+ +QY+MYDVKGGSR VIFDR++GV+QQVVGEGTHFLVPWLQ
Sbjct: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KA++YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP+IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181

Query: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAE+ISKALAK GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 245 ASKDIAQTLANSSNVVYLPSQH 266
           ASK+IA+TLANSSNV YLPS H
Sbjct: 242 ASKEIAKTLANSSNVTYLPSSH 263

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  462 bits (1190), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 220/260 (84%), Positives = 247/260 (95%)

Query: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63
           ++R I+V+TK+A+P G++ T + Y+MYDVKGGSRGVIFDRI+GVK+ V+GEGTHFLVPWL
Sbjct: 2   STRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWL 61

Query: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123
           QKAIIYDVRTKPKSI+TNTGT+DLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPS
Sbjct: 62  QKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPS 121

Query: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183
           IGNEVLKSIVAQFDAAELITQREI+SQ+IRKE+S RANEFGIKLEDVSITHMTFG EFTK
Sbjct: 122 IGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTK 181

Query: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243
           AVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRL
Sbjct: 182 AVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRL 241

Query: 244 EASKDIAQTLANSSNVVYLP 263
           EASKDIA+TL+ SSN+ YLP
Sbjct: 242 EASKDIARTLSKSSNITYLP 261

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  462 bits (1190), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 220/260 (84%), Positives = 246/260 (94%)

Query: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           S+L D + ++ALPIGI  + +QY+MYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           +AI+YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181

Query: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241

Query: 245 ASKDIAQTLANSSNVVYLPS 264
           ASK+IAQTLANSSNV YLPS
Sbjct: 242 ASKEIAQTLANSSNVTYLPS 261

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  462 bits (1189), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 219/261 (83%), Positives = 247/261 (94%)

Query: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63
           +++++D + K+A+P+GI  +GIQY MYDVKGGSR VIFDR++GVKQQV+GEGTHFL PWL
Sbjct: 2   STKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWL 61

Query: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123
           QKAI++DVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V QLP+IYQNLGLDYDERVLPS
Sbjct: 62  QKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPS 121

Query: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183
           IGNEVLK+IVAQFDAAELITQREI+S KIR+ELS R+NEFGIKLEDVSITHMTFG EFTK
Sbjct: 122 IGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTK 181

Query: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243
           AVEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAE+ISKALAK GDGLLLIRRL
Sbjct: 182 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRL 241

Query: 244 EASKDIAQTLANSSNVVYLPS 264
           EASK+IA+TL+ SSNV YLPS
Sbjct: 242 EASKEIAKTLSQSSNVTYLPS 262

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  461 bits (1187), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 216/261 (82%), Positives = 248/261 (95%)

Query: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SRL++ + +VA+P+GI+ +G+QY+MYDV+GGSR VIFDR++GV++QVVGEGTHFLVPWLQ
Sbjct: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAI+YD+RTKPK IATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQRE++SQ+IR ELS RA+EFGI+LEDVSITHMTFGPEFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181

Query: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAE+ISKALA+ GDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241

Query: 245 ASKDIAQTLANSSNVVYLPSQ 265
           ASK+IAQTLA SSN+ YLP +
Sbjct: 242 ASKEIAQTLAASSNITYLPGK 262

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  459 bits (1181), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 218/262 (83%), Positives = 244/262 (93%)

Query: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           S++ID + KVALPIGI+ +GIQ++MYDVKGGSR VIFDRI+GVKQ ++GEGTHFL+PWLQ
Sbjct: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP+IYQNLGLDYDERVLPSI
Sbjct: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
            NEVLK+IVAQFDAAELITQRE++S +IR EL  R+NEFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181

Query: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244
           VE KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAE+ISKAL K GDGLLLIRRLE
Sbjct: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241

Query: 245 ASKDIAQTLANSSNVVYLPSQH 266
           ASK+IA TL+ SSNV YLP+ H
Sbjct: 242 ASKEIAATLSQSSNVTYLPNGH 263

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  456 bits (1172), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 214/262 (81%), Positives = 245/262 (93%)

Query: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SR  D + K+ALP+G+ A+ +QY+MYDVKGGSR VIFDR++GV+QQVVGEGTHFL+PWLQ
Sbjct: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KA+++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLKSIVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG +FTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181

