Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4413.492ON80780731490.0
Smik_6.2263.492ON83984124090.0
Suva_7.4183.492ON83183823450.0
YGR130C3.492ON81660418840.0
NCAS0E008103.492ON6924759031e-110
SAKL0F02772g3.492ON7734688541e-102
CAGL0I10516g3.492ON8134678471e-100
NDAI0G009403.492ON6564797042e-81
KLTH0F14828g3.492ON8364586573e-73
TDEL0D056003.492ON7004126021e-66
KLLA0D16236g3.492ON8714946049e-66
Kpol_480.143.492ON6993175862e-64
ZYRO0D09988g3.492ON9943175921e-63
Kwal_55.212293.492ON7874925797e-63
TPHA0D042503.492ON6293375331e-57
Ecym_12373.492ON7273053716e-36
KNAG0B008103.492ON7573243682e-35
KAFR0C019603.492ON5632742956e-27
AFR310C3.492ON6232632556e-22
TBLA0C044803.492ON802941834e-13
KNAG0A079403.492ON2751691383e-08
KAFR0G036903.492ON3631741271e-06
NCAS0F035503.492ON4411371262e-06
NDAI0B058603.492ON681113940.012
TDEL0F047508.351ON70569820.41
KNAG0F001301.19ON363102800.53
Kwal_26.79022.502ON532133800.58
ZYRO0B12144g4.238ON2005231752.9
NDAI0J008308.351ON70865752.9
KNAG0M022602.590ON847186743.5
NCAS0I029301.163ON84864743.7
KLTH0G11550g8.351ON70165734.3
KLTH0F12144g3.425ON843109725.6
TBLA0H011308.351ON75567708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.441
         (807 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...  1217   0.0  
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   932   0.0  
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   907   0.0  
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   730   0.0  
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   352   e-110
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   333   e-102
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   330   e-100
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   275   2e-81
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   257   3e-73
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   236   1e-66
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   237   9e-66
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   230   2e-64
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   232   1e-63
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   227   7e-63
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   209   1e-57
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   147   6e-36
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   146   2e-35
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   118   6e-27
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...   102   6e-22
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    75   4e-13
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    58   3e-08
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    54   1e-06
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    53   2e-06
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    41   0.012
TDEL0F04750 Chr6 complement(893402..895519) [2118 bp, 705 aa] {O...    36   0.41 
KNAG0F00130 Chr6 complement(7147..8238) [1092 bp, 363 aa] {ON} A...    35   0.53 
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    35   0.58 
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    33   2.9  
NDAI0J00830 Chr10 (185771..185801,185919..188014) [2127 bp, 708 ...    33   2.9  
KNAG0M02260 Chr13 complement(417569..420112) [2544 bp, 847 aa] {...    33   3.5  
NCAS0I02930 Chr9 (541697..544243) [2547 bp, 848 aa] {ON} Anc_1.1...    33   3.7  
KLTH0G11550g Chr7 (971803..971833,971902..973976) [2106 bp, 701 ...    33   4.3  
KLTH0F12144g Chr6 complement(1023571..1026102) [2532 bp, 843 aa]...    32   5.6  
TBLA0H01130 Chr8 (253122..253152,253271..255507) [2268 bp, 755 a...    32   8.9  

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score = 1217 bits (3149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/807 (77%), Positives = 624/807 (77%)

Query: 1   MLFNTNRQDEDPFTQLIXXXXXXXXXXXXXXXXKPYQFLQKVVSNEPKGKEEWVSPFRQD 60
           MLFNTNRQDEDPFTQLI                KPYQFLQKVVSNEPKGKEEWVSPFRQD
Sbjct: 1   MLFNTNRQDEDPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPKGKEEWVSPFRQD 60

Query: 61  ALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTK 120
           ALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTK
Sbjct: 61  ALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTK 120

Query: 121 NEERQYQXXXXXXXXXXXXXXXXXCQKITDLXXXXXXXXXXXXXXXXXXXXXXXXXXXKG 180
           NEERQYQ                 CQKITDL                           KG
Sbjct: 121 NEERQYQLLTELELKEKHLKYLKECQKITDLTSDGNDDAATSADSSLSSSDKEDSTTSKG 180

Query: 181 NEIAGEXXXXXXXXXXXXXXXXXXXVGDSGDEATSIEEEQDDKASETTSVEKAAAGNGEG 240
           NEIAGE                   VGDSGDEATSIEEEQDDKASETTSVEKAAAGNGEG
Sbjct: 181 NEIAGEAAAADMTKITTTTAPTSSAVGDSGDEATSIEEEQDDKASETTSVEKAAAGNGEG 240

Query: 241 AQEPVALKNEGSVAEPTAVTTQVDVPEPAVTSQSNVPESAVLPXXXXXXXXXXXXXXNPT 300
           AQEPVALKNEGSVAEPTAVTTQVDVPEPAVTSQSNVPESAVLP              NPT
Sbjct: 241 AQEPVALKNEGSVAEPTAVTTQVDVPEPAVTSQSNVPESAVLPTEESKSETSVVKEVNPT 300

Query: 301 XXXXXXXXXXXXXXXXXQSSVXXXXXXXXXXXXXXXXXXXDKAPIDPSKAPKVPFKERPK 360
                            QSSV                   DKAPIDPSKAPKVPFKERPK
Sbjct: 301 EEGQTEEVHDEEDEKSEQSSVEEHGEETSTPETSEAESVEDKAPIDPSKAPKVPFKERPK 360

Query: 361 KERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDE 420
           KERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDE
Sbjct: 361 KERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDE 420

Query: 421 KVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNR 480
           KVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNR
Sbjct: 421 KVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNR 480

Query: 481 LVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQK 540
           LVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQK
Sbjct: 481 LVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQK 540

Query: 541 EFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHER 600
           EFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHER
Sbjct: 541 EFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHER 600

Query: 601 NVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHX 660
           NVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAH 
Sbjct: 601 NVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHE 660

Query: 661 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEQQITQVKQTYNDQLTXXXXXXXX 720
                                             DHEQQITQVKQTYNDQLT        
Sbjct: 661 EQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQDKLAA 720

Query: 721 XXXXXXXXXXXRTRLQGEKAIEEQTRQKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNS 780
                      RTRLQGEKAIEEQTRQKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNS
Sbjct: 721 EEKELEAVKRERTRLQGEKAIEEQTRQKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNS 780

Query: 781 HSPKNEILVPKDDSLYEYHTEEDVMYA 807
           HSPKNEILVPKDDSLYEYHTEEDVMYA
Sbjct: 781 HSPKNEILVPKDDSLYEYHTEEDVMYA 807

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/841 (59%), Positives = 565/841 (67%), Gaps = 36/841 (4%)

Query: 1   MLFNTNRQDEDPFTQLIXXXXXXXXXXXXXXXXKPYQFLQKVVSNEPKGKEEWVSPFRQD 60
           MLFN NRQ++DPFTQLI                 PYQFLQKVVSNEPKGKEEW+SPFRQD
Sbjct: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD 60

Query: 61  AL-SRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 119
           AL S+  NNRLYV DAKN+KFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT
Sbjct: 61  ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 120

Query: 120 KNEERQYQXXXXXXXXXXXXXXXXXCQKITDLXXXXXXXXXXXXXXXXXXXXXXXXXXXK 179
           +NEERQYQ                 CQKITDL                            
Sbjct: 121 QNEERQYQLLTELELKEKHLQYLKKCQKITDLTKDEKNDNGTATSSSMSTSSSSSSSSSD 180

Query: 180 GNEIAGEXXXXXXXX-----XXXXXXXXXXXVGDSG-DEATSIEEEQDDKASETTSVEKA 233
              IA                          + + G DEATSIEE+Q DKASE+TS+E++
Sbjct: 181 DEGIASTTTTENNEAIANTSTTMTTSTSTTSINEHGSDEATSIEEKQGDKASESTSIEES 240

Query: 234 AAGNGEGAQEPVALKNEGSVAEP-----TAVTTQVDVPEPAVTSQ--------------- 273
            + N    +E  +L +EG+VAE      TA +TQ++VPEPA TSQ               
Sbjct: 241 TSKNDNNVREAASLNDEGNVAESSISKTTADSTQMNVPEPAATSQRDTSAQVVTSSNDAS 300

