Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4393.489ON71371334400.0
Suva_7.4163.489ON71371428330.0
Smik_6.2243.489ON70571327570.0
YGR128C (UTP8)3.489ON71371327470.0
NCAS0E008303.489ON67172314360.0
TDEL0D055703.489ON64971613900.0
Kpol_480.163.489ON65571513511e-178
ZYRO0D10054g3.489ON66472113451e-177
TPHA0D042303.489ON65271613231e-174
NDAI0G009603.489ON70076913131e-171
TBLA0C044603.489ON69873912931e-169
SAKL0F02838g3.489ON65471312751e-166
CAGL0I10560g3.489ON67872012331e-160
KLTH0F14762g3.489ON65071612161e-158
KLLA0E04665g3.489ON64771611421e-147
AFR307C3.489ON65072011371e-146
Kwal_55.212223.489ON3733936571e-78
KAFR0C019403.489ON6095755632e-62
KNAG0B008303.489ON6076175455e-60
Kwal_55.21225singletonOFF2152483392e-35
ZYRO0E08074g6.271ON59236850.14
NDAI0K012508.696ON40996707.0
TPHA0J021406.174ON601436910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.439
         (713 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...  1329   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...  1095   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...  1066   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...  1062   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   557   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   540   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   525   e-178
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   522   e-177
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   514   e-174
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   510   e-171
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   502   e-169
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   495   e-166
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   479   e-160
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   473   e-158
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   444   e-147
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   442   e-146
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   257   1e-78
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   221   2e-62
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   214   5e-60
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   135   2e-35
ZYRO0E08074g Chr5 complement(633136..634914) [1779 bp, 592 aa] {...    37   0.14 
NDAI0K01250 Chr11 (283367..284596) [1230 bp, 409 aa] {ON} Anc_8....    32   7.0  
TPHA0J02140 Chr10 complement(479106..480911) [1806 bp, 601 aa] {...    31   10.0 

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score = 1329 bits (3440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/713 (92%), Positives = 663/713 (92%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
           MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
           DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240

Query: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300
           VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC
Sbjct: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300

Query: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360
           QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT
Sbjct: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360

Query: 361 FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK 420
           FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK
Sbjct: 361 FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK 420

Query: 421 NDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFF 480
           NDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFF
Sbjct: 421 NDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFF 480

Query: 481 NDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTHGL 540
           NDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKA            NRTHGL
Sbjct: 481 NDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTHGL 540

Query: 541 LSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEMK 600
           LSLLRDQPRLFKQAIVTC            FSIRNRELLLDISFRVLQDFTRDSIKQEMK
Sbjct: 541 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEMK 600

Query: 601 KLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENLTL 660
           KLSKLDIQNFIECITNTEEDGPLEGFNHNH              IGLFSLEGALLENLTL
Sbjct: 601 KLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLTL 660

Query: 661 YIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
           YIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI
Sbjct: 661 YIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score = 1095 bits (2833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/714 (76%), Positives = 598/714 (83%), Gaps = 2/714 (0%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADG FNE TNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKLTFDYPIPSTN+ITAC+A + QV +E D K S++D  D E   N Q+KR++EIWSFG 
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHE-VTNFQSKRDVEIWSFGL 119

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
           MVNKGNYTLNV TK +E N +TSN+HL E+  D + +AG DD LSQ+KIKTK KVMNIKI
Sbjct: 120 MVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKI 179

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
           DAKNSL+IAVLQNGL+EFYD KLKLL+S+DISY NLKYAKWFTENGT+FVFVLCPLEDDK
Sbjct: 180 DAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDK 239

Query: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300
           VCYK+ ELSDFE K++SPIKELSSTIIEGFSFESSK CYQFGKLYKLNQGKI+VYSLPHC
Sbjct: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299

Query: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360
           QLQQII++PLINK  SE+DLISFQPVSVNRILLTVNN IYLLDLLHCSILN RELTHV+T
Sbjct: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359

Query: 361 FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK 420
           FQLL+SA+IDSEKS NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ+GK
Sbjct: 360 FQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419

Query: 421 ND-ASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIF 479
           ND +SV+LKPLFDDE+V +NMVKRNDIDGNI+VP F YDE+I+K+S LKNND+ASFD+IF
Sbjct: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479

Query: 480 FNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTHG 539
           F DLKVKEEHYTEKDRFISD  FLN+VLDLIF KF GNDYPKA            NRTH 
Sbjct: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTHN 539

Query: 540 LLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEM 599
           LLS LRDQPRLFKQAIVTC            FSIRN+ELLLDISFR+LQDFTRDSIKQEM
Sbjct: 540 LLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEM 599

Query: 600 KKLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENLT 659
           K LSKLDIQNFI+ ITNT+ED  LE  NH+               IGLFSLEGALL+NL 
Sbjct: 600 KNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLA 659

Query: 660 LYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
            YIDKQV+IAERNTELWNL++ KGSQHGF  ++S S TSQKQALP Y MEYL+I
Sbjct: 660 SYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score = 1066 bits (2757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/713 (74%), Positives = 592/713 (83%), Gaps = 8/713 (1%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSNFSLQA+YVQVADGTFNESTNNITL            NPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL FDYPIPSTN+ITAC+A E QVN+E        D ++ EK  NSQTKRNIEIWSFG 
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIE--------DKDNNEKVINSQTKRNIEIWSFGL 112

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
           MVNKGNYTLNV TK+LE+  N ++E+LVE+ I++  + G++  LSQ+KIK KAKVM+IKI
Sbjct: 113 MVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKI 172

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
           D KN+LIIA+LQNGLIEFYD KLKLL+SFDISYDNLKYAKWFTENG +F+FVLCPL+DDK
Sbjct: 173 DTKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDK 232

Query: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300
           VCYK+LEL+D+E+++NSPIKELSSTIIEGFSF+ SKLCYQFGKLYKLN+GKIYVYSLPHC
Sbjct: 233 VCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHC 292

Query: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360
           QLQQ+IELPLIN S+ E DLISFQPVSVNR+LLTVNNI+YLLDLLHCS L  REL+HVKT
Sbjct: 293 QLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKT 352

Query: 361 FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK 420
           FQLL +A+I+SEKSH+SKTIAIGISTKNG NPTSSLEIINIDVGTNTLKDSLGKSFQ  K
Sbjct: 353 FQLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEK 412

