Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4423.493ON1741747242e-98
YGR131W (FHN1)3.493ON1741746554e-88
Smik_6.2273.493ON1741745904e-78
Suva_7.4193.493ON1741745375e-70
Skud_16.4443.493ON1731744193e-52
Smik_16.4023.493ON1731744054e-50
NDAI0B058803.493ON1821824064e-50
NDAI0G009303.493ON1761774046e-50
YPR149W (NCE102)3.493ON1731744021e-49
CAGL0I10494g3.493ON1721753984e-49
Suva_16.4783.493ON1661743881e-47
NCAS0E008003.493ON1741743778e-46
CAGL0L08448g3.493ON1731743752e-45
TDEL0D056103.493ON1751753682e-44
KAFR0C019703.493ON1791813326e-39
KNAG0B008003.493ON1821823292e-38
SAKL0F02750g3.493ON1701743247e-38
Kwal_55.212383.493ON1701743178e-37
Kpol_1017.63.493ON1871873189e-37
KLLA0D16280g3.493ON1691743031e-34
KLTH0F14850g3.493ON1711753012e-34
KAFR0G037003.493ON1861863023e-34
NCAS0F035603.493ON1831833013e-34
ZYRO0D09966g3.493ON1781782952e-33
TBLA0D029603.493ON1891892936e-33
KNAG0A079503.493ON1821822926e-33
TBLA0C044903.493ON1861712892e-32
TPHA0D032803.493ON1841842832e-31
Ecym_12363.493ON1691742047e-20
AFR312W3.493ON1681221932e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.442
         (174 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   283   2e-98
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   256   4e-88
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   231   4e-78
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   211   5e-70
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   166   3e-52
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   160   4e-50
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   160   4e-50
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   160   6e-50
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   159   1e-49
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   157   4e-49
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   154   1e-47
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   149   8e-46
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   149   2e-45
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   146   2e-44
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   132   6e-39
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   131   2e-38
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   129   7e-38
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   126   8e-37
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   127   9e-37
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   121   1e-34
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   120   2e-34
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   120   3e-34
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   120   3e-34
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   118   2e-33
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   117   6e-33
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   117   6e-33
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   115   2e-32
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   113   2e-31
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    83   7e-20
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...    79   2e-18

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  283 bits (724), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 144/174 (82%), Positives = 144/174 (82%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLSAADNLIRIVSAVF             TQTNGSSRVNFCMFAAAYGLITDSFYGFLAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           FWSSLTYPAILLV                 VGIRCHSCKNKTYLEQNNITQGSSSRCHQS
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  256 bits (655), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 134/174 (77%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLSAADNL+RI++AVF             TQT  SSRVNFCMFAA YGL+TDS YGFLAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           FW+SLTYPAILLV                 VGIRCHSCKNKTYLEQN I QGSSSRCHQS
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QAAVAFFYFSCFLFLIKVTV+  GMMQNGGFG NTG+ RRRARRQMG+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  231 bits (590), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 134/174 (77%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLSAADNLIRI++AVF             TQ   SSRVNFCMF AAYGL+TDS YGFLAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           FWSSLTYPAILL                  VGIRCHSCKNKTYLEQN ITQ SSSRCHQS
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QAAVAFFYFSCFLFLIKVTV+ AG +QNGGFGFN+G+GRRRARRQ+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  211 bits (537), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 111/174 (63%), Positives = 126/174 (72%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS ADN++RI++A+F             +QT  SSRVNFCMFAAAYGL+TDSFYG LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
            WSSLTYP I+ V                 VGIRCHSC NKTYL+ N ITQGS SRCHQ+
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           +AAV FFYFSC LFLIKV VS+A M+QNGGFGF   +GRRRARRQMG+PTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  166 bits (419), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 107/174 (61%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML+ ADN++RI++ +F             TQ   SSRVNFCMFAAAYG+ TDS YG  AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F+  L +P +L                   VGIR HSC N++Y++ N ITQGS +RC Q+
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QAAVAF YFSC +FL K  +SV  M+ NG FG +  + +RR   Q+GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG-SGSFSKRRRTGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  160 bits (405), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 104/174 (59%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML+ ADN++RI++ +F             TQ   SSRVN+CMFA AYG+ TDS YG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F   L +P +L                   VGIR HSC N +Y++ N ITQGS +RC Q+
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QAAVAF YFSC +FL K  +S+  M+ NG FG +  + +RR   Q+GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFG-SGSFSKRRRTGQVGVPTISQV 173