Query: 274 -------SNVPESAVLPXXXXXXXXXXXXXXNPTXXXXXXXXXXXXXXXXXQSSVXXXXX 326
                  S + +S ++P                +                 QSSV     
Sbjct: 301 EPHTKSESGISKSDIIPTEELKEETVVAKKI--SSAVKSTEEEEGEGEETEQSSVEEPGE 358

Query: 327 XXXXXXXXXXXXXXDKAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAP 386
                         DK PIDPSKAPKVPF+ERP+K +TGIFALWKS TSSSAQK    AP
Sbjct: 359 ETSTPGTSESESEEDKVPIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAP 418

Query: 387 SNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYS 446
           SNPVATPE PELIVKTKEHGYLSKAVYDKINYDEKVHQAWL DL+A+EKAKYDA +  Y 
Sbjct: 419 SNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYE 478

Query: 447 ERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENM 506
           E+LQDLQNQIDE+E+SMKAMRKETSEKIEVSKNRLVKQIIDVN AHNNKKLMIFKDTENM
Sbjct: 479 EKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENM 538

Query: 507 KNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQI 566
           KNQKL+EK+ VL KQT VKS+IDELNS KTNVQK+FNDWTTNLSNLSQQLDAQIFKINQI
Sbjct: 539 KNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQI 598

Query: 567 NLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVST 626
           NLKQSKVQ+EID+L++KK  L+ QT+EN+KLHE+NVQ LESVEN+EYLPQINDIDNQ+ST
Sbjct: 599 NLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQIST 658

Query: 627 LLNKMTIIRQENANEKTELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXX 686
           LLN+MTII+QENANEKT+LSAITKRLEDERRAH                           
Sbjct: 659 LLNEMTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELE 718

Query: 687 XXXXXXXXDHEQQITQVKQTYNDQLTXXXXXXXXXXXXXXXXXXXRTRLQGEKAIEEQTR 746
                   DHE+QITQVK+TYNDQLT                   +TRLQGEKAIEEQTR
Sbjct: 719 EQARQAQLDHEEQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTR 778

Query: 747 QKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNSHSPKNEILVPKDDSLYEYHTEEDVMY 806
           Q+++DEALKQEIL KQHKQAEGLHAAE++ IPN H  KN+ +VPKDDSLYEYHTEEDVMY
Sbjct: 779 QRNADEALKQEILSKQHKQAEGLHAAERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMY 838

Query: 807 A 807
           A
Sbjct: 839 A 839

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/838 (59%), Positives = 552/838 (65%), Gaps = 38/838 (4%)

Query: 1   MLFNTNRQDEDPFTQLIXXXXXXXXXXXXXXXXKPYQFLQKVVSNEPKGKEEWVSPFRQD 60
           MLFNT+RQ++DPFTQLI                KPYQFLQKVVSNEPKGKE+WVSPFRQD
Sbjct: 1   MLFNTSRQEDDPFTQLINQSSAQNQQVQQQE--KPYQFLQKVVSNEPKGKEDWVSPFRQD 58

Query: 61  ALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTK 120
           ALS NQNNRLYV DAKN+KFPTVSATS YSKQQP+DLGYKNIPK+ KRAKDI+FPTYLTK
Sbjct: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118

Query: 121 NEERQYQXXXXXXXXXXXXXXXXXCQKITDLXXXXXXXXXXXXXXXXXXXXXXXXXXXKG 180
           NEERQYQ                 CQKITDL                             
Sbjct: 119 NEERQYQLLTELELKEKHLKYLKKCQKITDLTGDANDDTTSTTSSSSSLSSSDDEDTASA 178

Query: 181 NEIAGEXXXXXXXXXXXXXXXXXXXVGDSGDEATSIEEEQDDKASETTSVEKAAAGNGEG 240
              A                      GDS DEATSIEEEQ + A ETT   +  A N + 
Sbjct: 179 TAPA---ENETATTATTTATSTTSAAGDSADEATSIEEEQKENAGETTPTVETTADNEKE 235

Query: 241 AQEPVALKNEGSVAEP-----TAVTTQVDVPEPAVTSQSN-------------------- 275
            QEP   K+E ++AEP     T VT + D+PE AV + S+                    
Sbjct: 236 IQEPETFKDEQNLAEPAVAEITPVTARSDIPESAVAAASDDVPEVAVANTSDNVPEVTVA 295

Query: 276 -----VPESAVLPXXXXXXXXXXXXXXNPTXXXXXXXXXXXXXXXXXQSSVXXXXXXXXX 330
                VPE AV P                T                 QSS          
Sbjct: 296 AASDEVPEEAVAPIEEQTEKTSVVKTD--TVTKEGKGEVADVEEETEQSSADEHGEETST 353

Query: 331 XXXXXXXXXXDKAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPV 390
                     D  PIDPSKAPKVPF+ERP+KERTG FALWKSPTSSSA+KG  TAP NPV
Sbjct: 354 PETSEAESDGDITPIDPSKAPKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAPLNPV 413

Query: 391 ATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQ 450
           ATPENPELIVKTKEHGYLSKAVYDKINYDEK+HQAWL DL+A+EKAKYDA +T Y E+LQ
Sbjct: 414 ATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQ 473

Query: 451 DLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQK 510
           DLQNQIDEIENSMK +R+ETS+KIEV+KNRLVKQIID+NT HNNKKLMIFKDTENMK QK
Sbjct: 474 DLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQK 533

Query: 511 LQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQ 570
           L+EK+EVL KQT VKSEIDELNS K+NVQKEFNDWTTNLS+LSQQLDAQIFKINQINLKQ
Sbjct: 534 LEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQ 593

Query: 571 SKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNK 630
           SK QNEID L+K+K+DLI QTEENKKLHE+NV+ LESVENKEYLPQINDID Q+STLLN+
Sbjct: 594 SKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQ 653

Query: 631 MTIIRQENANEKTELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 690
           MTIIRQENANE+T LSAITK+LEDERRAH                               
Sbjct: 654 MTIIRQENANERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAH 713

Query: 691 XXXXDHEQQITQVKQTYNDQLTXXXXXXXXXXXXXXXXXXXRTRLQGEKAIEEQTRQKSS 750
               +HE+QITQVK+TYNDQLT                   RT+LQGEKAIEEQTRQK++
Sbjct: 714 QAELEHEEQITQVKKTYNDQLTELQDKLAAEEEELEAVKRERTKLQGEKAIEEQTRQKNA 773

Query: 751 DEALKQEILGKQHKQAEGLHAAE-KHNIPNSHSPKNEILVPKDDSLYEYHTEEDVMYA 807
           DE LKQ IL KQHKQA GLHAAE + N P+S+  +++  VPK+DSLYEYHTEEDVMYA
Sbjct: 774 DEILKQTILDKQHKQATGLHAAENRVNTPSSNLQESKRAVPKNDSLYEYHTEEDVMYA 831

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/604 (64%), Positives = 433/604 (71%), Gaps = 15/604 (2%)

Query: 206 VGDSGDEATSIEEEQDDKASETTSVEKAAAGNGEGAQEPVALKNEGSVAEPTAVTTQVDV 265
           V +S DEATS+EEE +DK SE+TS+ K   G  + AQ         +VAEP  ++++  V
Sbjct: 226 VENSADEATSVEEEHEDKVSESTSIGK---GTADSAQ--------INVAEP--ISSENGV 272

Query: 266 PEPAVTSQSNVPESAVLPXXXXXXXXXXXXXXNPTXXXXXXXXXXX--XXXXXXQSSVXX 323
            EP  T QS   +S V+P              NP                    QSS   
Sbjct: 273 LEPRTTDQSGGSKSGVVPTDEQKEEKSDVKKVNPPSGEEKKEVEAEGDAEEETEQSSAEE 332

Query: 324 XXXXXXXXXXXXXXXXXDKAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGV 383
                            D++PIDPSKAPKVPF+E  +KERTGIFALWKSPTSSS QK   
Sbjct: 333 SAERTSTPETSEPESEEDESPIDPSKAPKVPFQEPSRKERTGIFALWKSPTSSSTQKSKT 392

Query: 384 TAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATST 443
            APSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEK+HQAWLADL+AKEK KYDA + 
Sbjct: 393 AAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNK 452

Query: 444 GYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDT 503
            Y E+LQDLQNQIDEIENSMKAMR+ETSEKIEVSKNRLVK+IIDVN  HNNKKLMI KDT
Sbjct: 453 EYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDT 512