Query: 421 NDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFF 480
            D+SVILKPLFDDE+VT NMVKRN+IDG+I++P F YDE+I KLS LK+NDI SFD+IFF
Sbjct: 413 KDSSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFF 472

Query: 481 NDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTHGL 540
            DLK+KEEHYTEKDRFISD  FLNKVLDLIF KF GNDYPK             +RT  L
Sbjct: 473 KDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNL 532

Query: 541 LSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEMK 600
           LSLLRDQPRLFKQAIVTC            FSIRN+ELLLDISFR+LQDFTRDSIKQEMK
Sbjct: 533 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMK 592

Query: 601 KLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENLTL 660
           +LSKLDIQNFIE +T+TE D  LEGFNH+               IGLFSLEGALLE+LT 
Sbjct: 593 RLSKLDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTS 652

Query: 661 YIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
           YIDKQVKIAERNTELWNLIDIK SQHGF  L+  S +SQKQALP Y MEYLDI
Sbjct: 653 YIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/713 (73%), Positives = 592/713 (83%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKLTFDYPIPSTN+ITAC+A + Q N++ +++ S DD  + EK  N+Q KRN+EIW+FG 
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
           MVNKGNYTLNV TK LE   +TSN+HL E  ID++ + G+D+FLSQ+KIK KAKVM+IKI
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
           D KNSL+IA+LQNGLIE +D KL LL+SFDISYDNLKYAKWFTENGT++VFVLCPL+DDK
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240

Query: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300
           VCYK+LEL+D  S ++SPIKELSSTIIEGFSFE+SKLCYQFGKLYKLNQGKIY+YSLPHC
Sbjct: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300

Query: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360
           QLQQ+IE P+++K +  DDLISFQPVSVNR+LLTVNN+IYLLDLLHCS L+ RELTHVKT
Sbjct: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360

Query: 361 FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK 420
           FQLLKSA+I+SEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 
Sbjct: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420

Query: 421 NDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFF 480
           ND+SVILKPLFDD+D+ +  VK ND+ G+ +VP+ H +EVIEKLS L++NDI SFD+IFF
Sbjct: 421 NDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFF 480

Query: 481 NDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTHGL 540
            +LK+KEEHYTEKDR+ISDPGFLNKVLDLIF KF GNDYPK             +RT  L
Sbjct: 481 KELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRNL 540

Query: 541 LSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEMK 600
           LSLLRDQPRLFKQAIVTC            FSIRNRELLLDISFR+LQDFTRDSIKQEMK
Sbjct: 541 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMK 600

Query: 601 KLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENLTL 660
           KLSKLD+QNFIE IT+  ED   E FN +               IGLFSLEGALLENLTL
Sbjct: 601 KLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTL 660

Query: 661 YIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
           YIDKQV+IAERNTELWNLID KG QHGFA+ +  + TSQK+ALP Y MEYLDI
Sbjct: 661 YIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/723 (46%), Positives = 459/723 (63%), Gaps = 62/723 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRL  LPKIASLSNF+LQ+DY+QV D TF+ +TN IT+            NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL F++PIPSTN++TAC+  E                   +K ++ +T      W F +
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFE-------------------QKGSSEET------WCFAT 95

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
           M NK + TLN+  K    N+  +NE    DS  S          S+ KIK    V++IKI
Sbjct: 96  MANKTS-TLNLINK----NQYQTNEEESGDSAPSDSSVT-----SEFKIKADDHVVDIKI 145

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
             K  +I+ VL+NG I+ YD +LKLL S +++Y+N+++ + F E+G DF+FVLC LE+DK
Sbjct: 146 LNKKKIIV-VLKNGKIQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDK 204

Query: 241 VCYKMLELSD-FESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPH 299
           VC K+ ++++  E+ ++S I EL+STI+E F  E++K CYQFGK YKL   KI VYSLP 
Sbjct: 205 VCLKLFQINENIETINDSAI-ELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQ 263

Query: 300 CQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVK 359
            Q Q  I LP+I      + ++SF+P+S NRILLTVNN IYLLDL+H SIL+ RELTH+K
Sbjct: 264 FQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLK 323

Query: 360 TFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
           TFQLLK+A++D+  + N +T+AIG+STK G NPTSSLE++N+DVGT+T+KDSLGKSFQ  
Sbjct: 324 TFQLLKTAVVDTNINQN-RTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTS 382

Query: 420 KNDASV-ILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEI 478
             + +V  LK LFDDE+  ++  K+        V  F+Y+++ ++L V   ND+  FD+I
Sbjct: 383 STENNVQSLKSLFDDENDYSDKKKQ--------VKNFNYEKIYKEL-VDSKNDVTKFDDI 433

Query: 479 FFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTH 538
           FF    +K+E+YTEKDRFI +  FL +++DLIF  F   +YPK              RT 
Sbjct: 434 FFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETF-KEEYPKTFTYLLTDPLFPLERTK 492

Query: 539 GLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQE 598
           GLL+ L + PRLFKQAIVTC            F+I N EL LDIS R+LQD+TRDSIK+E
Sbjct: 493 GLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKE 552

Query: 599 MKKLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENL 658
           +KKL K++++NFIE I + E D   +  N  H              IGLF+L+ A+LE L
Sbjct: 553 LKKLPKIEVENFIEFIIDEESDIK-DTTNAPH---LFQLLSLVVDSIGLFALDNAVLERL 608

Query: 659 TLYIDKQVKIAERNTELWNLID----IKGSQHGFATLSSGSTTS----QKQALPAYAMEY 710
           + YID+QV IA+ NTELW+L+D    +      F T +S  + +    Q++ LP Y++EY
Sbjct: 609 SKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEY 668

Query: 711 LDI 713
           LD+
Sbjct: 669 LDL 671

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/716 (43%), Positives = 428/716 (59%), Gaps = 70/716 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQ F+LA LP++ASLSNF+ Q +++QVAD     ++N IT+            NPT
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL    PIPSTN++TAC  A                 +DE+           EIW +  
Sbjct: 60  PKLVLSIPIPSTNIVTACDVAR----------------SDEQ-----------EIWCYAL 92

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
              K   TLNV +K+  +          E+ ++S      DD L   K+K   + + + +
Sbjct: 93  QAGKV-CTLNVASKVSHA----------ENGVNS------DDVL---KVKVDDQAVGVHV 132