Query: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAE+ISKALAK GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 245 ASKDIAQTLANSSNVVYLPSQH 266
           ASK+IA+TLANSSNV YLPS  
Sbjct: 242 ASKEIAKTLANSSNVTYLPSNQ 263

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  444 bits (1142), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 210/258 (81%), Positives = 238/258 (92%)

Query: 6   RLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQK 65
           ++ + + K+A+P+G+  + + Y+MYDVKGGSR VIFDRI GVKQ VVGEGTHFLVPWLQK
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 66  AIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIG 125
           ++I+D+RTKPK+I TNTGTRDLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 126 NEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAV 185
           NEVLKSIVAQFDAAELITQREI+SQ+IRKEL+ RANEFGI+LEDVSITHMTFGPEFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 186 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 245
           EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 246 SKDIAQTLANSSNVVYLP 263
           SK+IA+TLA S +V YLP
Sbjct: 245 SKEIAETLAGSPHVTYLP 262

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  444 bits (1141), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 220/263 (83%), Positives = 246/263 (93%)

Query: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63
           +SRL + + KVA+P+GI+A+GIQY+MYDV+GGSR VIFDR++GV+Q+VVGEGTHFLVPWL
Sbjct: 2   SSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWL 61

Query: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123
           QKA+IYDVRTKPKSIATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPS
Sbjct: 62  QKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPS 121

Query: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183
           IGNEVLK+IVA++DAAELITQRE++S  IR ELS RA+EF I+LEDVSITHMTFGPEFTK
Sbjct: 122 IGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTK 181

Query: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243
           AVE KQIAQQDAERAKFLVEKAEQ R+ SVIRAEGEAE+AE ISKALAK GDGLLLIRRL
Sbjct: 182 AVELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRL 241

Query: 244 EASKDIAQTLANSSNVVYLPSQH 266
           EASKDIAQTLANSSNV YLPSQ 
Sbjct: 242 EASKDIAQTLANSSNVTYLPSQQ 264

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  438 bits (1126), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/260 (84%), Positives = 245/260 (94%)

Query: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           S+ I+V++K+A+P G++     Y MYDVKGGSRGVIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAIIYDVR+KPKSIATNTGT+DLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPSI
Sbjct: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLKSIVAQFDAAELITQRE++SQ+IR+ELSTRA EFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181

Query: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERAKFLVEKAEQ RQASVIRAEGEAESAE ISKALAKVGDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLE 241

Query: 245 ASKDIAQTLANSSNVVYLPS 264
           ASK+IA+TL+ SSNV YLPS
Sbjct: 242 ASKEIARTLSRSSNVTYLPS 261

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  413 bits (1061), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 194/260 (74%), Positives = 233/260 (89%)

Query: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SR ++ I  +A+PIG+     Q  +YDV+GG+R VIFDR++GV+Q+VVGEGTHFL+PWLQ
Sbjct: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KA+IYDVRTKPK+IATNTGT+DLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPSI
Sbjct: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQRE++SQKIR+EL+ RA+ F IKLEDV+ITHM FG EFTK+
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181

Query: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244
           VE+KQIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AE+ISKAL K GDGLL+IRRLE
Sbjct: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241

Query: 245 ASKDIAQTLANSSNVVYLPS 264
           ASK IAQTLA SSN+ YLPS
Sbjct: 242 ASKKIAQTLAGSSNITYLPS 261

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  392 bits (1006), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 196/264 (74%), Positives = 236/264 (89%), Gaps = 3/264 (1%)

Query: 5   SRLIDVITKVALPIGIIA---TGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVP 61
           SRL D + ++ LP+  IA   + +Q++MYDV+GG+R +IFDRI+GVK  VVGEGTHFL+P
Sbjct: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61

Query: 62  WLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVL 121
           WLQKAII+DVRTKP++IATNTGT+DLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERVL
Sbjct: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121

Query: 122 PSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEF 181
           PSIGNEVLK+IVAQF+A+ELITQRE++SQ+IR EL+ RA+EF I+LEDVSITHMTFG EF
Sbjct: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181

Query: 182 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIR 241
           TKAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE ISKAL K GDGLL+IR
Sbjct: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241