Query: 504 ENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKI 563
           ENMKNQKLQEK+EVL KQT VKSEID+LN+ KTNVQKEFNDWTTNLSNLSQQLDAQIFKI
Sbjct: 513 ENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKI 572

Query: 564 NQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQ 623
           NQINLKQ KVQNEID L+KKKEDL+ QTEENKKLHE+NVQ LESVENKEYLPQINDIDNQ
Sbjct: 573 NQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQ 632

Query: 624 VSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXX 683
           +S+LLN++TII+QENANEKT+LSAITKRLEDERRAH                        
Sbjct: 633 ISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQ 692

Query: 684 XXXXXXXXXXXDHEQQITQVKQTYNDQLTXXXXXXXXXXXXXXXXXXXRTRLQGEKAIEE 743
                      DHEQQITQVKQTYNDQLT                   RTRLQ EKAIEE
Sbjct: 693 ELEEQAHQAQLDHEQQITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEE 752

Query: 744 QTRQKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNSHSPKNEILVPKDDSLYEYHTEED 803
           QTRQK++DEALKQEIL +QHKQAEG+HAAE H IPN  S KN  ++PKDDSLYEYHTEED
Sbjct: 753 QTRQKNADEALKQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPKDDSLYEYHTEED 812

Query: 804 VMYA 807
           VMYA
Sbjct: 813 VMYA 816

 Score =  224 bits (572), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 111/151 (73%)

Query: 1   MLFNTNRQDEDPFTQLIXXXXXXXXXXXXXXXXKPYQFLQKVVSNEPKGKEEWVSPFRQD 60
           MLFN NRQ++DPFTQLI                 PYQFLQKVVSNEPKGKEEWVSPFRQD
Sbjct: 1   MLFNINRQEDDPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGKEEWVSPFRQD 60

Query: 61  ALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTK 120
           AL+  QNNR Y  DAKN+KFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT+
Sbjct: 61  ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQ 120

Query: 121 NEERQYQXXXXXXXXXXXXXXXXXCQKITDL 151
           NEERQYQ                 CQKITDL
Sbjct: 121 NEERQYQLLTELELKEKHLKYLKKCQKITDL 151

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  352 bits (903), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/475 (42%), Positives = 279/475 (58%), Gaps = 28/475 (5%)

Query: 344 PIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTK 403
           PIDP+ AP VPF            +L      S  +      PSNPVA+P N E IVKT 
Sbjct: 235 PIDPALAPMVPF------------SLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTA 282

Query: 404 EHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSM 463
           + GYLSKAVYDKI YDE+ H+ WLAD + K+  KY+A    Y + LQD+ NQ+ E+ + +
Sbjct: 283 QFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLI 342

Query: 464 KAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTA 523
           +    +T EKI+V   +LVK++ D      N K+ IF +T+ +K +KL EK+ VL   T 
Sbjct: 343 EKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTE 402

Query: 524 VKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKK 583
           VK  IDEL + K  V+ E+++WTTN++N+  +LDA++FKI+QIN+ Q  +QN+IDAL  +
Sbjct: 403 VKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQ 462

Query: 584 KEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKT 643
           K +L  +  +NK +H+ NV+ +ESV+NKEYLP++NDIDN+++ LLN+MTI++QENANEK 
Sbjct: 463 KNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKV 522

Query: 644 ELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEQQITQV 703
           +L+ ITK+LEDERRAH                                   +H+Q+I  +
Sbjct: 523 QLAEITKKLEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDAL 582

Query: 704 KQTYNDQLTXXXXXXXXXXXXXXXXXXXRTRLQGEKAIEEQTRQKSSDEALKQEILGKQH 763
           K  Y  +L                    +TRL+GEKA++EQ RQK +D+ LK EI  KQH
Sbjct: 583 KNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQH 642

Query: 764 KQAEGLHAAE----KH-------NIPNSHSPKNEILVPKDDSLYEYHTEEDVMYA 807
           KQAE   AA+    KH        I     P +     KD+SLY+Y TEEDVMY 
Sbjct: 643 KQAEAFSAAQLKGRKHPLAALAREITGEAKPSS-----KDNSLYDYETEEDVMYV 692

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (61%), Gaps = 6/86 (6%)

Query: 40  QKVVSNEPKGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGY 99
           +K+ ++E K   ++ SPFR +  + N      V + K ++FPTVSATS Y+ + PK  G+
Sbjct: 60  KKIAASEAKAMSDYASPFRAEYSNVN------VQNEKTRRFPTVSATSNYTLKNPKQKGF 113

Query: 100 KNIPKNAKRAKDIRFPTYLTKNEERQ 125
             I K    AKDI FP YLT+NE+RQ
Sbjct: 114 TTIKKGQNFAKDIYFPNYLTENEQRQ 139

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  333 bits (854), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/468 (40%), Positives = 289/468 (61%), Gaps = 24/468 (5%)

Query: 344 PIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTK 403
           PIDP+KAP+VPFK +     TG+FALW   T S  Q         P+ATP++PE IV+T 
Sbjct: 320 PIDPNKAPRVPFKAK-----TGVFALW---TRSDKQ-------DQPLATPQDPEYIVRT- 363

Query: 404 EHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSM 463
           + GY+SKA+YDK+ YDE+VHQ  LA    ++  KYDAT   Y+++L  LQ+QIDE++ +M
Sbjct: 364 DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATM 423

Query: 464 KAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTA 523
           + +R +T EKI+VS++ L K+++D+N  H + K +IFK+TEN+K QK+ E+DE+  K   
Sbjct: 424 EQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEE 483

Query: 524 VKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKK 583
           VK+EI+ELN  K  V  EFN++   L +L+ QLD+++ KI ++N KQ ++   I  L +K
Sbjct: 484 VKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQK 543

Query: 584 KEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKT 643
           K ++  +T + ++LH+ +   LES++NKEYLP+IN ID+QV+TLL  +T+I+QENAN+KT
Sbjct: 544 KLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKT 603

Query: 644 ELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEQQITQV 703
           E +AITKRLE+ER+AH                                    HE+++ Q+
Sbjct: 604 EFAAITKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEELRQI 663

Query: 704 KQTYNDQLTXXXXXXXXXXXXXXXXXXXRTRLQGEKAIEEQTRQKSSDEALKQEILGKQH 763
           K+ +   L                    +TRL GEKAI+EQ R + +D ALKQE++ K+ 
Sbjct: 664 KEEHEKALNDANVQLAKEKEEREVVEREKTRLAGEKAIQEQERAQEADLALKQELMEKRR 723

Query: 764 KQAEGLHAAEKHNIPNSHSPKNEIL------VPKDDSLYEYHTEEDVM 805
           KQAE + AAE+    ++   K  +L      + ++ SLY+Y T E+++
Sbjct: 724 KQAEAVDAAEQARKISTQ--KKSVLSNPSQNLTRESSLYDYETVEEII 769

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 59/116 (50%), Gaps = 10/116 (8%)

Query: 38  FLQKVVSNEPKGKE--EWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPK 95
           FL+KVV+N+ K +E  ++ SPFR      +Q   +   + K KKFPTVSATS  +     
Sbjct: 28  FLRKVVTNKKKEEEEKDYSSPFR------SQQELIAAKNVKAKKFPTVSATSGTAS--AA 79

Query: 96  DLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQXXXXXXXXXXXXXXXXXCQKITDL 151
           DLGYK I    +RAKDI  P YL   +E+Q +                  QKI D+
Sbjct: 80  DLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDV 135

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  330 bits (847), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/467 (41%), Positives = 282/467 (60%), Gaps = 33/467 (7%)

Query: 349 KAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAP--------SNPVATPENPELIV 400
           K P++P+ E+P  E    F+ +     ++        P          P+ATPENPELI 
Sbjct: 372 KVPRIPYTEQP--ESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIA 429

Query: 401 KTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIE 460
           KT+E+GY+SK +YDK+ YDE  H+ WL   K  EKAKYD     Y+  L++LQ +ID I 
Sbjct: 430 KTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMIN 489

Query: 461 NSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGK 520
            SM+ ++KET++KIEVS+N LVK+I + NT HN +K  IFK+TEN+KNQK+Q+K E+L K
Sbjct: 490 ESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKEILDK 549