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
           + K+  I+ VL+NGLI+FYD +LKLL+S D+SY ++   K+FTE   DF+F+LC L +DK
Sbjct: 133 NGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDK 192

Query: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300
           VC+K+ ELS   + +  PIKELSS I+E FS  +SK+CYQ G+LY+L   ++ VY+LP C
Sbjct: 193 VCFKLFELS-LPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQC 251

Query: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360
           QL Q + LP++  +    D+IS +P+S NRIL+T +N IYLL+L H SIL  RELTH+K+
Sbjct: 252 QLVQAVTLPMVQGA----DVISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKS 307

Query: 361 FQLLKSALIDSEKSH---NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 417
           FQLLKSA+IDS  S    N KT  IG+ TK+G NPTSSLEI+N+DVGT TLKDSLGK F 
Sbjct: 308 FQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFT 367

Query: 418 VGKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDE 477
           V     S +LKPLF DED                   F ++++ + L   K + I+SFD 
Sbjct: 368 VSNEPISQVLKPLFSDEDNEAEDEDNK-------FEHFDFNQIYQHLEKNKQS-ISSFDR 419

Query: 478 IFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRT 537
           IF  +L +K EHYTE DRFI D  FL+ V+ LI   F   +YPKA            + T
Sbjct: 420 IFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQ-EEYPKALTFLLTHPLFPVDCT 478

Query: 538 HGLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQ 597
             LLS LR+ PRLFKQAIVTC            FSI N EL LDIS R+LQD+T D IKQ
Sbjct: 479 PKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQ 538

Query: 598 EMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLEN 657
           E++KL+K+D+QNFIE + ++ ++  +   +                 IGLF+L+G LL+ 
Sbjct: 539 EVRKLNKIDVQNFIEFVISSNDENAIRSSHQ-----LFQLLSLVLDSIGLFALDGVLLDR 593

Query: 658 LTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
           L  YI ++V IAERN++L +L+D K +  GFA   +GS  S ++A+P Y +EYLD+
Sbjct: 594 LADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  525 bits (1351), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/715 (43%), Positives = 426/715 (59%), Gaps = 62/715 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPS SQPFRLA LPKI SLSN   Q   +Q+AD  F+  +N IT+            NPT
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADD-FSLESNKITIGISGSTISQYIINPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           P L F+ PIPSTN +TAC+             +S+ D +             +E W++G 
Sbjct: 60  PSLVFNVPIPSTNNVTACNIGHF---------VSDTDGS------------KLECWAYGL 98

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
             NK N+TLN++ K                S D +      + +  +  K   K+ +IKI
Sbjct: 99  SYNK-NHTLNISIKT---------------SDDDKYATSGGEVVETYSQKCDDKIEHIKI 142

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
           + K  +I+ VL+NGLI+FYD  LKLL S ++ Y ++ + + F E+G  F  +L  +E  K
Sbjct: 143 NEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISFVEHFEEDGKQFAIILSNIEGKK 202

Query: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300
           + +K+ EL    + D + I ELSSTI+E      S++CYQFGK+Y+L + ++Y+Y+LP C
Sbjct: 203 ISFKLYELF---TNDKTSINELSSTILEDADLGESQICYQFGKIYRLFEDRLYIYNLPQC 259

Query: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360
           QLQQ IELP I K +S  D++SF P++ NRILLTVNN IYLLDL+H SIL  R+L+HVK 
Sbjct: 260 QLQQTIELPFIQKKDS--DVLSFSPIANNRILLTVNNKIYLLDLVHNSILAERDLSHVKV 317

Query: 361 FQLLKSALIDSE-KSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
           +QLLKS ++ S+ ++ NSKTIAIG+S KNGP+P SSLE+IN+DVG+ TLKDSLGKSFQV 
Sbjct: 318 YQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVINVDVGSGTLKDSLGKSFQVA 377

Query: 420 KNDASVILKPLF-DDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEI 478
               ++ L+ LF +DE +     +++          F Y  ++++L   KN DI  FD+I
Sbjct: 378 NVKKNIPLQSLFPEDETIYAKGEQKS----------FDYKNILQELQNNKN-DINKFDDI 426

Query: 479 FFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTH 538
           FF  L + +E+YTE+DRFI D  FL+ VLDLIF  F   DYP+A            + T 
Sbjct: 427 FFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFK-KDYPRALTFLLTHPLFPISHTR 485

Query: 539 GLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQE 598
            LL+  R+QPRLFKQA+VTC            F+I N EL LDIS R+LQD+TRDSIKQE
Sbjct: 486 NLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYTRDSIKQE 545

Query: 599 MKKLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENL 658
           +K LSK+DIQNFIE + +T+ +   + FN                  GLF+LE   LE L
Sbjct: 546 LKTLSKVDIQNFIEFVIDTDSEDKSQ-FNPQLFQLLSLVLDAS----GLFALEEETLEKL 600

Query: 659 TLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
           + YID QV +AERN  LW+L+D    +      ++     Q ++L AY++EYL++
Sbjct: 601 SAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNVLQTKSLSAYSVEYLEL 655

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  522 bits (1345), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 306/721 (42%), Positives = 430/721 (59%), Gaps = 65/721 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPS+ QPFRL+ LP+I +LSN+ +Q+DY++V+    + ++N IT+            NPT
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL  +  IPSTNV++AC  A +            DD                EIW +  
Sbjct: 60  PKLLSNISIPSTNVVSACDVATLA-----------DDK---------------EIWCYCV 93

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
              K ++ LN + K ++++            +D+      +DF    KIK  +KV+ IKI
Sbjct: 94  KSGKSHF-LNASVKPVDADT----------VLDTDGGDKTEDF----KIKMDSKVVGIKI 138

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
                 I+ VL++GLI++YD +L+ L S DISY N+K   +F+ENG +F+FVL   E++K
Sbjct: 139 IPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNK 198

Query: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300
           VC+K+ EL   + K ++PIKELS+TI+E F+ + SKLCYQ GKLY+L    I  Y+LP C
Sbjct: 199 VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQC 258

Query: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360
            L Q   LP+I   NS+   +S  PVS NRILLTVNN +YLLDL+H S+L+ R LTH KT
Sbjct: 259 HLVQTTHLPMILDPNSQK--VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKT 316

Query: 361 FQLLKSALIDSEKS-----HNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKS 415
           FQLL+SA ++   S       ++T+AIG++TKNG NPTS+LE+IN+DVGT TLKDSLGKS
Sbjct: 317 FQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKS 376

