Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4403.490ON2131978111e-110
YGR129W (SYF2)3.490ON2151975846e-76
Smik_6.2253.490ON2131955837e-76
Suva_7.4173.490ON2121955672e-73
ZYRO0D10032g3.490ON2091912561e-26
TDEL0D055803.490ON1931962481e-25
SAKL0F02816g3.490ON1921952165e-21
NCAS0E008203.490ON2021932114e-20
Kpol_480.153.490ON2071941852e-16
Ecym_12393.490ON1931961763e-15
NDAI0G009503.490ON2132031722e-14
KLTH0F14784g3.490ON1951941493e-11
Kwal_55.212263.490ON1961981493e-11
CAGL0I10538g3.490ON2001901483e-11
KLLA0E04643g3.490ON2211921432e-10
TBLA0C044703.490ON2222041415e-10
AFR308W3.490ON1921941177e-07
KNAG0B008203.490ON207511053e-05
TPHA0D042403.490ON20966672.4
SAKL0G08624g5.360ON35650648.7
NOTE: 1 genes in the same pillar as Skud_7.440 were not hit in these BLAST results
LIST: KAFR0C01950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.440
         (213 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...   317   e-110
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...   229   6e-76
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...   229   7e-76
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...   223   2e-73
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   103   1e-26
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   100   1e-25
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    88   5e-21
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    86   4e-20
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    76   2e-16
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    72   3e-15
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    71   2e-14
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    62   3e-11
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    62   3e-11
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    62   3e-11
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    60   2e-10
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    59   5e-10
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    50   7e-07
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    45   3e-05
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    30   2.4  
SAKL0G08624g Chr7 complement(737815..738885) [1071 bp, 356 aa] {...    29   8.7  

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  317 bits (811), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 160/197 (81%)

Query: 17  GVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYN 76
           GVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYN
Sbjct: 17  GVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYN 76

Query: 77  AWXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXG 136
           AW                 SYDQVAKLSYEKTLRNLVTQ                    G
Sbjct: 77  AWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKNENSVNKNDSNSSPKNG 136

Query: 137 AIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIND 196
           AIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIND
Sbjct: 137 AIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIND 196

Query: 197 KNKQFNEKLSREPKDSN 213
           KNKQFNEKLSREPKDSN
Sbjct: 197 KNKQFNEKLSREPKDSN 213

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score =  229 bits (584), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 137/197 (69%), Gaps = 2/197 (1%)

Query: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77
           V+VSIK+RKLADREIQE   NRKP+VYSMEDVND  E V D E+ +K+KAFHYTVQEY+A
Sbjct: 18  VDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDA 77

Query: 78  WXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXX--XX 135
           W                 SYDQ+AKLSYEKTLRNL TQ                      
Sbjct: 78  WERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKK 137

Query: 136 GAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIN 195
           G I K+Q++ KTGKI I DDDKLVNKLA +L+SESKKRYEAR++QM+NAKT   VESFIN
Sbjct: 138 GRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFIN 197

Query: 196 DKNKQFNEKLSREPKDS 212
           DKNKQFNEKLSRE K S
Sbjct: 198 DKNKQFNEKLSRESKGS 214

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  229 bits (583), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 120/195 (61%), Positives = 136/195 (69%)

Query: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77
           VNVSIKNRKLADREIQEA +NRKP+VY+MED+ND  E V   E+SDKD+AFHYT QEY A
Sbjct: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77

Query: 78  WXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXGA 137
           W                 SYDQ+AKLSYEKTLRNL TQ                      
Sbjct: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137

Query: 138 IHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFINDK 197
           I +IQ++ KTGKI I DD KLVNKLA +LESESKKRYEAR++QME+A  PS VESFINDK
Sbjct: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197

Query: 198 NKQFNEKLSREPKDS 212
           NKQFNEKLSRE ++S
Sbjct: 198 NKQFNEKLSRESRNS 212

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score =  223 bits (567), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 134/195 (68%), Gaps = 1/195 (0%)

Query: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77
           V+ S+K RKLADREIQEA  NRKP+VYSMED +D  E V + ++ DKD+AFHYTVQEYNA
Sbjct: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDD-ELVRETKSDDKDRAFHYTVQEYNA 76

Query: 78  WXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXGA 137
           W                 SYDQ+AKLSY+KTLRNL TQ                      
Sbjct: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSR 136

Query: 138 IHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFINDK 197
           I KIQ+N  TGKI IVDDD+LVNKLA TLES+SKKR++AR++QMEN KTPS VESFINDK
Sbjct: 137 IEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDK 196

Query: 198 NKQFNEKLSREPKDS 212
           NKQFNEKL RE + S
Sbjct: 197 NKQFNEKLGRESRGS 211

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  103 bits (256), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 101/191 (52%), Gaps = 18/191 (9%)