Query: 521 QTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDAL 580
              V+ EI +LN  K  V++EF+ WTTN++ L QQLDA+I K+ QI +KQ + Q EI+ L
Sbjct: 550 HAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKL 609

Query: 581 QKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENAN 640
           + +K++  AQ +  KK HE   + +ES ENKEYLP+I+ IDNQ+S LLN++ II+QENAN
Sbjct: 610 ETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQENAN 669

Query: 641 EKTELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEQQI 700
           E+TELS ITK LE+ERRAH                                   +HE+Q+
Sbjct: 670 EQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKREHEEQV 729

Query: 701 TQVKQTYNDQLTXXXXXXXXXXXXXXXXXXXRTRLQGEKAIEEQTRQKSSDEALKQEILG 760
            ++K+ Y ++L                    +  L+ EK +EE  R    +E +K+E+L 
Sbjct: 730 RKMKEQYENELN--------------NVKKQKESLETEKLVEEHNR----NENIKKEVLD 771

Query: 761 KQHKQAEGLHAAEKHNIPNSHSPKNEILVPKDDSLYEYHTEEDVMYA 807
           KQ KQAE  HAA+  +I  + +  N++   +D+SLYE+ TEE++MY 
Sbjct: 772 KQRKQAEAQHAAQTKSIATNAA--NDM---QDNSLYEFKTEEEIMYV 813

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 53/98 (54%), Gaps = 8/98 (8%)

Query: 54  VSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIR 113
           V+PF         N   Y  +AK  KFPTVSATSA + Q PK+LG+K + K+ KRAKDI+
Sbjct: 105 VNPFT--------NKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIK 156

Query: 114 FPTYLTKNEERQYQXXXXXXXXXXXXXXXXXCQKITDL 151
           FP YLT+NE RQ                    QKI DL
Sbjct: 157 FPVYLTENEFRQQTILKELELKEGKLQYLKDSQKIIDL 194

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  275 bits (704), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 177/479 (36%), Positives = 262/479 (54%), Gaps = 27/479 (5%)

Query: 344 PIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVT-----APSNPVATPENPEL 398
           PIDP   P V F+            L   P ++  +K  V         NP ATP + E 
Sbjct: 190 PIDPKLTPMVSFQ------------LSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEE 237

Query: 399 IVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDE 458
           IVKTK+ G LSK++YD++ YD++ H+ +LA  KA+ + KYD     Y   L+ L  +I  
Sbjct: 238 IVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVA 297

Query: 459 IENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVL 518
               ++  +K+T  K+++    LVK++ D  +   + K+ IF +T+ +K +K+ EK  V 
Sbjct: 298 SNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVE 357

Query: 519 GKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEID 578
                V  EID+LN  K  V  EFN+WT N++N+++QLDA++FKI QIN+ Q  +QN+ID
Sbjct: 358 ELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKID 417

Query: 579 ALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQEN 638
            L  +K  L  + E NK  H  NV+T+E+V+NK+YLP++N+ID+Q++ LLN++T+I+QEN
Sbjct: 418 GLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQEN 477

Query: 639 ANEKTELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEQ 698
           ANEK +LS +T++LE ER  H                                   +HE 
Sbjct: 478 ANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHET 537

Query: 699 QITQVKQTYNDQLTXXXXXXXXXXXXXXXXXXXRTRLQGEKAIEEQTRQKSSDEALKQEI 758
           ++T +K +Y  QL                    ++RL+G KAIE+Q RQK SD  LK EI
Sbjct: 538 EMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEI 597

Query: 759 LGKQHKQAEGLHAAEKHNIPNSHSPKNEILV----------PKDDSLYEYHTEEDVMYA 807
           L KQH+QAE  +A +      + SP  E L+           KDDSL+EY TEE++MY 
Sbjct: 598 LSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 71/130 (54%), Gaps = 18/130 (13%)

Query: 11  DPFTQLIXXXXXXXXXXXXXXXXKPYQFLQKVVSN---------------EPKGKEEWVS 55
           DPF  L+                    FLQ+V+S+               +    EE++S
Sbjct: 11  DPFEHLLNPQPKTTGSSDSSRPRSSSLFLQRVISSTSSIQKTPTTSSSSKKKVSTEEYLS 70

Query: 56  PFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFP 115
           PFR + ++   NN+ Y+ + K K+FPTVSATS Y+ +  K++G+K IPK+   AKDI FP
Sbjct: 71  PFRSNLVT---NNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFFP 127

Query: 116 TYLTKNEERQ 125
           +YLT+NE+RQ
Sbjct: 128 SYLTQNEQRQ 137

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  257 bits (657), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 159/458 (34%), Positives = 247/458 (53%), Gaps = 78/458 (17%)

Query: 344 PIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTK 403
           P D  + P+VPF        TGIFALW    + S ++G       PVA+P +PE IVK  
Sbjct: 348 PKDIKETPRVPFA-------TGIFALW----TRSDKRG------QPVASPNDPEFIVKF- 389

Query: 404 EHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSM 463
           + GY+SKA+YD + Y+E +H+  + D   +  AKY+A +  Y +RL  L++QI E+E +M
Sbjct: 390 DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATM 449

Query: 464 KAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTA 523
           + ++K+T+EKIE+S+ +L  Q+ID+N  H++ K +IFK+TENMK  K++EK+ V  KQ  
Sbjct: 450 ETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQED 509

Query: 524 VKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKK 583
           VK+E++EL   +  +  E  +    +  L+ +LDA++  I ++N +Q+++Q  ID LQ++
Sbjct: 510 VKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQ 569

Query: 584 KEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKT 643
           K+ LI++     + H  NV  LES+ENKEYLP++N ID ++S LL  +T+++QE AN KT
Sbjct: 570 KDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKT 629

Query: 644 ELSAIT---------------------KRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXX 682
           E +A++                     KRLE ER                          
Sbjct: 630 EFAAVSKRLEEEDEERKEKLRQEEENRKRLEAER-------------------------- 663

Query: 683 XXXXXXXXXXXXDHEQQITQVKQTYNDQLTXXXXXXXX-------XXXXXXXXXXXRTRL 735
                       +H+QQI  ++Q +  QL                           R +L
Sbjct: 664 ------LQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQALLKEREQRELVERERVKL 717

Query: 736 QGEKAIEEQTRQKSSDEALKQEILGKQHKQAEGLHAAE 773
           QGEKAI EQ   K++D+AL++EI  + H +A  L  AE
Sbjct: 718 QGEKAIREQEEAKAADKALEEEIKQRNHSRALALDGAE 755

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 56/115 (48%), Gaps = 11/115 (9%)

Query: 38  FLQKVVSNEPKGKEEWVSPFR-QDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKD 96
           FL KVVS E + +  + SPFR   +L+  Q  ++       +KFPTVSA+ +       D
Sbjct: 27  FLHKVVSKE-QEQSAYNSPFRTSQSLAAAQKRKM-------QKFPTVSASVSAHSS--SD 76

Query: 97  LGYKNIPKNAKRAKDIRFPTYLTKNEERQYQXXXXXXXXXXXXXXXXXCQKITDL 151
           +GYK I    +RAKDI  P YL  N+ERQ +                  Q+I D+
Sbjct: 77  MGYKVIDAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  236 bits (602), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 145/412 (35%), Positives = 215/412 (52%), Gaps = 59/412 (14%)

Query: 394 ENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQ 453
           ENPE +VKTK+ GYL+K +YDKI   ++ H  W+A  K  E+ K+D      + ++  L+
Sbjct: 346 ENPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 454 NQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQE 513
            QI EI+N M  +R +T  KIEVS+N L ++  ++   H  KK  +FKDTE +K+QKL E
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 514 KDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKV 573
           KD VL KQ  V+ EIDELN  K  V++E   WT ++  LS ++DA++  + ++N+KQ   
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 574 QNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTI 633
           Q EI+ LQ++K D++ Q E+N   H  N + +E  +NK YLP++N++DNQ+S LL ++T 
Sbjct: 525 QEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTT 584

Query: 634 IRQENANEKTELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 693
           IRQ  ANE+TELSAITK+L+ ER  H                                  
Sbjct: 585 IRQHCANERTELSAITKKLDKERLEHEEKLKLEAENRRRKEEDLLGKQRKELEAKAQEAR 644