Query: 416 FQVGKNDASVILKPLF--DDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNN-DI 472
           FQ   +  +  L+PLF  D+ D  +N     D D    V  F Y+++ ++LS  KNN  I
Sbjct: 377 FQSINDSKTHNLQPLFSDDESDAGDNA----DSD---EVVAFAYEDIFKELS--KNNKSI 427

Query: 473 ASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXX 532
           + FD  F   L ++EEHYT+++RFI D  FL+KV+ LI   F   +YP+A          
Sbjct: 428 SKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSF-DQEYPRALTFLLTHPLF 486

Query: 533 XXNRTHGLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTR 592
             + T GLL   R+ PRLFKQAIVTC            FSI N EL LDIS R+LQDFT 
Sbjct: 487 PTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTT 546

Query: 593 DSIKQEMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEG 652
           D IK E+KKL+K+D+ NF+  + + +++   E   +                IGLF+L+G
Sbjct: 547 DMIKDEVKKLNKVDVHNFVNFLISPKDE---ELIQNKSTYELFQLLSLVIDAIGLFALDG 603

Query: 653 ALLENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLD 712
           ALL+ L+ YID+QV +AERN  LWNL+D +    G     +GS+ +++Q LP Y +EYL+
Sbjct: 604 ALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLE 663

Query: 713 I 713
           +
Sbjct: 664 L 664

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  514 bits (1323), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 311/716 (43%), Positives = 433/716 (60%), Gaps = 67/716 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIA LS++++Q+  +QVAD  F   +N IT+            NPT
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           P ++   PIPSTN +TAC+ A+ +            D++ EE           EIW +  
Sbjct: 60  PNVSQTVPIPSTNNVTACNVAQYK------------DADTEEL---------FEIWVYNL 98

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
            VNK N TL+V  K ++ +K ++ +                D L  + +K  A V+ IKI
Sbjct: 99  AVNKKN-TLHVAIKTVDPDKFSTTQ---------------SDALETYTVKCDASVVGIKI 142

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240
           + ++  I+  L NG I+ +D KLKLL S + SYDN+ +++ F EN   F  +L  +E +K
Sbjct: 143 NKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNK 202

Query: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300
           + YK+ EL     +D + IKELSSTI+E    + SK+ YQFGKLY+L + +++VYSLP C
Sbjct: 203 LSYKLYELF---GQDKTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQC 259

Query: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360
           QL   I LP I+   S+   ISF+PVS NRILLTV+N I++LDL+H + L  R L HVK 
Sbjct: 260 QLVDTITLPQIDLKKSQ--AISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKM 317

Query: 361 FQLLKSALIDS-EKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
           FQLLKS +I++ + S+N KTIAIG+S KNGP+P ++LEIIN +VGT TLKDSLG SF V 
Sbjct: 318 FQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVS 377

Query: 420 KNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIF 479
           K+  S IL+PLF D+    N+VKR+D         F Y+ +++KLS  +N DI  FD+IF
Sbjct: 378 KSFKSNILQPLFTDD---ANLVKRHD---------FKYEAILKKLSSTEN-DIKKFDDIF 424

Query: 480 FNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTHG 539
           F DL +++ +YT+ +RFI D  FL+ V+DLIF  F   +YP A            ++T  
Sbjct: 425 FGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQ-KEYPSALTFLLTHPLFPIHQTKN 483

Query: 540 LLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEM 599
           LL  LR+ PRLFKQA+VTC            FSI N EL +DIS R+LQD+T+DSIK E+
Sbjct: 484 LLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLEL 543

Query: 600 KKLSKLDIQNFIECIT--NTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLEN 657
           K L+K+DIQNFI+ +   N EE+         H               GLFS+EG LL  
Sbjct: 544 KNLNKIDIQNFIDFVIDPNNEEE-------KKHNEQLFVLLSLVLDASGLFSIEGPLLTQ 596

Query: 658 LTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
           L+ YIDKQV++ E++ +LW+LID    +      +SG+T  + +AL AY++EYL++
Sbjct: 597 LSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  510 bits (1313), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 320/769 (41%), Positives = 436/769 (56%), Gaps = 125/769 (16%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRL  LPKIASLSN+SLQ DY+QV   TFN +TN + +            NPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL F+YPIPSTN++TAC                           N     N E+W FG 
Sbjct: 61  PKLIFNYPIPSTNIVTACDV-----------------------LENDNDNTNNEVWCFGL 97

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
           + NK  YTL + TK  +  K+++     ED +D       D+F             N+K+
Sbjct: 98  VANK-TYTLTLITK--DKQKSSATMEDDEDVVDVIDTTIKDEF-------------NVKL 141

Query: 181 DAKNSL------------IIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTD 228
           D+K               I+ VL+NGLI+F++  LKLL +  I+Y N+K+ + F E+  D
Sbjct: 142 DSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKD 201

Query: 229 FVFVLCPLED-DKVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKL 287
           F+F +C L D +KVC K+ ++      +N    EL+S I+E F+ +++K CYQFGK YKL
Sbjct: 202 FMFTICDLGDNNKVCIKLFQI------NNDSAIELNSIIMENFNGQNAKFCYQFGKFYKL 255

Query: 288 NQGKIYVYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHC 347
               + VYSLP  QL+    +P+I    ++D ++S +P+S NRILLT+NN IYLLDL+H 
Sbjct: 256 TNNNLMVYSLPQFQLEHTTTIPMI---KTDDQIVSMKPISTNRILLTINNKIYLLDLIHN 312

Query: 348 SILNHRELTHVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNT 407
           SIL+ RELTH+K+ QLL+SA+I  +  +N+KTI IG+STK G NPTSSLEIIN+DVG+NT
Sbjct: 313 SILSERELTHLKSLQLLRSAVI-GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNT 371

Query: 408 LKDSLGKSFQ--VGKNDASV---ILKPLFD-------DEDVTNNMVKRNDIDGNINVPIF 455
           LKDSLGK FQ    +N   +    LKPLFD       D+D+   +V +           F
Sbjct: 372 LKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDDDLFKKLVTKEQ---------F 422

Query: 456 HYDEVIEKLSVLKNNDIASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFG 515
           +YDE++ KLS    NDI  FDEIFF    +K+EHYTE DRFI +  F  K++DLIF KFG
Sbjct: 423 NYDEILTKLSE-NTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFG 481