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  160 bits (406), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 85/182 (46%), Positives = 110/182 (60%), Gaps = 8/182 (4%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS  DN++R+++A+F             TQ N SSR+NFCMFAAA+GL+TDSF+G   N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FWSSL-TYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119
            + +L ++P +L +                 V IR HSCKN+ Y+  N+ITQGS +RC  
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARR-------QMGVPTIS 172
           SQAAVAFFYFSCF+FL K+ +S   M  NG FG  T  G R  RR       ++GVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  160 bits (404), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 110/177 (62%), Gaps = 4/177 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS ADNL+R+++A+F             TQ   +SR+N+CMF   Y L+TDSF+G LAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F+  L++P IL                    GIR HSC N++YL++N ITQGS +RC +S
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARR---QMGVPTISQV 174
           QA VAFFYFS F+FLIK+ +S   M+QNG F  NT   RRR R    ++GVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFS-NTFTSRRRRRNGAAEVGVPSISQV 176

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  159 bits (402), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 104/174 (59%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML+ ADN++RI++ +F             TQ   SSRVN+CMFA AYG+ TDS YG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F   L +P +L                   VGIR HSC N +Y++ N ITQGS +RC Q+
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QAAVAF YFSC +FL K  +SV  M+ NG FG +  + +RR   Q+GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG-SGSFSKRRRTGQVGVPTISQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  157 bits (398), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 105/175 (60%), Gaps = 4/175 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS ADNL+RIV+AVF             T+   SSRVNFC+FAAAYG+ TDS YG  AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLE-QNNITQGSSSRCHQ 119
           F+  L +P +L V                 VGIR HSC NK YLE +  I QGS +RC Q
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           +QA VAFFYFS  +FL K+ +S+  ++ NG FG      RR+   ++GVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 172

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  154 bits (388), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 105/174 (60%), Gaps = 8/174 (4%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML+  DN++RI++ +F             TQ+  SSR+N+CMFA AY ++TDS YG  AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F+  L +P IL                     IR HSC+N+TYL  N+ITQGS +RC ++
Sbjct: 61  FFEPLAWPLILF-------SLDFLNFVFTFTAIRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QAAVAF YFSC +FL K  +SV  M+ NG FG +  + +RR   Q+GVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG-SGSFSKRRRTGQVGVPTISQV 166

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  149 bits (377), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 101/174 (58%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML  ADNL+RI++AVF             T+T+ +SR+N+CMF  AY L TDS YG  AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F+  L  PA+                     GIR HSCK++ Y+  N ITQG  +RC +S
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QA VAFFYFS  +FL K+ +S   M+QNG F  + G  RRR   ++GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  149 bits (375), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 99/174 (56%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML+  DNL+RIV+ VF             T+   SSRVN+CMFAAAYG+ TDS YG  AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F+  L +P IL                   VGIR HSC N  Y E N I QGS  RC +S
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QAAVAFF+FS  +FL K+ +S+  +  NG FG      RRR   ++GVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFG-TKFIRRRRNNAEVGVPSVSQV 173

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  146 bits (368), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 106/175 (60%), Gaps = 1/175 (0%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML+  DN +R+V+  F             ++   SSRVNFCMFAAA+G++TDSFYG LAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
            W    +P IL                   VGIR HSCKN+ YL+ NNITQGS+ RC  +
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGY-GRRRARRQMGVPTISQV 174
           QA+VAFFYFS F+FL K+ +S+ G++ NG F   T    RRR   Q+GVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  132 bits (332), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 101/181 (55%), Gaps = 9/181 (4%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQT-NGSSRVNFCMFAAAYGLITDSFYGFLA 59
           ML  ADN++R+++AVF             TQ  + +SRVN+CMFA A+GL  DS YG  A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119
           NF+  L +P +L                   VGIR HSC N++YL+ N I +GS  RC +
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQM------GVPTISQ 173
           +QA VAF YFS  +F+ K+ +S   + QNG   F++G  R  +RR+       GVP ISQ
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNG--AFSSGSSRFISRRKKHATDVGGVPNISQ 178