Query: 694 XDHEQQITQVKQTYNDQLTXXXXXXXXXXXXXXXXXXXRTRLQGEKAIEEQTRQKSSDEA 753
             HEQ++ ++K  Y                         T+L+G+   E+Q +       
Sbjct: 645 EKHEQEMQKLKTDY-------------------------TQLEGKFKREQQQK------- 672

Query: 754 LKQEILGKQHKQAEGLHAAEKHNIPNSHSPKNEILVPKDDSLYEYHTEEDVM 805
                               K  +  +H P       KDDSLYEY TEE+++
Sbjct: 673 --------------------KDALAFAHEPT------KDDSLYEYGTEEEIL 698

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (61%), Gaps = 10/81 (12%)

Query: 49  GKEEWVSPFR--QDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNA 106
           G+ ++VSPFR  Q+ LS  +         + ++FPT SA SAY   +P++LGYK I    
Sbjct: 36  GERDYVSPFRDEQEVLSAQRR--------RTQRFPTTSAASAYVNARPEELGYKKIGAGE 87

Query: 107 KRAKDIRFPTYLTKNEERQYQ 127
           KRAKDI FP YL + E++Q +
Sbjct: 88  KRAKDISFPVYLEEIEKKQLE 108

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  237 bits (604), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 167/494 (33%), Positives = 264/494 (53%), Gaps = 36/494 (7%)

Query: 344 PIDPSKAPKVPFKERPKKER-----------TGIFALWKS---PTSSSA----QKGGVTA 385
           P D + AP+VPF      +            +G+FAL+K    P SS+        G   
Sbjct: 379 PPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAAGTVV 438

Query: 386 PSN--PVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATST 443
           P +  PVATPE+PELIV+T+E GY+SK+VYDK+ YDE  HQA LA    ++  +Y+  + 
Sbjct: 439 PGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497

Query: 444 GYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDT 503
            Y E++Q +Q +I E++  M+ +R E  EK+++ +    + +++ N  H N K  ++K T
Sbjct: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557

Query: 504 ENMKNQKLQEK-DEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFK 562
           E +KNQ + +K D+ +  QT V+SEIDEL   K  V KE  +  + +  L+ +LD +   
Sbjct: 558 EEIKNQTISDKEDKEVAHQT-VQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSA 616

Query: 563 INQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDN 622
           +N+   K+ +   EI AL+++K  L  + +E ++LH++NV  +ES++NKEYLP++N+I+ 
Sbjct: 617 LNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINT 676

Query: 623 QVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXX 682
           ++S+LL  + +I+QE AN+K E S++T+RLE+ER+ H                       
Sbjct: 677 EISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEKQR 736

Query: 683 XXXXXXXXXXXXDHEQQITQVKQTYNDQLTXXXXXXXXXX-------XXXXXXXXXRTRL 735
                        HE+++  +KQT+++ L                           RTRL
Sbjct: 737 TEYEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERERTRL 796

Query: 736 QGEKAIEEQTRQKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNSHSPKNEILVP----K 791
           QGEKAIE Q R    D+ L+ E   K  +QAE   A E  N   S + K +  VP     
Sbjct: 797 QGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVE--NALKSSNKKTKAAVPPANTT 854

Query: 792 DDSLYEYHTEEDVM 805
           + SLY+Y T E+V+
Sbjct: 855 NSSLYDYETVEEVI 868

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 60/156 (38%), Gaps = 15/156 (9%)

Query: 2   LFNTNRQDEDPFTQLIXXXXXXXXXXXXXXXXKPYQFLQKVVSNEPKGKEE-----WVSP 56
           LF   R + DPF  L+                     L++V + + + +EE     + SP
Sbjct: 6   LFR-KRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNEYHSP 64

Query: 57  FRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIP-KNAKRAKDIRFP 115
           FR       Q  R      + +KFPT+S  +   +  P+ +GY  +  K+ K+AKDI  P
Sbjct: 65  FR--TAEETQRAR----QVRQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAKDIIIP 116

Query: 116 TYLTKNEERQYQXXXXXXXXXXXXXXXXXCQKITDL 151
           + L   E  Q                    QKI DL
Sbjct: 117 SGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDL 152

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  230 bits (586), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 205/317 (64%), Gaps = 6/317 (1%)

Query: 344 PIDPSKAPKVPFKE-RPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKT 402
           PI+P +AP +     +P+   TGI A++K  +SS+ Q        NP+++PENPE ++KT
Sbjct: 314 PINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQ----PVSKNPMSSPENPEYVIKT 369

Query: 403 KEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENS 462
           K+HGYLSKAVYDK+ YD+ VHQ WL +L+  E+ KY    T Y + L D+Q++ID I + 
Sbjct: 370 KQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDL 429

Query: 463 MKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQT 522
           M  ++ +TS+KIEV + +LVK I+D+   HN+ K  IFK+TE MK +KL  K + + KQ 
Sbjct: 430 MDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQA 489

Query: 523 AVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQK 582
            ++ EI+ L+  +T V  +FN+W + L+ ++ QLDA+I  I   N ++  ++ E+  L  
Sbjct: 490 EIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNI 549

Query: 583 KKEDLIAQTEENKKLHERNVQTLESVE-NKEYLPQINDIDNQVSTLLNKMTIIRQENANE 641
            K +L  + ++N+++H+ N + L  +   K YLP+IN+IDN+++  L K++ I++E   E
Sbjct: 550 SKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEE 609

Query: 642 KTELSAITKRLEDERRA 658
              L+ +TK+LEDER A
Sbjct: 610 NNRLTILTKKLEDERIA 626

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/92 (46%), Positives = 59/92 (64%), Gaps = 5/92 (5%)

Query: 34  KPYQFLQKVVSNEPKGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQ 93
           + +  L+KVVS +     E+VSPFR  +  +  N   Y    K ++FPTVSA+S +S+  
Sbjct: 21  RSHSMLKKVVSRDHNV--EYVSPFRDPSNVQAAN---YAKAKKMERFPTVSASSHFSRMS 75

Query: 94  PKDLGYKNIPKNAKRAKDIRFPTYLTKNEERQ 125
           P +LGYKNI K+ KRAKDI FP++L  NE RQ
Sbjct: 76  PNELGYKNISKSTKRAKDISFPSFLIANERRQ 107

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  232 bits (592), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 202/317 (63%), Gaps = 9/317 (2%)

Query: 344 PIDPSKAPKV-PFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKT 402
           P+D +  P+V  F E  KK    IF+++     S  +     AP NP+ATPENPE++VKT
Sbjct: 450 PVDYAAVPRVVTFPEVEKKR--SIFSIFGRKKKSQNR-----AP-NPLATPENPEILVKT 501

Query: 403 KEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENS 462
              G+LSKAVYDK+ Y+   H  WL +  + EK +Y+     Y  RL++L+ +++++E S
Sbjct: 502 DREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEES 561

Query: 463 MKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQT 522
           M+ ++ + +E IE+   RL K+ ++    +  KK  IF +T+ +++QK +E DE+  +Q 
Sbjct: 562 MQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQE 621

Query: 523 AVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQK 582
            V+ EI  LN+ K N+ +EF  WT  L++ S  LDA+++ ++ +  K +K Q +ID L  
Sbjct: 622 EVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSH 681

Query: 583 KKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEK 642
           KK  L  +   +K+ H +N + +E   NKEYLP++++ID+++S LL ++++I+QE+ANEK
Sbjct: 682 KKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEK 741

Query: 643 TELSAITKRLEDERRAH 659
            +L +ITK+LE ER+AH
Sbjct: 742 LKLGSITKKLESERQAH 758

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 6/76 (7%)

Query: 52  EWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKD 111
           E+ SPFR ++  ++   R      + ++FPTVS  S +SK  PK+LGY+ + + ++RAKD
Sbjct: 68  EFASPFRLESNEKDAEKR------RLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKD 121

Query: 112 IRFPTYLTKNEERQYQ 127
           I+FP YL +NE RQ Q
Sbjct: 122 IQFPIYLRENEARQDQ 137

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  227 bits (579), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 157/492 (31%), Positives = 255/492 (51%), Gaps = 78/492 (15%)

Query: 351 PKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYLSK 410
           P+VPF        TGIFALW    + S ++G       PVA+P++PE IVK  + GY+SK
Sbjct: 327 PRVPFA-------TGIFALW----TRSDKRG------QPVASPDDPEFIVKF-DKGYMSK 368