Query: 516 G-------NDYPKAXXXXXXXXXXXXNRTHGLLSLLRDQPRLFKQAIVTCXXXXXXXXXX 568
                   N+YPK              RT  LLS   + PRLFKQAIVTC          
Sbjct: 482 STATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTCPNLPLPELLN 541

Query: 569 XXFSIRNRELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQNFIECITNTE----EDGPLE 624
              +I+N EL LDIS R+LQD+++DSIKQE++ L +L+I+NFI+ I N E    ++ P  
Sbjct: 542 ELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQNSP-- 599

Query: 625 GFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLIDIKGS 684
                               IGLF+L   +LENL+ YID+QV I E+NTELW LID   +
Sbjct: 600 --------QLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNN 651

Query: 685 -------QHGFATLSSGSTT-------------SQKQALPAYAMEYLDI 713
                   + F++ S+ + +             +QK+ALP Y+++YL++
Sbjct: 652 IFSHNKKDNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  502 bits (1293), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 310/739 (41%), Positives = 442/739 (59%), Gaps = 67/739 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSN+SLQ DY+QVA  TF   TN +TL            NPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 61  PKLTFDYPIPSTNVITACSAA----EVQ-----VNVEEDLKISNDDSNDEEKAANSQ--- 108
           PKL F+  IPSTN +TA + +    EV+     V  ++   +  D+    E+ + ++   
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 109 -TKRNIEIWSFGSMVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDF---- 163
            TKR++E+W++G + NK N TLN++ K                        G D+F    
Sbjct: 121 VTKRSVELWAYGLVANKSN-TLNISVKT----------------------TGLDEFSTTP 157

Query: 164 ---LSQHKIKTKAKVMNIKIDAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAK 220
              + +  IK  +KV+NIKI  +   I+ VL+NGL++ +D  L L  S DI+Y+++++ +
Sbjct: 158 GEIIRKKTIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQ 217

Query: 221 WFTENGTDFVFVLCPLEDDK--VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLC 278
            FTE+  +F+ +L  ++++K  VC+K+ +L      D++ + ELS +I++ F    SKL 
Sbjct: 218 HFTESKQNFLLILSNIDEEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLS 275

Query: 279 YQFGKLYKLNQGKIYVYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNI 338
           YQFGKLY+L   +++VYSLP CQL Q I L  I  +    D+ S +PV+ NR++L +NN+
Sbjct: 276 YQFGKLYRLTGSELFVYSLPQCQLLQNISLAEIFPNTI--DVSSIKPVANNRLVLAINNV 333

Query: 339 IYLLDLLHCSILNHRELTHVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEI 398
           +YL+D LH SIL  RE THVKTFQLL+SA I  + +   +TIAIG+STK+GP   S+LE+
Sbjct: 334 VYLIDTLHRSILAEREFTHVKTFQLLQSATI-GDSNITQRTIAIGVSTKSGPTSASALEL 392

Query: 399 INIDVGTNTLKDSLGKSFQVGKNDAS-VILKPLFDDEDVTNNM-VKRNDIDGNINVPIFH 456
           INI+VG+ TLKDSLGK      ++ S   LKPLFD+ D  + +    +DI    NV  F+
Sbjct: 393 INIEVGSGTLKDSLGKGVSKKLSEGSHSDLKPLFDENDEKSLIGTPVHDIS---NVKSFN 449

Query: 457 YDEVIEKLSVLKNND-IASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFG 515
           ++++   L+ LK++D I+ FD+ FF  L++KE HYTE DRFISD  F+   +DLIF KF 
Sbjct: 450 FNKI---LADLKSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKF- 505

Query: 516 GNDYPKAXXXXXXXXXXXXNRTHGLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRN 575
             ++PKA              T GLL  L+D PRLFKQAIVTC            F+++N
Sbjct: 506 DTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKN 565

Query: 576 RELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQNFIE-CITNTEEDGPLEGFNHNHXXXX 634
            EL LDIS RVLQD++R+ +KQE+KKL  +DI+NFIE  IT T E+         +    
Sbjct: 566 GELTLDISLRVLQDYSRNDVKQEIKKLDNVDIENFIEFIITPTTEEI------QTNTPQL 619

Query: 635 XXXXXXXXXXIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSG 694
                     IGLF+L+G LLE L+ YI++QV IAER++ELW+L+D   +   F      
Sbjct: 620 FQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLK 679

Query: 695 STTSQKQALPAYAMEYLDI 713
           S    K+ L  Y+++YLDI
Sbjct: 680 SVIGNKETLSVYSVDYLDI 698

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  495 bits (1275), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 301/713 (42%), Positives = 421/713 (59%), Gaps = 61/713 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           M S+SQPFRL  LPKIASL+NFS Q DY+QVA+ T   S N I +            NPT
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVAN-TLTPSANKINIGVSGSSISQYIINPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL  +  IPST+++TAC  +E+Q N                   +++T+   E+W +  
Sbjct: 60  PKLVHNLSIPSTSIVTACDVSEIQQN-----------------EGDTETQ---EVWCYAL 99

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
           + NK  +TLN   K L ++  + N               +      +K+  K KV ++KI
Sbjct: 100 VANKS-FTLNTIIKPLTADAPSVN---------------STQTFENYKVSIKHKVASVKI 143

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFT-ENGTDFVFVLCPLEDD 239
                 IIAVLQNGL++ +D +LKLL+S DISY N+   K+FT E   DF+ VL  L DD
Sbjct: 144 FPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDD 203

Query: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPH 299
           KVCYK+ E+   +S  N P+KEL+S I+EGFS ++SK  YQFGK+Y L+ GKI +YSLPH
Sbjct: 204 KVCYKLFEIIHHDS--NVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPH 261

Query: 300 CQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVK 359
            QL   I LP +    + ++++SF+P+S NR LLTV+N IYLLDLLH +IL+ RELTHVK
Sbjct: 262 FQLSNTINLPFV----THENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVK 317

Query: 360 TFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
           TFQLL +A+I    + N+KTIAIG+STK+  N TS+L+I+NI+VG+ TLKDS+ K F + 
Sbjct: 318 TFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGF-LT 376

Query: 420 KNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIF 479
           ++    +L  LFD++D   +    +  D         Y++++ +L   K+     FD +F
Sbjct: 377 QDATEEVLNSLFDEQDDELDEDGTSQFD---------YNQILSELEKAKSK-TEKFDNVF 426