Query: 174 V 174
           V
Sbjct: 179 V 179

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  131 bits (329), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 76/182 (41%), Positives = 94/182 (51%), Gaps = 8/182 (4%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML  ADNL+R+++  F             TQ    SRVN+CMFAAAYG+ TD  YG LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           FW  L +P IL                   VGIR HSCKN  Y E+N+I QGS +RC  S
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTG--------YGRRRARRQMGVPTIS 172
           QAA AFF+FS  +F+ K+ +S   +  NG F   +          G        GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  129 bits (324), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 101/174 (58%), Gaps = 4/174 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS  DN +R+V+  F             TQ   S RVNF +F AA+ L+TDSFY   AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
            +S+  +P +L+                  VGIR HSC N++YL  NNITQGS+ RC ++
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QA VAF YFS F+FL K+ +SV  +  +G FG  +G G RRA   +GVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFG--SGSGSRRA--NVGVPTISQV 170

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  126 bits (317), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 98/174 (56%), Gaps = 4/174 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS  DN +R  + VF             T+ N + +VNF +FAAA+GL+ D+ Y   AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F S+L +P ++ V                 V IR HSC N  Y++ N +TQGSS RC ++
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QA+VAF YF+ F+FL+K+ +S+  +   G F   T  GR+ A   +GVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFS--TSSGRKSA--NVGVPTISQV 170

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  127 bits (318), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 105/187 (56%), Gaps = 13/187 (6%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS ADN++R ++  F             T+   SSRVN+CMF   + ++TDSFYG LAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FWSS-LTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119
            W++   +P IL                   VGIR HSCKN+ Y++ N I QGS+ RC +
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNT-GYGRRR-----------ARRQMG 167
           +QA++AFFYFS F+F +KV +S   ++ NG  GF+T   GRRR           +  Q+G
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 168 VPTISQV 174
           VP ISQV
Sbjct: 181 VPNISQV 187

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  121 bits (303), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 94/174 (54%), Gaps = 5/174 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS  DN +R V+ VF             TQ + SSRVNF +FAA +G++ DS Y  +AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F S+L +P IL+                  VGIR  SC N ++   N I +GS  RC ++
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QA+  F YFS  +FL+K  +S+   + +G FG  T   R   + Q+GVPTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFG--TSSNR---KTQVGVPTISQV 169

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  120 bits (301), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 97/175 (55%), Gaps = 5/175 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXT-QTNGSSRVNFCMFAAAYGLITDSFYGFLA 59
           MLS  DN +R ++  F             T +T+ + +VNF +F AA+GL+ DS Y   A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119
           NF S+L +P ++ V                 V IR HSC N+ YL+ N +TQGS+ RC +
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           +QA+VAF YFS F+FL K+ +S+  ++  G F    G G  R    +GVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAF----GAGSSRRTGNVGVPTISQV 171

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  120 bits (302), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 100/186 (53%), Gaps = 12/186 (6%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXT-QTNGSSRVNFCMFAAAYGLITDSFYGFLA 59
           ML+ ADN +R+V+  F             T Q + S+RVN+CMFA A+G++TDS YG  A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119
           NF+  L +P IL V                 VGIR H+C N+ Y   N I +GS +RC  
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGG--FGFNTGYGRRRARR---------QMGV 168
           +QAAVAFFYFS  +FL+K   S+   +  G    G + G+G RR RR           GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 169 PTISQV 174
           PT+S+V
Sbjct: 181 PTVSEV 186

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  120 bits (301), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 102/183 (55%), Gaps = 9/183 (4%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS  DN +R  + +F             TQ +GSSRVN+CMFAAA+GL+TDSF+G  AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FWSSLT-YPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119
               L+ +P IL V                 VGIRCHSC N+ YLE N I QGS  RC  
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARR--------QMGVPTI 171
           SQAAVAFFYF+ F+FL K+ +S   M  NG FG  +   RR+ R           GVPTI
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 172 SQV 174
           S+V
Sbjct: 181 SEV 183