Query: 411 AVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKET 470
           A+YD + Y+E VH+  +     +   KYDA +  Y + L  L++QI E+E +M+ ++ +T
Sbjct: 369 ALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDT 428

Query: 471 SEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDE 530
           ++KI +S   L  ++I+ N  H+N K +IFK+TEN K  K+ EK  V+ KQ  VK+E +E
Sbjct: 429 TDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEE 488

Query: 531 LNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQ 590
           L + +        +  + +  L+ QLD++   I ++N +Q+++Q  IDAL+++K+ L+A 
Sbjct: 489 LEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548

Query: 591 TEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAIT- 649
                +LH  N+  LE + NK+YLP+IN +D+Q+S LL+ + +++QE AN+ TE +A++ 
Sbjct: 549 ATAADELHNSNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVSK 608

Query: 650 ------------KRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHE 697
                        RLE+E R                                     +H+
Sbjct: 609 RLEEENEERKEKLRLEEENRKR------------------------LEAERFQKQRDEHD 644

Query: 698 QQITQVKQTYNDQLTXXXXXXX-------XXXXXXXXXXXXRTRLQGEKAIEEQTRQKSS 750
           Q +  ++Q +  QL                           R RLQGEKAI+EQ + K +
Sbjct: 645 QHVLTLQQEHERQLAEASQKAADTELLLQQEREKRELVERERVRLQGEKAIQEQEQAKLA 704

Query: 751 DEALKQEILGKQHKQAEGLH-----------AAEKHNIPNSHSPK-NEILVPK----DDS 794
           D+AL+ E+  + H +A+ +            +   +N P   +PK +E L  K    D+S
Sbjct: 705 DKALEDEVKERNHNRAQAIDAAEAARARNAKSISNNNAPALSTPKEDEKLNIKDATTDNS 764

Query: 795 LYEYHTEEDVMY 806
           LYEY TE++V Y
Sbjct: 765 LYEYFTEKEVRY 776

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 9/88 (10%)

Query: 38  FLQKVVSNEPKGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDL 97
           FL+KVV+ E +    + SPFR         +++     K ++FPTVSA+S  +     ++
Sbjct: 26  FLRKVVTKEQEDAT-YSSPFR------TSQSQVEAQKRKVQRFPTVSASSGGNSS--AEM 76

Query: 98  GYKNIPKNAKRAKDIRFPTYLTKNEERQ 125
           G+K I    KRAKDI  P YL  N+ERQ
Sbjct: 77  GFKVIDAARKRAKDIAVPRYLQGNDERQ 104

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  209 bits (533), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/337 (39%), Positives = 204/337 (60%), Gaps = 22/337 (6%)

Query: 343 APIDPSKAP--KVP-----FKERPKKERT-GIFALWKSPTSS--SAQKG------GVTAP 386
            PIDPS  P  ++P         PK   T  I +L      S  +A+ G      GV  P
Sbjct: 251 GPIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVP 310

Query: 387 -SNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGY 445
            ++ VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+     Y
Sbjct: 311 ETHAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY 370

Query: 446 SERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTEN 505
            ++L +LQ Q+D+IE   K    +  +KIE+ + +LVK ++DV + +N  K  + K+TE 
Sbjct: 371 EDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETEL 430

Query: 506 MKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQ 565
           MK QK+  K+++L KQ  VK+EI++LN+ K  +  E+N W  NL NL+  LD +I KI  
Sbjct: 431 MKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEA 490

Query: 566 INLKQSKVQNEIDALQKKKEDL---IAQTEENKKLHERNVQTLESVENKEYLPQINDIDN 622
           IN    ++Q +I+ LQ KK +L   I   EE  KL++  +Q L +VE K+YLP++N+ID 
Sbjct: 491 INENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL-NVE-KDYLPRLNEIDE 548

Query: 623 QVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAH 659
           Q++   +K+ II+ E  +E  +LS +TK+LE+ER AH
Sbjct: 549 QIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/92 (46%), Positives = 58/92 (63%), Gaps = 8/92 (8%)

Query: 38  FLQKVVSNEPKGKEEWVSPFR--QDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPK 95
           FL + +S + +  E ++SPFR  QD +  N     Y    K KKFPT SATS ++K  P 
Sbjct: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN-----YAKSLKEKKFPTTSATSNFNKMVPG 76

Query: 96  DLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQ 127
           ++GY ++ KN KRAKDI+FP YL  NE+RQ Q
Sbjct: 77  EMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQ 108

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  147 bits (371), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 94/305 (30%), Positives = 169/305 (55%), Gaps = 18/305 (5%)

Query: 349 KAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYL 408
           K  + PFK   K    GIFALWK              P    ATPE+PE IV T E GY+
Sbjct: 295 KGHRGPFKFSKK----GIFALWKRSEK----------PEKLNATPEDPEFIVLT-EKGYM 339

Query: 409 SKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRK 468
           SK +YD++ Y+E++HQ  LA L     AKY+ T+  Y E+L  L N+I E+  +M  ++ 
Sbjct: 340 SKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKS 399

Query: 469 ETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEI 528
           +T  +++  +  L + ++D+   H+ +K  + K+ EN KN K+ EK+ +  K T V+ E+
Sbjct: 400 QTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPEL 459

Query: 529 DELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLI 588
           + L   +   + E   + + +  L+ +LDA++ ++  ++ +Q++V   + AL++++  + 
Sbjct: 460 EALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIE 519

Query: 589 AQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAI 648
               E+  +   N + L+++EN    P I  +DNQVS +   ++ + QE+A +K EL+ +
Sbjct: 520 KDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTEL 576

Query: 649 TKRLE 653
           + + E
Sbjct: 577 STKKE 581

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 187/324 (57%), Gaps = 19/324 (5%)

Query: 342 KAPIDPSKAPKVPFKER------PKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPEN 395
           + P+DP+  PK+           P     G+         S+ Q+   T  +NP AT + 
Sbjct: 254 RKPVDPATQPKLYVDLDSLQLIDPGSTAVGV---------STKQRLMDTPVTNPQATEDT 304

Query: 396 PELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQ 455
           PEL++K  ++G++S AV++K+ YD+KVH+A +AD + ++++K+      Y ++L  + ++
Sbjct: 305 PELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDR 364

Query: 456 IDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKD 515
              +   M   + +   K EV +N+ +KQ+ D N   N+ K+ +  + + +K QKLQ+  
Sbjct: 365 KLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQKLQDLK 424

Query: 516 EVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQN 575
            +  K+T ++ E+++L   K++ +K+++ WTTNL+N++++LDAQ+FK++Q N KQ K+  
Sbjct: 425 FISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITR 484

Query: 576 EIDALQKKKEDLIAQTEEN---KKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMT 632
           +I  L ++K +L A+ + N   K   +RN+  LE+ ++ +   ++  + + +   L+ + 
Sbjct: 485 QIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKS-HELVKVTDSIQGKLDSLA 543

Query: 633 IIRQENANEKTELSAITKRLEDER 656
           +++QE + E+ +L  IT  +E  R
Sbjct: 544 VVKQEISGERLKLIGITNEMERAR 567

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 2/100 (2%)

Query: 51  EEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAK 110
           EE+VSPFR   L++    +L +   + KKFPTVSATS Y+    ++LG+  +  + +RA+
Sbjct: 46  EEYVSPFRGGQLTKASKKQLQLQ--RTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRAR 103

Query: 111 DIRFPTYLTKNEERQYQXXXXXXXXXXXXXXXXXCQKITD 150
           DI FP YL +NE+RQ                   CQ + D
Sbjct: 104 DIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score =  118 bits (295), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 156/274 (56%), Gaps = 13/274 (4%)

Query: 382 GVTAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDAT 441
             T    PVA+PEN E +VK      +SK VYDKI +D KV+  ++   +  +  K +  
Sbjct: 240 STTESKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKL 299

Query: 442 STGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFK 501
            + Y+E+++ +Q +  +  N ++ +  E+    EV +N+LVK ++D     ++ K+ I +
Sbjct: 300 KSEYNEKIKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILR 359

Query: 502 DTENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIF 561
            T  +K QKL E   +  K+  ++ E + +N  K + +  FN    +L+ + Q+LDA++F
Sbjct: 360 KTGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLF 419