Query: 242 RLEASKDIAQTLANSSNVVYLPSQ 265
           RLEASK IA+TLANS NV YLPS+
Sbjct: 242 RLEASKGIAETLANSPNVTYLPSK 265

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  371 bits (952), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 199/213 (93%)

Query: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SR+ DV+ ++A+P+G+  + IQY+MYDV+GG R VIFDR+ GV+Q V+GEGTHFLVPWLQ
Sbjct: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           K+I++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPSI
Sbjct: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQREI+SQ+IR ELS RA+EF IKLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181

Query: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAE 217
           VEQKQIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  292 bits (748), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 191/241 (79%), Gaps = 1/241 (0%)

Query: 25  IQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           I   +++V GG R +++ RI+GV  ++  EGTHF+ PWL   IIYDVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RP+V+QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 204
           RE +S+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 205 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPS 264
           A QE+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LA+S N V L +
Sbjct: 234 ARQEKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVILDN 292

Query: 265 Q 265
           +
Sbjct: 293 E 293

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  291 bits (745), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 192/241 (79%), Gaps = 1/241 (0%)

Query: 25  IQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           +Q ++++V GG R +++ RINGV  ++  EGTHF++PWL+  I+YDVR KP+++A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 204
           RE +S+ IR+ L  RA++F I L+DVSIT MTF PEFT+AVE KQIAQQDA+RA F+V+K
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 205 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPS 264
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ LANS N V L +
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPNRVVLDN 291

Query: 265 Q 265
           +
Sbjct: 292 E 292

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  291 bits (745), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 187/241 (77%), Gaps = 1/241 (0%)

Query: 25  IQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           +   +++V GG R +++ RI+GV  ++  EGTHF+ PWL   IIYDVR KP+++A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 204
           RE +S+ IR+ L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 205 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPS 264
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LANS N V L +
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPNRVILDN 292

Query: 265 Q 265
           +
Sbjct: 293 E 293

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  291 bits (744), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 189/241 (78%), Gaps = 1/241 (0%)

Query: 25  IQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           +   +++V GG R +++ R+NGV  ++  EGTHF+ PW+   IIYDVR KP+++A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RP+V QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 204
           RE +S+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 205 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPS 264
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LANS N V L +
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPNRVVLDN 292

Query: 265 Q 265
           +
Sbjct: 293 E 293

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  290 bits (743), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 191/241 (79%), Gaps = 1/241 (0%)

Query: 25  IQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           I   +++V GG R +++ RI+GV  ++  EGTHF+ PWL   I+YDVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RP+V+QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 204
           RE +S+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 205 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPS 264
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LA+S N V L +
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVILDN 292

Query: 265 Q 265
           +
Sbjct: 293 E 293

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  290 bits (743), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 191/250 (76%), Gaps = 1/250 (0%)

Query: 16  LPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP 75
           L +G  A      +++V GG R +++ RI GV Q++  EGTH ++PW++  I+YDVR KP
Sbjct: 47  LVLGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKP 106

Query: 76  KSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQ 135
           +++A+ TGT+DLQMV++T RVL RP V QLP+IY+ LG DYDERVLPSI NEVLK++VAQ
Sbjct: 107 RNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQ 166

Query: 136 FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA 195
           F+A++LITQRE +S+ IR  L  RA+ F I L+DVSIT+MTF PEFT+AVE KQIAQQDA
Sbjct: 167 FNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDA 226

Query: 196 ERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLAN 255
           +RA F+V+KA QE+Q  V++A+GEA+SAE I  A+ K  D + L +RL+ +KDIA+ LAN
Sbjct: 227 QRAAFIVDKARQEKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILAN 285

Query: 256 SSNVVYLPSQ 265
           S N V L ++
Sbjct: 286 SPNRVVLDNE 295

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  289 bits (740), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 191/241 (79%), Gaps = 1/241 (0%)

Query: 25  IQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           +   +++V GG R +++ R+ G++Q++  EGTHF VPWL+  I+YDVR KP+++A+ TGT
Sbjct: 55  VNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGT 114

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RPEV QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 204
           RE +S+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 175 RERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 234