Query: 20  VSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNAWX 79
           +S++NRKL + E +E    RKP+VY +E   + + P +D +  ++    +YT+Q+Y  W 
Sbjct: 30  ISVENRKLVNAESKELAAGRKPRVYQLE-APEPSLPTQDDKHGNQ--LMNYTIQQYEEWN 86

Query: 80  XXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXGAIH 139
                           +   +AK +Y+K L  L                       G+I 
Sbjct: 87  SRQRDQTNKRDSG---NLQDMAKYTYDKELNKL----------HKDTMLQNRYTNGGSIQ 133

Query: 140 KIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQME--NAKTPSSVESFINDK 197
           K+ RN KTGK+ I DDD+LV KLA  ++  + +RYEARR++ME  N +  SS   +IN+K
Sbjct: 134 KMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGGGYINEK 193

Query: 198 NKQFNEKLSRE 208
           NKQFNEKL R+
Sbjct: 194 NKQFNEKLDRQ 204

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  100 bits (248), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 106/196 (54%), Gaps = 23/196 (11%)

Query: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVND-GAEPVEDAETSDKDKAFHYTVQEYN 76
           V+V+I+ RK+A+RE ++  L  KPK+YSMED N+ G  PV+ +E   + K  +Y+++EY 
Sbjct: 18  VDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSSERR-RLKLMNYSMREYE 76

Query: 77  AWXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXG 136
            W                 +  ++AK SYEK L                           
Sbjct: 77  EWDKKQKGKEVKRGGA---NVQELAKYSYEKDL------------------SRSKQNNGN 115

Query: 137 AIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIND 196
            + KI  + KT ++++ DD+KLVNKLA  L+  +++R+ AR+K ME A   ++   +IN+
Sbjct: 116 RVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINE 175

Query: 197 KNKQFNEKLSREPKDS 212
           KNKQFN KL R+ K++
Sbjct: 176 KNKQFNLKLDRQMKET 191

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 87.8 bits (216), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 101/195 (51%), Gaps = 25/195 (12%)

Query: 17  GVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSD-KDKAFHYTVQEY 75
           GV+VS+KNRK A++E ++A  + KPKVYSM +     E  +D +  D + K  +Y++++Y
Sbjct: 17  GVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNE----DETFKDQKEEDTRGKLLNYSIKDY 72

Query: 76  NAWXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXX 135
             W                 S   +AK +Y+K +R +                       
Sbjct: 73  EKWQLKRTAKLKNSDGS---SQQDLAKYTYDKEIREM---------------EKDGSLNR 114

Query: 136 GAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIN 195
           G + K + N K G+I+I DD K + +LA  L   +K+RY  R+KQ E   + S+   FIN
Sbjct: 115 GKVTKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS-STTGGFIN 172

Query: 196 DKNKQFNEKLSREPK 210
           DKNKQFNEKLSR+ K
Sbjct: 173 DKNKQFNEKLSRQFK 187

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 85.9 bits (211), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 93/193 (48%), Gaps = 17/193 (8%)

Query: 19  NVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDK-DKAFHYTVQEYNA 77
           + +I+NR L DRE ++   + KP+VY+M+D  D     ++ +  DK  K  +YT+++Y  
Sbjct: 20  DATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKLMNYTLRQYEE 79

Query: 78  WXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXGA 137
           W                    Q+A  SY+K + NL                         
Sbjct: 80  WEKKQKDKKIKDDSSDMK---QLAMFSYDKGVSNLNRFRTDKTTTEREV----------- 125

Query: 138 IHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFINDK 197
             +IQ N KTGK+ I D+ KLVN LA  L   + KRY   +K+++     SS E +IN++
Sbjct: 126 --QIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYINER 183

Query: 198 NKQFNEKLSREPK 210
           NK FNEKL RE +
Sbjct: 184 NKHFNEKLDRESR 196

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 75.9 bits (185), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 92/194 (47%), Gaps = 16/194 (8%)

Query: 17  GVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYN 76
            V++ I+NRKL D   +E   N KPK YSME++ +  + V      + D+  +Y+++EY 
Sbjct: 19  AVDILIENRKLLDANTRELKKNSKPKTYSMEELAED-DTVNTGTVDEADRLLNYSIREYE 77

Query: 77  AWXXXXXXXXXXXXXXXXX--SYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXX 134
            W                   S  Q+AK +Y+K                           
Sbjct: 78  EWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQ-------------IKKLQKQKSTNDN 124

Query: 135 XGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFI 194
            G I KI+++ KTGKI + D  +L+ +LA  L   +K+RY+   ++ +     +   S+I
Sbjct: 125 RGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYI 184

Query: 195 NDKNKQFNEKLSRE 208
           N+KNK+FN+KL R+
Sbjct: 185 NEKNKEFNDKLERQ 198

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 72.4 bits (176), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 98/196 (50%), Gaps = 25/196 (12%)