Query: 562 KINQINLKQSKVQNEIDALQKKKEDLIAQTE--ENKKLH-ERNVQTLESVENKEYLPQIN 618
           K++Q N++   +++EI+ LQ KK+ L+ + +  E KKLH + + + LE          +N
Sbjct: 420 KLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LN 469

Query: 619 DIDNQVSTLLNKMTIIRQENANEKTELSAITKRL 652
           ++D Q+++ L+ + +I+QE  NEK ++S +T  L
Sbjct: 470 EMDEQINSKLSNLNLIKQEIINEKLKISKLTNDL 503

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 58/97 (59%), Gaps = 7/97 (7%)

Query: 34  KPYQFLQKVVSNEPKGKEE---WVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYS 90
           K +QFL KV +N+ K  ++   + SPFR +A SR Q  +L   D K  KFP VSATS Y+
Sbjct: 29  KKHQFLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQL--QDLKTAKFPLVSATSTYN 86

Query: 91  KQQPKDLGYKNIPKNAKRAKDIRFPTYLTKNEERQYQ 127
               KD+ YK++      A+DI+FP+ L  NE RQ Q
Sbjct: 87  -TDTKDV-YKDLDPKKNFARDIKFPSRLIDNENRQNQ 121

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score =  102 bits (255), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 141/263 (53%), Gaps = 1/263 (0%)

Query: 389 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSER 448
           P  TPE PE+++ T   GY+SKAVYD++N +EK H   L +        Y   S  Y + 
Sbjct: 279 PNGTPEEPEVVLLTN-RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337

Query: 449 LQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKN 508
           + DL  +I ++   + A++ ET  +I+  +  L K I D+   + +K+ ++ +  E  + 
Sbjct: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRA 397

Query: 509 QKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINL 568
           ++L +K+E++ +   ++ EID L   K N   E  +    +  L QQLDAQ  ++  +  
Sbjct: 398 EQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457

Query: 569 KQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLL 628
           +Q++V   +  LQ++K  L  +  ++ +  +RN + LE +   +Y   + +ID + S +L
Sbjct: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEIL 517

Query: 629 NKMTIIRQENANEKTELSAITKR 651
            ++  IRQE   ++ EL A+ +R
Sbjct: 518 TEIAKIRQEIEFQRKELVALKER 540

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 7/94 (7%)

Query: 35  PYQFLQKVVSNEP---KGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSK 91
           P   LQ  +++     KGK+ + SPFR      N N  L     KN ++PT+SATS YS 
Sbjct: 36  PSDVLQTAINSHTLHGKGKQ-YKSPFRDTQTPSNMNVAL---KKKNHRYPTISATSPYSN 91

Query: 92  QQPKDLGYKNIPKNAKRAKDIRFPTYLTKNEERQ 125
             P+DLGYKNI  + KRAKDI FP  L +NE RQ
Sbjct: 92  MTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQ 125

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 108/206 (52%), Gaps = 28/206 (13%)

Query: 388 NPVATPENPELIVKTKEHG---YLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTG 444
           NP ATP+NPEL+VKT+ +     LSK+VYD +NY+ KVH   + D         + ++  
Sbjct: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDY-------INDSNIK 428

Query: 445 YSERLQDLQNQIDEIENSMKAMRKETSE---KIEVSKNRLV-KQIIDVNTAHNNKKLMIF 500
           Y E+ ++  N I+E++  +K++ K+  +   KI+   N  V K  ID+   H  +K++I 
Sbjct: 429 YKEKNEEFNNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYH--EKMLI- 485

Query: 501 KDTENMKNQKLQEKDEVL------GKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQ 554
                 KNQ +++ DE+           A+  +  +  + +++      DW +  S L++
Sbjct: 486 -----KKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNE 540

Query: 555 QLDAQIFKINQINLKQSKVQNEIDAL 580
           Q+D+++  I Q+N   + V+ +I  L
Sbjct: 541 QIDSKVNVIKQLNKNLADVKQKITEL 566

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 74/169 (43%), Gaps = 24/169 (14%)

Query: 342 KAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVK 401
           + P+D  K PK+P+ E  +                           NPVATPE PE +V 
Sbjct: 94  REPVDIQKVPKIPYSEYGQCNEAEF--------------------RNPVATPETPEEVVI 133

Query: 402 TKE----HGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQID 457
            K     +   SK ++D I  D   H AWL   + K   +       Y+++L  L +QI 
Sbjct: 134 YKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIK 193

Query: 458 EIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENM 506
             + +M  +R++    I++++NRL K  +        +K  I+K+TE +
Sbjct: 194 SEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETERL 242

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 76  KNKKFPTVSATSAYSKQQPKDLGYKN-IPKNAKRAKDIRFPTYLTKNEERQ 125
           K K  P  +  S+Y+  +P++LGYK   PK  K A++I FP  LT+NE RQ
Sbjct: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQ 57

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 81/174 (46%), Gaps = 23/174 (13%)

Query: 344 PIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPE-LIVKT 402
           PI+    PK+P            +   K P +   +        N +ATP+N E +IV  
Sbjct: 156 PINIYSVPKIP-----------SYVFTKVPGNKKKE------LKNSLATPQNKEQVIVLR 198

Query: 403 KEHG---YLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEI 459
           K+ G   Y SK V+D I Y+ K+H   L  L AK   ++ +    Y  ++ +L  +ID I
Sbjct: 199 KKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKID-I 257

Query: 460 EN-SMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQ 512
           EN  ++ +  + S   + S  +  K  +   T +NN K  ++ + E +KNQ+ Q
Sbjct: 258 ENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEAIKNQRNQ 311

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 10/91 (10%)

Query: 38  FLQKVVSNEPKGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDL 97
           FL+  ++++ K    + SPFR++    N N   Y+ + KN K+   +  S ++K     +
Sbjct: 28  FLKDTIAHDAK----YQSPFRRNI---NPNYLNYIREHKNAKYTITNPNSDFNKLNLNTV 80

Query: 98  GYKNIP---KNAKRAKDIRFPTYLTKNEERQ 125
           GYK IP   K+ K AKDI FP  L +NEE Q
Sbjct: 81  GYKTIPTDRKSRKIAKDIDFPRSLRENEEAQ 111

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 69/137 (50%), Gaps = 10/137 (7%)

Query: 373 PTSSSAQKGGVTAPS--NPVATPENPELIVKTKEH--GYLSKAVYDKINYDEKVHQAWLA 428
           PT       G+  PS   P+ATP+NPE++V+  E+    +SK  YD++   +  H AWL 
Sbjct: 162 PTEQEQFHRGMNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLK 221

Query: 429 DLKAKEKAKYDATSTGYSERLQDLQNQI---DEIENSMKAMRKETSEKIEVSKNRLVKQI 485
              A+  A Y+     Y +++  L  +I    E+ N ++A     S   E++KN+ + + 
Sbjct: 222 SYNAENMANYNQRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVS---EINKNKALVKR 278

Query: 486 IDVNTAHNNKKLMIFKD 502
             +N     +K+++ K+
Sbjct: 279 FQINKLIGEEKILLMKN 295

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 56/113 (49%), Gaps = 1/113 (0%)

Query: 388 NPVATPENPELIVKTKE-HGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYS 446
           NP+AT  NPE+++K  +    ++K  YDK+    + H  W+ +   +    Y+     Y 
Sbjct: 383 NPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQ 442

Query: 447 ERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMI 499
           E+L  L  QI+     +  ++K+T +  E++   L  +   + +  N++K ++
Sbjct: 443 EKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEKYVL 495

>TDEL0F04750 Chr6 complement(893402..895519) [2118 bp, 705 aa] {ON}
           Anc_8.351 YDR164C
          Length = 705

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 471 SEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDE 530
           S+ IE+ + +L+  I D+ T HN K L+I    EN+ N    E  ++L   TAV    D 
Sbjct: 2   SDLIELQREQLLGVINDIKTEHNVKFLVIDDYFENLLNYLFDEPQQLLRHVTAV----DR 57

Query: 531 LNSAKTNVQ 539
           ++S K N Q
Sbjct: 58  IDSPKRNGQ 66

>KNAG0F00130 Chr6 complement(7147..8238) [1092 bp, 363 aa] {ON}
           Anc_1.19 YDR532C
          Length = 363

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 58/102 (56%), Gaps = 7/102 (6%)