Query: 480 FNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTHG 539
           F  L +K+E+YTE DRF +  GFL+KVL LIF  F   +YP+A                 
Sbjct: 427 FKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENF-NKEYPRALTYLLTHPLFPAKHATC 485

Query: 540 LLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEM 599
           LLS  ++ PRLF+QAIVTC            F++ N EL LD+S R+LQDFT+DSIKQ +
Sbjct: 486 LLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSI 545

Query: 600 KKLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENLT 659
           KK+SK+DI NFI  + N ++D       +                IGLF+L+G  LENL 
Sbjct: 546 KKMSKVDINNFIGFVINEDDDEE----RNKSKPQLFQLLNLVLDSIGLFALDGESLENLH 601

Query: 660 LYIDKQVKIAERNTELWNLI-DIKGSQHGFATLSSGSTTSQKQALPAYAMEYL 711
            +I+ QV I E+N EL NL+ D         +  S S+++ +QALP+Y++EYL
Sbjct: 602 QFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTTEQALPSYSVEYL 654

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  479 bits (1233), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 283/720 (39%), Positives = 426/720 (59%), Gaps = 49/720 (6%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASL NFS +  Y++VAD +F   +N++ L             PT
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVAD-SFTPDSNSVLLGISGSSISKYVITPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQ--VNVEEDLKISNDDSNDEEKAANSQTK--RNIEIW 116
           P+L F+ PIPST++++AC+         V  D + + D++ D    + +  +  ++ EIW
Sbjct: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIW 119

Query: 117 SFGSMVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVM 176
            +    N   +TLN   + +++N    N  + E++              Q   K K +++
Sbjct: 120 CYALSANNKTHTLNCLIREVDNN----NTSITENN-------------PQFNAKFKEQII 162

Query: 177 NIKIDAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPL 236
           NI++D K+ +I+ + + GL++FYDL+LKLL S +  Y ++K  K F ENG +++ ++  L
Sbjct: 163 NIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDL 222

Query: 237 EDDKVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYS 296
           +D KV  ++ E+S  E K    +KEL+S+IIE F+ + S LCYQFG++Y+L + +I VYS
Sbjct: 223 KDQKVALQLYEVSTEEKK----VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYS 278

Query: 297 LPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELT 356
           +P  QL   +++P +++   ++ LIS +P++ NR+LLTV N IYLLDLLH SIL+ RE++
Sbjct: 279 IPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVS 338

Query: 357 HVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSF 416
           H+KTFQ+LK+A+ + + S +  T+A+GISTKNG NPTS+LEIINIDVG+N+LKDSLGKSF
Sbjct: 339 HMKTFQILKTAM-NRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSF 397

Query: 417 QVGKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKN-NDIASF 475
               N     LK LF +                  +P  ++ E++ K   LKN N    F
Sbjct: 398 LRRNNQIQGQLKNLFPEPKY--------------ELPSINFPEILGK---LKNANSAEKF 440

Query: 476 DEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGN-DYPKAXXXXXXXXXXXX 534
           DE FFN L +KEE +TE  RF++D  FL  VLDLIF K   N   P++            
Sbjct: 441 DETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPK 500

Query: 535 NRTHGLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDS 594
            +  GLL+ ++   RLFKQAIVTC            F+I+N EL++DIS R+LQD+T+D+
Sbjct: 501 EKAIGLLTKVKSNSRLFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDA 560

Query: 595 IKQEMKKLSKLDIQNFIECITNT-EEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGA 653
           IK+E+KKL ++ ++NF+  I      +  +  F                  IGLF LE +
Sbjct: 561 IKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTM-FTPQIFKLLSLILDSIGLFGLEES 619

Query: 654 LLENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
           +L  L+  I+K+VKIAERN ELWN++D K      ++ ++ S  ++    P Y +EY+DI
Sbjct: 620 ILIQLSSIIEKEVKIAERNVELWNIMDAKMLSVKKSSSTAASKLAENSQTP-YIVEYIDI 678

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  473 bits (1216), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/716 (39%), Positives = 418/716 (58%), Gaps = 69/716 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPS+SQPFRL  LPKIASL+N++ Q +Y+QVAD T   +TNNI +            NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVAD-TLTPTTNNINVGVSGSAVSQYIINPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL ++ PI STNV++AC+ AE+    E+D +                     E+  +G 
Sbjct: 60  PKLVYNQPISSTNVVSACAVAEITTTSEKDSQ---------------------EVICYGI 98

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
             N+  Y+L  T K + S  +        DS     +A        HK+    +++N+K+
Sbjct: 99  QSNRV-YSLCATIKPVSSTAS--------DSSFGETYAA-------HKVSVSDQIVNLKV 142

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFT-ENGTDFVFVLCPLEDD 239
                 I+AVL++GLI+F+D +LKL +S D SY N+ Y + FT E+G  + F+L  ++  
Sbjct: 143 FPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGH 202

Query: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPH 299
           KV +K+ E+   +S   +P  ELSS I+E    + S++ YQFG++Y+L+   + +Y+LPH
Sbjct: 203 KVSFKLFEIG--QSDSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPH 260

Query: 300 CQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVK 359
            Q  + IELP +    + + +ISF+P+S NR LLT +N I+LLDLLH +IL+ RE+ HVK
Sbjct: 261 FQHSRTIELPFL----APESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVK 316

Query: 360 TFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
            FQLL++A+I    + N+KTIA+G+S K+G NP+SSL+IINIDVGT TL+DS+GK F + 
Sbjct: 317 IFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGF-MS 375

Query: 420 KNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIF 479
           + + S  L+PL         +   ND +       F+YD ++++LS   +N I +FD +F
Sbjct: 376 RENKSQHLQPL---------ISTLNDTEA----AEFNYDRILKELSKAADN-IENFDSVF 421

Query: 480 FNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTHG 539
           F  L +K  +YT+ DRF++D  FL  V  LIF  F  ++YPKA            + TH 
Sbjct: 422 FKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSF-KSEYPKALTYLLTNPLFPVSHTHN 480

Query: 540 LLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEM 599
           LL  L+D PRLFKQAIVTC            F++ N EL LD+S R+LQDF +DSIK+ +
Sbjct: 481 LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI 540