Query: 18  VNVSIKNRK-LADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYN 76
           V++SIKNRK +   E+ + G + KP+VYS+ D       V+    +++ K  +Y++ +Y 
Sbjct: 18  VDISIKNRKEIVSEEVLQVGRS-KPEVYSINDEGAAVNEVQSTSNTERRKLLNYSLIDYE 76

Query: 77  AWXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXG 136
            W                 +Y      +Y+  ++ L                       G
Sbjct: 77  KWDEKEKQANFDGTYSGDIAYS-----TYKNEIKQL----------------RKGGLTKG 115

Query: 137 AIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSS-VESFIN 195
            I K  R  ++GK+ I D+ +LVNKLA TLE  S++R+   +K+++  K  +S + +F+N
Sbjct: 116 KITK-GRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVN 174

Query: 196 DKNKQFNEKLSREPKD 211
           +KN+ FNEKLSR+ K+
Sbjct: 175 EKNRHFNEKLSRQFKE 190

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 96/203 (47%), Gaps = 25/203 (12%)

Query: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVND---------GAEPVEDAETSDKDKAF 68
           +++  +NRK AD+E++E   + KPKVY ++ V D         G     + E   K K  
Sbjct: 21  LDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLM 80

Query: 69  HYTVQEYNAWXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXX 128
           +YT++EY  W                 +  ++A  +YEK L  L ++             
Sbjct: 81  NYTIREYEEWDKQQKDKQRKRVDGSDLT--ELATFTYEKELSKLNSKLENISHEQK---- 134

Query: 129 XXXXXXXGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPS 188
                     H+I  N + GK+ + D+++L+N L   L   +KKRY  R+K++++  +  
Sbjct: 135 ----------HQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSD 184

Query: 189 SVESFINDKNKQFNEKLSREPKD 211
              ++  DKNKQFNEKL RE K+
Sbjct: 185 IAGNYFKDKNKQFNEKLERELKE 207

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 86/194 (44%), Gaps = 20/194 (10%)

Query: 17  GVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYN 76
           GV++S+KN++   +E ++     KP VYSM+   + A   E  E S + K   Y+++++ 
Sbjct: 17  GVSLSVKNKQQILQEEKQTSARAKPAVYSMK--TEEAPSSETTEESKEAKLLQYSMKDFE 74

Query: 77  AWXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXG 136
            W                  Y  +AK +Y+K ++ L                        
Sbjct: 75  QWQDKERRKSQKSSDVAK--YQDLAKFTYDKEVQQLRKNYTNKVEKPK------------ 120

Query: 137 AIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIND 196
              K+  N K GKI + DD  LV  LA +L   + +RY    K++       +   FIN+
Sbjct: 121 ---KVSIN-KKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINE 176

Query: 197 KNKQFNEKLSREPK 210
           KNKQFN+K+ R+ K
Sbjct: 177 KNKQFNDKIERQTK 190

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 91/198 (45%), Gaps = 30/198 (15%)

Query: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77
           +++S+KN+    RE +    +RKP VYSM    +GAE     + ++ +K   Y++ EY  
Sbjct: 18  IDLSVKNKNEVIREEKMVSASRKPAVYSMNA--EGAEEEIAKDVTEANKLLKYSMLEYEQ 75

Query: 78  WXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXGA 137
           W                 S+  +AK +Y+K ++ L                       G 
Sbjct: 76  W--QDKVKKNSHRLEGGASFQDLAKSTYDKEVQQL-------------------SKIDG- 113

Query: 138 IHKIQRNIK-----TGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVES 192
            +++ +N K      GKI + DD +LV  L  TL   + +RY   +K++      ++   
Sbjct: 114 -NRVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGG 172

Query: 193 FINDKNKQFNEKLSREPK 210
           +IN+KNKQFN+KL R+ K
Sbjct: 173 YINEKNKQFNDKLERQTK 190

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 88/190 (46%), Gaps = 19/190 (10%)

Query: 19  NVSIKNRKLADREIQEAGLNRKPKVYSM-EDVNDGAEPVEDAETSD-KDKAFHYTVQEYN 76
           ++ I+NR L  +E +E     KP+VYSM +D +D  E     E SD +   F YTVQ++ 
Sbjct: 19  DIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQSDMRTNLFQYTVQDFI 78

Query: 77  AWXXXXXXXXXXXXXXXX-XSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXX 135
            W                      +AK +Y+K L+NL                       
Sbjct: 79  DWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEFKMKAKET----------- 127

Query: 136 GAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIN 195
               + + N  +GK+ I D+ +LV +L+  L+  +K+RY++ RK + N K  +S+   IN
Sbjct: 128 ----QFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRK-IANDKEHTSLSGSIN 182