Query: 482 VKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVL-GKQTA-VKSEIDELNSAKTNVQ 539
           + Q +    + N+K+++  K   +MK + L+ + ++L G++ A  +SE+D L S+ TN+ 
Sbjct: 97  LDQFLRYTISSNDKEVLGLKSIHDMKYESLKNQIKILEGERLAETRSEVDALRSSITNLS 156

Query: 540 KEFNDWTTNLSNLSQQLDAQIFKINQI-----NLKQSKVQNE 576
           K  ++   ++ ++S+Q  AQI    ++      LK+ K++ E
Sbjct: 157 KTISNSERDILSISKQTSAQIDSCFELLKERDTLKRMKIETE 198

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 66/133 (49%), Gaps = 15/133 (11%)

Query: 529 DELNSAKTNV----QKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKK 584
           DEL+  K +V    ++ + DW       S +    IF +N +     K   EI A ++++
Sbjct: 241 DELSFRKGDVIRVMEQVYRDWWRG----SLRGKIGIFPLNYVTPVTDKTLEEICAEKRQE 296

Query: 585 EDLIAQTEENKKLHERNVQTLESVENKEYL---PQINDIDNQVSTLLNKMTIIRQENANE 641
           + +++Q  +  +LH    QT+ +  N   L   PQ+ND+ + V+ L  ++T +    A +
Sbjct: 297 DAILSQYNKVNELH----QTMRAGSNDVNLTQDPQVNDLYSTVTPLRPQLTKMIGTCAQK 352

Query: 642 KTELSAITKRLED 654
           + + S++ K L D
Sbjct: 353 REDYSSLRKVLAD 365

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 118/231 (51%), Gaps = 24/231 (10%)

Query: 429  DLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDV 488
            ++KA E  K +A S       ++L+N++D+++N  K++ ++ ++ +E  K R+++   + 
Sbjct: 1144 NIKALEHQKKEAISNS-----KELENELDQLKNKHKSLDEQNTKSVEELKTRVLEVEKER 1198

Query: 489  NTAHNNKKLMIFKDTENMKN----QKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFND 544
            +  HNN + +  K  E  K+    QK QE ++   K   ++ ++D L   K ++  E N+
Sbjct: 1199 DEKHNNVQKIENKLQEESKSLESLQKSQESNK--SKLKVLQDKLDSLLQEKNDLVSEKNN 1256

Query: 545  WTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKK-------KEDLIAQTEENKKL 597
               N + + +  +    KI+ +   + K  +E+  LQKK       K+  IA  E +++ 
Sbjct: 1257 LKENFAKVKEDFEESQRKIHGLKESEKKKNHELHELQKKFKGELDVKQKQIADLERSREE 1316

Query: 598  HERNVQTLE------SVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEK 642
             ++N++ L+      S ENK+ + ++      +S  LNK+    +EN +++
Sbjct: 1317 VDKNLKNLQVDVKNVSEENKKVIEKLEKEKEALSLELNKLRKSSKENLDDR 1367

>NDAI0J00830 Chr10 (185771..185801,185919..188014) [2127 bp, 708 aa]
           {ON} Anc_8.351 YDR164C
          Length = 708

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 471 SEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDE 530
           S  I++ +N L+  ++++ T HN K L+I +  EN+ N   Q   E+L   T V    D 
Sbjct: 2   SNLIDLQRNYLIDLLVNIQTNHNIKFLVIDEYAENIINFLFQNPKELLTYVTTV----DR 57

Query: 531 LNSAK 535
           ++S K
Sbjct: 58  IDSPK 62

>KNAG0M02260 Chr13 complement(417569..420112) [2544 bp, 847 aa] {ON}
           Anc_2.590 YKL050C
          Length = 847

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 99/186 (53%), Gaps = 25/186 (13%)

Query: 448 RLQDLQNQIDEIENSMKAMRKETS------EKIEVSKNRLVKQIIDVNTAHNNKKLMIFK 501
           R +D+    DE EN +K  R + +      E +  + + + ++I+ +N+   + K  I +
Sbjct: 509 REKDIDVARDEQENLLKPYRDDLAAAETEQEALITNYDAINEEIVRLNSVVKHHKSKIEE 568

Query: 502 DTENMKNQKLQEK------DEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQ- 554
            T  +++Q  +E+      D++ G +  +++++DE    + N  +E  +  T  + L Q 
Sbjct: 569 YTGTLESQGTREQRELTLIDDLDGNRGELETDMDEQLIIRANKAREEAELATKEARLKQL 628

Query: 555 QLDAQI----FKINQ--INLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESV 608
           +++A I     ++NQ  I+L++ K+ N ++A+Q     L+A+   ++KL E  ++TL  +
Sbjct: 629 EVEAAINERRTELNQTDIDLQKEKL-NLLEAMQ-----LVAEARGDEKLDEERIKTLFGM 682

Query: 609 ENKEYL 614
            ++EY+
Sbjct: 683 TSEEYI 688

>NCAS0I02930 Chr9 (541697..544243) [2547 bp, 848 aa] {ON} Anc_1.163
           YJL176C
          Length = 848

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 5/64 (7%)

Query: 562 KINQINLKQSKVQNEIDALQKKKEDLIAQ----TEENKKLHERNVQTLESVENKEYLPQ- 616
           K+N IN  +  ++ E   L++++EDL+ Q     + +KKL E+   +LES +NKE L Q 
Sbjct: 731 KMNLINKLEKTMELEKKVLERQQEDLLIQRLTFNKNSKKLLEKFQSSLESFDNKEILEQN 790

Query: 617 INDI 620
           IN+I
Sbjct: 791 INEI 794

>KLTH0G11550g Chr7 (971803..971833,971902..973976) [2106 bp, 701 aa]
           {ON} similar to uniprot|P38932 Saccharomyces cerevisiae
           YGL095C VPS45 Protein of the Sec1p family essential for
           vacuolar protein sorting required for the function of
           both Pep12p and the early endosome/late Golgi SNARE
           Tlg2p
          Length = 701

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 471 SEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDE 530
           S+ IE+ +N ++  I D+ T HN K L+I      + +    +K+E+L   TA    ID 
Sbjct: 2   SDLIELQRNYILSFINDIKTEHNLKFLIIDDCVNALLDSLFADKNELLRAVTA----IDL 57

Query: 531 LNSAK 535
           ++S+K
Sbjct: 58  IDSSK 62

>KLTH0F12144g Chr6 complement(1023571..1026102) [2532 bp, 843 aa]
           {ON} weakly similar to uniprot|P53253 Saccharomyces
           cerevisiae YGR089W NNF2 Protein that exhibits physical
           and genetic interactions with Rpb8p which is a subunit
           of RNA polymerases I II and III computational analysis
           of large- scale protein-protein interaction data
           suggests a role in chromosome segregation
          Length = 843

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 7/109 (6%)

Query: 504 ENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKI 563
           + ++ + LQ+KD  L  Q        E    +T ++ E  +++T LS L Q+L     K 
Sbjct: 713 QQVEREHLQQKDRHLRNQM-------EYGKLQTTLEIELEEYSTKLSKLEQELTQLKSKR 765

Query: 564 NQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKE 612
           +++++KQ K++ E+    +  E+L AQ  + +K      + L  VE  E
Sbjct: 766 DKVSMKQEKLKKEVTQCTEDMENLKAQFLQQRKQDRERREELRVVEANE 814

>TBLA0H01130 Chr8 (253122..253152,253271..255507) [2268 bp, 755 aa]
           {ON} Anc_8.351 YDR164C
          Length = 755

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 4/67 (5%)

Query: 474 IEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDELNS 533
           IE+ KN  +KQ+ D+   HN K L+I    E          DE+L    AV    D ++S
Sbjct: 5   IELQKNYFLKQLNDIQVPHNVKLLVIDDYVEKFFGFIFANPDELLAHVAAV----DRIDS 60

Query: 534 AKTNVQK 540
            K   Q+
Sbjct: 61  PKRRSQQ 67

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,623,690
Number of extensions: 2765767
Number of successful extensions: 15662
Number of sequences better than 10.0: 1375
Number of HSP's gapped: 15697
Number of HSP's successfully gapped: 2175
Length of query: 807
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 689
Effective length of database: 39,950,811
Effective search space: 27526108779
Effective search space used: 27526108779
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 70 (31.6 bits)