Query: 600 KKLSKLDIQNFIECIT--NTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLEN 657
           K+ SK+D+ NFI  +   N EED         +              +GLF+LE  +LE 
Sbjct: 541 KQKSKIDVNNFINFVISENFEED------RIKNKPRLFQLLSLVLDSVGLFALENEMLEK 594

Query: 658 LTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
           LT YID+Q+ + + N EL+NL++ K  ++GF      ++TS +  + AY++E L++
Sbjct: 595 LTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  444 bits (1142), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 269/716 (37%), Positives = 410/716 (57%), Gaps = 74/716 (10%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           M S+SQPFRL+ LPKI SL+N++ Q DY+QV D   + S N + +            NPT
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL F+ PIPSTN++TAC   E                     AAN+      E+W +G 
Sbjct: 60  PKLVFNLPIPSTNIVTACDVVE--------------------DAANT------EVWCYGL 93

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
              K ++    T  M++   ++SN  +                 SQ K K K++V++IKI
Sbjct: 94  EARKVSHLHLATKPMIQDAVSSSNAEIT----------------SQFKYKLKSEVVSIKI 137

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTE-NGTDFVFVLCPLEDD 239
            +K   ++ +L+NGLI+ +D +LKL  + DISYD++++ ++F +  G DF FVLC L D+
Sbjct: 138 YSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQDGQGNDFFFVLCQLSDE 197

Query: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKL-NQGKIYVYSLP 298
           K+CYK+ ++    S+  S I EL+S I+E ++ E++KLC++FGKLY L N  ++ +Y LP
Sbjct: 198 KICYKLFQV---RSESVSCI-ELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLP 253

Query: 299 HCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHV 358
           H QLQ  I+LP I+K    D ++S +PVS NR+LLT +N IYL+DLL+ +IL  ++L ++
Sbjct: 254 HLQLQTSIQLPFISK----DAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNI 309

Query: 359 KTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQV 418
           K  QLL +A++      N KTIA+ ++TKNG NPTS L++INIDVGT TLKD++GK F V
Sbjct: 310 KAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMV 369

Query: 419 GKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEI 478
            +      L+ LF++ +           D ++ +P   Y+ +I++L + K   I +FD I
Sbjct: 370 KQKQK---LQKLFEESNE----------DDDVELPSPDYERIIKQLHICKK--IENFDSI 414

Query: 479 FFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTH 538
           FF  L + +E+YT+ DRF++D   L +++D +FL F  ++YPKA                
Sbjct: 415 FFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNF-KDEYPKALTYLLTHPLFPPVHAK 473

Query: 539 GLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQE 598
           GLL+ L++ PRLFKQAIVTC            F+I N EL  DI+ RVLQD+ ++SIK  
Sbjct: 474 GLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAG 533

Query: 599 MKKLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENL 658
           ++K+ K+DI NF++ I N+ +       N                 IGLF+L+   LE L
Sbjct: 534 IRKIEKMDITNFLDMILNSNKADSDLKLNKPQ---IFQLMSLIIDSIGLFALDDEYLEKL 590

Query: 659 TLYIDKQVKIAERNTELWNLID--IKGSQHGFATLSSGSTTSQKQALPAYAMEYLD 712
           + ++D QV +  +N EL +L +   K S       +S + +S  Q + AY ++YL+
Sbjct: 591 SSFVDAQVSVVSQNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPISAYTVDYLE 646

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  442 bits (1137), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 267/720 (37%), Positives = 402/720 (55%), Gaps = 79/720 (10%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           M  ++QPFRLA LPKI+SL+N++ Q  Y+QVAD     ++N +T+            NPT
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPTSNTVTVGVSGSSISQYVINPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL ++ PIPSTNV+T C           D+   +D +               E+WS+  
Sbjct: 60  PKLVYNIPIPSTNVVTGC-----------DVLAMSDGA---------------ELWSYAL 93

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
             N   +TL+   +   +          E  +D    A  D+   Q     K +V+ ++I
Sbjct: 94  TANGKVHTLHAVLRKAGAAPQ-------ETGLD----ASEDEHFKQ---TLKGRVVRVRI 139

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTEN-GTDFVFVLCPLEDD 239
            +    I+ VL  GLI+ YD +L+LL+S DISY N+   ++FT++ G D++FVLC +++ 
Sbjct: 140 LSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNK 199

Query: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPH 299
           K CYK+ +L+   S +N PI EL+S I+E F+   SK+ YQFGKLY+L   K+YVYSLPH
Sbjct: 200 KTCYKLFQLN--HSAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPH 257

Query: 300 CQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVK 359
            QL   + LP + K    DD +S Q +S NR+LLT  N I+LLDLLH +IL  REL+++K
Sbjct: 258 FQLSHCVPLPFVRK----DDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIK 313

Query: 360 TFQLLKSALI-DSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQV 418
            FQLL++A+I  +    +++T AIG+STK G NP+S+L+++ I VGT TLKDSLGK F  
Sbjct: 314 FFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLS 373

Query: 419 GKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEI 478
           G++  +  LKPLF  +D         D   NI+     +  ++ +L+        +FD I
Sbjct: 374 GEHRRTEALKPLFGTDD---------DESPNID-----FAAILAELT--SRTTPKAFDSI 417

Query: 479 FFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTH 538
           F+  L  K+E+YTE DRFI++  FL  +LD IF  F  +++PKA            + T 
Sbjct: 418 FYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFA-DEFPKALIYLLTHPLFPSSHTK 476

Query: 539 GLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQE 598
           GLL  L+  PRLFKQA+VTC            F++ N EL LD+S RVLQ+FT++ IKQ 
Sbjct: 477 GLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQG 536

Query: 599 MKKLSKLDIQNFIECI----TNTEEDGPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGAL 654
           +++LS++D+ NF+  +    T+ EE                         +GL +LEG +
Sbjct: 537 IRELSRVDLHNFLNFVIKDSTDVEE-------RQKAKPQLFQLLSLVIDAVGLLALEGDI 589

Query: 655 LENLTLYIDKQVKIAERNTELWNLIDIKGSQHG--FATLSSGSTTSQKQALPAYAMEYLD 712
           L  L+ +ID QV +A++  EL  L++   ++ G    +++    +     +P Y++EYLD
Sbjct: 590 LHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  257 bits (657), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 222/393 (56%), Gaps = 20/393 (5%)