Query: 196 DKNKQFNEKL 205
            KN QFN+ L
Sbjct: 183 AKNLQFNKSL 192

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 86/192 (44%), Gaps = 27/192 (14%)

Query: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77
           V VSI+N+K     I E   N + +VYSM D  +       +E  D  K  +Y+++EY  
Sbjct: 54  VEVSIRNKKAI---IAEEKKNSERRVYSMADDGEDKARSNKSEPEDPIKLANYSIREYEK 110

Query: 78  WXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXGA 137
           W                  +  +AK SY+K +  L                         
Sbjct: 111 WEAKTQNSRHNKSVMG--DFQTIAKNSYKKEVDALPKDIS-------------------- 148

Query: 138 IHKIQRNI-KTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFIND 196
            H ++  I + GK+++ D+ +LV K+   L   SKKRY  R+++++     +  + FIND
Sbjct: 149 -HPLKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFIND 207

Query: 197 KNKQFNEKLSRE 208
           KNK+FN KL+ E
Sbjct: 208 KNKRFNAKLNSE 219

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 58.9 bits (141), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 89/204 (43%), Gaps = 22/204 (10%)

Query: 19  NVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAE-PVED-------AETSDKDKAFHY 70
           N  I N+        ++  N KPKVYSM D  D  E P+ D       +E     K  +Y
Sbjct: 20  NTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNY 79

Query: 71  TVQEYNAWXXXXXXXXXXXXXXXX----XSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXX 126
           T++EY  W                     S D +AK +Y+K +R L              
Sbjct: 80  TLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDIRKL-------NKALRAT 132

Query: 127 XXXXXXXXXGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKT 186
                    G I K  RN ++ KI I DD  LV +L   L+++S + Y+   ++ +N  T
Sbjct: 133 NSGNKSNKPGKIIKNHRN-ESNKIVIKDDKFLVEELVNNLKTKSDRLYKHLGERRKNYST 191

Query: 187 PSSVESFINDKNKQFNEKLSREPK 210
             ++   +N KN++FNEKL+RE K
Sbjct: 192 --TLSGHVNTKNQEFNEKLTREWK 213

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 28/194 (14%)

Query: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77
           V+ SI+NRK A  E +      KP+VYSM +        +D + S++ K  +Y + +Y  
Sbjct: 18  VDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQ-SEQLKLLNYRIADYEK 76

Query: 78  WXXXXXXXXXXXXXXXXXSYDQVAKLSYEKTLRNLVTQXXXXXXXXXXXXXXXXXXXXGA 137
           W                    ++A  +Y   L  L                       G 
Sbjct: 77  WDEKQKRHKQPSDGA---DLGELANSTYRSELHQL--------------------HRRGV 113

Query: 138 IHKIQRNIK---TGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFI 194
           +     N +   +GK+ + D+ +LV KLA  ++  +K+R+E R+K+       ++  S +
Sbjct: 114 VKGRATNGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS-L 172

Query: 195 NDKNKQFNEKLSRE 208
           NDKN+ FNEKL RE
Sbjct: 173 NDKNRHFNEKLDRE 186

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 159 VNKLAFTLESESKKRYEARRKQM--ENAKTPSSVESFINDKNKQFNEKLSR 207
           V +L   L   SKKRY  R+ +M  + A+  SS++ +IN+KNKQFN+KL R
Sbjct: 152 VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 148 GKIEIVDDDKLVNKLAFTLESESKKRYEARRK--QMENAKTPSSVE------SFINDKNK 199
           GK+ I DD  LVN     +   S  RY  R K   + N  T S V       S+ N KNK
Sbjct: 142 GKLLIKDDKHLVNGFISDINKVSNDRYIKRMKLNAVNNDATGSKVSHDKGKTSYNNAKNK 201

Query: 200 QFNEKL 205
            FN+KL
Sbjct: 202 DFNDKL 207

>SAKL0G08624g Chr7 complement(737815..738885) [1071 bp, 356 aa] {ON}
           similar to uniprot|Q06678 Saccharomyces cerevisiae
           YDR322W MRPL35 Mitochondrial ribosomal protein of the
           large subunit
          Length = 356

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 5/50 (10%)

Query: 166 LESESKKRYEARRKQME-NAKTPSSVESFINDK----NKQFNEKLSREPK 210
           LE  +  +YE   K+++ N KT  +VE+ IN+     N QFNEKL   PK
Sbjct: 78  LEKRAASKYEQMSKEVDLNKKTQLAVEAEINNPEVQYNFQFNEKLENNPK 127

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,218,267
Number of extensions: 616576
Number of successful extensions: 3037
Number of sequences better than 10.0: 48
Number of HSP's gapped: 3011
Number of HSP's successfully gapped: 53
Length of query: 213
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 108
Effective length of database: 41,441,469
Effective search space: 4475678652
Effective search space used: 4475678652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)