Query: 205 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPS 264
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ L+ S N V L +
Sbjct: 235 ARQEKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPNRVILDN 293

Query: 265 Q 265
           +
Sbjct: 294 E 294

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  289 bits (739), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 137/238 (57%), Positives = 188/238 (78%), Gaps = 1/238 (0%)

Query: 28  TMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ R++GV  ++  EGTHF++PWLQ  IIYDVR KP+++A+ TGT+DL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP++  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 207
           +S+ IR+ L  RA +F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 208 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ SKDIA+ LA SSN + L ++
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSNRLVLDNE 291

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  287 bits (735), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 191/238 (80%), Gaps = 1/238 (0%)

Query: 28  TMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ R+NGV+ ++  EGTHF +PWL+  I+YDVR KP+++A+ TGT+DL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V QLP++++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 207
           +S+ IR+ L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L++S N V L ++
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVILDNE 293

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  287 bits (735), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 185/237 (78%), Gaps = 1/237 (0%)

Query: 29  MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDLQ 88
           +++V GG R +++ RI GV  ++  EGTHF++PW++  +IYDVR KP+++A+ TGT+DLQ
Sbjct: 59  LFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDLQ 118

Query: 89  MVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREII 148
           MV++T RVL RP V QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ +
Sbjct: 119 MVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDKV 178

Query: 149 SQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQE 208
           S+ IR  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA QE
Sbjct: 179 SRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQE 238

Query: 209 RQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           +Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +KDIA  LA S N V L ++
Sbjct: 239 KQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPNRVVLDNE 294

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  286 bits (733), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 189/238 (79%), Gaps = 1/238 (0%)

Query: 28  TMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ R++GV+Q V GEGTHF++PWL+  ++YDVR+KP+++++ TGT DL
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 207
           +S+ IR  L  RA+ F I L+DVSIT+MTF PEFT AVE KQ+AQQDA+RA F VEKA+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 208 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           E+Q+ +++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA S N V L ++
Sbjct: 237 EKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPNRVILDNE 293

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  286 bits (733), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 185/237 (78%), Gaps = 1/237 (0%)

Query: 29  MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDLQ 88
           +++V GG R +++ RI+GV  ++  EGTHF +PW++  IIYDVR KP+++A+ TGT+DLQ
Sbjct: 63  LFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGTKDLQ 122

Query: 89  MVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREII 148
           MV++T RVL RP V QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE +
Sbjct: 123 MVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREKV 182

Query: 149 SQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQE 208
           S+ IR+ L  RAN F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA QE
Sbjct: 183 SKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQE 242

Query: 209 RQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           +Q  V+RA+GEA+SAE I  A+ K  D + L +RL+ +++IA+ LA S N V L ++
Sbjct: 243 KQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPNRVVLDNE 298

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  286 bits (731), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 187/237 (78%), Gaps = 1/237 (0%)

Query: 29  MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDLQ 88
           +++V GG R +++ RI GV  ++  EGTHF++PWL+  ++YDVR KP+++A+ TGT+DLQ
Sbjct: 61  LFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDLQ 120

Query: 89  MVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREII 148
           MV++T RVL RP+V QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE +
Sbjct: 121 MVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREKV 180

Query: 149 SQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQE 208
           S+ IR+ L  RA  F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA+QE
Sbjct: 181 SRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQE 240

Query: 209 RQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           +Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA S N V L ++
Sbjct: 241 KQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPNRVVLDNE 296

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  283 bits (725), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 186/237 (78%), Gaps = 1/237 (0%)

Query: 29  MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDLQ 88
           +++V GG R +++ RI GV  ++  EGTHF++PWL+  I+YDVR KP+++A+ TGT+DLQ
Sbjct: 36  LFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDLQ 95

Query: 89  MVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREII 148
           MV++T RVL RP+V QLP++Y+ LG DYD+RVLPSI NEVLKS+VAQF+A++LITQRE +
Sbjct: 96  MVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREKV 155

Query: 149 SQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQE 208
           S+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA QE
Sbjct: 156 SRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQE 215

Query: 209 RQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           +Q  V++A GEA+SAE I +A+ K  D + L +RL+ +K+IA  LA S N V L ++
Sbjct: 216 KQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPNRVVLDNE 271