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  118 bits (295), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 109/178 (61%), Gaps = 4/178 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNG-SSRVNFCMFAAAYGLITDSFYGFLA 59
           ML+  DN++R V+  F             ++ +G +SRVNFCMFAAA+G++ DSFYG LA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119
           N +    +P IL +                 VGIR HSC N+ YL+ N ITQGS+SRC +
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQ---MGVPTISQV 174
           +QA VAFFYF+ F+FL K+ +S   ++ NG FG ++G+  RR R Q   +GVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  117 bits (293), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 94/189 (49%), Gaps = 15/189 (7%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQT-NGSSRVNFCMFAAAYGLITDSFYGFLA 59
           ML   DN+ RI +  F             T+  + SSRVN+CMF  A+GL++DSFYG LA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NF-WSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCH 118
           N       +P IL                   VGIR HSC NK Y  +N I QGS  RC 
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 QSQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFG--------FNTGYGRR---RARRQM- 166
           ++QA +AFFYFS FLFL+KV +++      G  G            +GRR   RA  QM 
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQMN 180

Query: 167 -GVPTISQV 174
            G  +ISQV
Sbjct: 181 KGGISISQV 189

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  117 bits (292), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 102/182 (56%), Gaps = 8/182 (4%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML+ AD  +R+V+ VF             TQ   SSR+N+CMF AAYG+ TDSFYG +AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           FW  L++P +L                   VGIR HSCKN  Y  +N I QGS +RC Q+
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGF--NTGYGRRRARRQ------MGVPTIS 172
           QAAVAFF+FS  +FL K  +S+  +  NG FG   ++  G R ++R+       GVP IS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 173 QV 174
            V
Sbjct: 181 TV 182

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  115 bits (289), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 91/171 (53%), Gaps = 4/171 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNG-SSRVNFCMFAAAYGLITDSFYGFLA 59
           MLS   N++RI++  F             ++    S RVN+CMFAA + L+TDSFY   A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFWSS-LTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCH 118
           NFW S   +P +L                   VGIR HSC NK YL  N ITQGS+ RC 
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 QSQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNT--GYGRRRARRQMG 167
            +QA++AF+YFS F++L+++  S   M +NG F      G   R +RR++ 
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLA 171

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  113 bits (283), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 97/184 (52%), Gaps = 10/184 (5%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           ML  ADN++R V+  F             TQ   SSRVN+C+F   + L+TD+FYG LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FWSS-LTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119
            WS+ L +P IL                   VG R HSC N++YL+ NNITQGS+ RC +
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFG---------FNTGYGRRRARRQMGVPT 170
           +QAA AFFYFS F+FL K+ +S   +  NG  G                  A  Q+GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 171 ISQV 174
           ISQV
Sbjct: 181 ISQV 184

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 83.2 bits (204), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 85/174 (48%), Gaps = 5/174 (2%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS  DN +R  + +F              Q    SRVNF +F A + L+ DS Y  LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F S+L +P +L+                    I  HSC N  +L  N+I++G   RC + 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174
           QA+  F +FS F+FL K  +S   ++  G   F++G GR+      GVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTG--AFSSGSGRKTGG---GVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 59/122 (48%)

Query: 1   MLSAADNLIRIVSAVFXXXXXXXXXXXXXTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60
           MLS  DN +R V+ VF              Q N  SRVNF +F A + L+TDSFY  +AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FWSSLTYPAILLVXXXXXXXXXXXXXXXXXVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120
           F S+  +P I +                    I  HSC N+ +L+ N I++ S+ RC + 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QA 122
           QA
Sbjct: 121 QA 122

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,073,816
Number of extensions: 372380
Number of successful extensions: 1111
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1068
Number of HSP's successfully gapped: 30
Length of query: 174
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 72
Effective length of database: 41,785,467
Effective search space: 3008553624
Effective search space used: 3008553624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)