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  284 bits (727), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 188/238 (78%), Gaps = 1/238 (0%)

Query: 28  TMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +I+ R+NGV+ ++  EGTHF +PW +  I+YDVR KP+++A+ TGT+DL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP V QLP++++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 207
           +S+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L+ S N V L ++
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPNRVILDNE 293

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  284 bits (726), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 186/238 (78%), Gaps = 1/238 (0%)

Query: 28  TMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RI+GV  ++  EGTHF++PW++  IIYDVR KP+++A+ TGT+DL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP V  LP+IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 207
           +S+ IR+ L  R++ F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 208 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           E+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA S N V L ++
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPNRVVLDNE 295

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  281 bits (720), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 134/237 (56%), Positives = 185/237 (78%), Gaps = 1/237 (0%)

Query: 29  MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDLQ 88
           +++V GG R +++ RI GV  ++  EGTH ++PWL+  ++YDVR KP+++A+ TGT+DLQ
Sbjct: 60  LFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGTKDLQ 119

Query: 89  MVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREII 148
           MV++T RVL RP V QLP+IY+ LG DY ERVLPSI NEVLK++VAQF+A++LITQRE +
Sbjct: 120 MVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQREKV 179

Query: 149 SQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQE 208
           S+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA QE
Sbjct: 180 SRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQE 239

Query: 209 RQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           +Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IAQ LA S N V L ++
Sbjct: 240 KQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPNRVILDNE 295

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  280 bits (715), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 186/237 (78%), Gaps = 1/237 (0%)

Query: 29  MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDLQ 88
           +++V GG R +++ RI GV  ++  EGTH L+PW +  ++YDVR KP+++A+ TGT+DLQ
Sbjct: 61  LFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDLQ 120

Query: 89  MVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREII 148
           MV++T RVL RP+V QLP IY+ LGLDYDERVLPSI NEVLK++VAQF+A++LITQRE +
Sbjct: 121 MVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREKV 180

Query: 149 SQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQE 208
           S+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V++A QE
Sbjct: 181 SRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQE 240

Query: 209 RQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYLPSQ 265
           +Q  V++A+G+A+SAE I +A+ K  D + L +RL+ +++IAQ L+ S N V L ++
Sbjct: 241 KQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPNRVVLDNE 296

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  279 bits (713), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 184/234 (78%), Gaps = 1/234 (0%)

Query: 29  MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDLQ 88
           +++V GG R +++ RINGV+ ++  EGTHF++PW++  ++YDVR KP+++++ TGT+DLQ
Sbjct: 59  LFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDLQ 118

Query: 89  MVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREII 148
           MV++T RVL RP V  LP IY+ LG+DYDERVLPSI NEVLK++VAQF+A++LITQRE +
Sbjct: 119 MVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRERV 178

Query: 149 SQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQE 208
           S+ IR+ L  RA  F I L+DVSIT+MTF PEFT +VE KQIAQQDA++A F+V+KA QE
Sbjct: 179 SRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQE 238

Query: 209 RQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVVYL 262
           +Q  +++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L+ S N V L
Sbjct: 239 KQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPNKVIL 291

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 165 IKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE 224
           IKL DVSI++     + TK++E     Q+ AER++    ++ ++   + ++     ES E
Sbjct: 197 IKLRDVSISY----DQLTKSIESA-YQQKAAERSEAPANESHKDHFQTNMQPVTTGESIE 251

Query: 225 FISKALAKVGDGLLLIRRLEASKD 248
           +I   L K  D + +  R   + D
Sbjct: 252 YIKSLLLKASDFVTMFDRFYVALD 275

>KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3.410
           YGR082W
          Length = 185

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%)

Query: 183 KAVEQKQIAQQDAERAK 199
           KAV+QK++AQQDA RAK
Sbjct: 43  KAVKQKKLAQQDAARAK 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,406,546
Number of extensions: 890609
Number of successful extensions: 3253
Number of sequences better than 10.0: 60
Number of HSP's gapped: 3383
Number of HSP's successfully gapped: 60
Length of query: 287
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 179
Effective length of database: 41,097,471
Effective search space: 7356447309
Effective search space used: 7356447309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)