Query: 321 ISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKTFQLLKSALIDSEKSHNSKTI 380
           +SF P+S+NR LLT +N +YLLDLLH +IL+ RE THVKTFQLL +A+I    S N+ TI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 381 AIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGKNDASVILKPLFDDEDVTNNM 440
           AIG++TK G   TSSL+++NIDVGT TLKDS+GK F   K         L    D     
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDT---- 116

Query: 441 VKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFFNDLKVKEEHYTEKDRFISDP 500
                      V   +Y ++++ L+  K+N    FD +FF  L +K ++YT+ DRF++D 
Sbjct: 117 ----------EVQEHNYTQILKDLAKTKSNS-DKFDSVFFKKLNIKNDYYTDSDRFLNDQ 165

Query: 501 GFLNKVLDLIFLKFGGNDYPKAXXXXXXXXXXXXNRTHGLLSLLRDQPRLFKQAIVTCXX 560
            FL   L LIF  F  ++YPKA              TH LL  L+D PRLFKQAIVTC  
Sbjct: 166 EFLGNSLKLIFENF-QSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPN 224

Query: 561 XXXXXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQNFIECITNTEED 620
                     F++ N EL LD+S R+LQDF++DSIK  +K+ SK+D+  FI  + N   D
Sbjct: 225 LPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVD 284

Query: 621 GPLEGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLID 680
                    +              +GLF+LE   L+ L+ YID+Q+ + ++N +L+NL+D
Sbjct: 285 ED----RVKNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVD 340

Query: 681 IKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713
            +  ++      + S +  + A+ AY++E L++
Sbjct: 341 ERNFKNILGQHHADSLSVGEGAITAYSVEQLEL 373

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  221 bits (563), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 182/575 (31%), Positives = 289/575 (50%), Gaps = 79/575 (13%)

Query: 164 LSQHKIKTKAKVMNIKIDAKNSLIIAVLQNGLIEFYDLKL-KLLYS------FDISYDNL 216
           L+  K+  ++K+M  K+ +  S  I +L+NG IE YD  L K  Y        ++ +   
Sbjct: 89  LNGKKVPIQSKIM--KLFSDESQTITILENGTIEKYDSNLIKSTYKTPHKDLVNVEFIES 146

Query: 217 KYAKWFTENGTDFVFVLCPLEDDKVC-YKMLELSDFESKDNSPIKELSSTIIEGFSFESS 275
           KYA   ++N      +   +E   V   + +  SDF+S D                    
Sbjct: 147 KYALLISQNSISLYDINTMIELRNVANVQDIVDSDFKSLD-------------------- 186

Query: 276 KLCYQFGKLYKLNQ--GKIYVYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILL 333
                 GKLY+ NQ   K  ++ +    +  II +P IN  + E D++SF  V  N +++
Sbjct: 187 ------GKLYQFNQKLSKFDIWEISSMTIVNIITIPFIN--DVEKDVVSFTVVDDNCVVM 238

Query: 334 TVNNIIYLLDLLHCSILNHRELTHVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPT 393
            VN+ IY L+L   S+++  EL ++K F+L+ +          S    +G+S  N     
Sbjct: 239 AVNSTIYALNLHLSSVISMSELLNLKWFKLIDNL---------SNQFVLGLSFNNE---N 286

Query: 394 SSLEIINIDVGTN-TLKDSLGKSFQ---VGKNDA--SVILKPLFDDEDVTNNMVKRNDID 447
              E+IN+D+ +N  LKDSLGK F+   V K     +++LK LF  ++   ++   ND D
Sbjct: 287 YKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDL--HNDSD 344

Query: 448 GNINVPIFHYDEVIEKLSVLKNNDIASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVL 507
            ++    F+YD++I  L+    N  + FD+IFF    +K+EHYTE DRF+ +  FL KV+
Sbjct: 345 SDVE-HTFNYDKIIVDLNKAVKNP-SKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVI 402

Query: 508 DLIFLKFG----GNDYPKAXXXXXXXXXXXXNRTHGLLSLLRDQPRLFKQAIVTCXXXXX 563
           +LI   +     GN+YPK             + T  LL   R+ PRL+KQAIVTC     
Sbjct: 403 ELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPL 462

Query: 564 XXXXXXXFSIRNRELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQNFIECITNTEEDGPL 623
                  F+I N EL LDIS RVLQD+T+DSIK+++K L K+DI+NFIE +T  E+    
Sbjct: 463 GELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDED---- 518

Query: 624 EGFNHNHXXXXXXXXXXXXXXIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLIDIKG 683
                                IGLF+L+  +L  ++ +I+++  +A++N+EL +L+D   
Sbjct: 519 ----QQVSSQLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNP 574

Query: 684 SQHGFATLSS-----GSTTSQKQALPAYAMEYLDI 713
           S+   A  SS      + +  ++ LP Y +E+LD+
Sbjct: 575 SKQSSARQSSKLINNNNKSLHRKTLPTYTVEHLDL 609

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 1  MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
          MPS+SQPF + T+PK +S S        + V+  +   ++N++ +            NPT
Sbjct: 1  MPSISQPFAITTVPKQSSTSP-------IIVSSHSLTANSNSLDVAISKYAVSKFVINPT 53

Query: 61 PKLTFDYPIPSTNVITA 77
          PKL    PIPS  V+TA
Sbjct: 54 PKLINSIPIPSNEVVTA 70

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  214 bits (545), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 182/617 (29%), Positives = 301/617 (48%), Gaps = 88/617 (14%)

Query: 127 YTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADD------FLSQ-HKIKTKAKVMNI- 178
           Y +N T K++ S    SN  L   + D+  +A   +      +L + H+I  K+ V+N  
Sbjct: 49  YIINPTPKLVNSKAIPSN--LTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCL 106

Query: 179 --KIDAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPL 236
             KI  ++ +  A+LQ+G ++ Y    + +++  +   ++K  ++      D  + L   
Sbjct: 107 SEKIHDESVVTTAILQDGTVQKYKGG-EQVFAKHLPLKDIKQVEFI-----DGQYALIVA 160

Query: 237 EDDKVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQ-FGKLYK--LNQGKIY 293
                 Y++  L++           +S+T+     FE  K   Q  GK+Y+  L      
Sbjct: 161 AQSTALYELENLTELR---------VSTTL----HFEQFKQIRQHLGKIYQFDLATNDFK 207

Query: 294 VYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHR 353
           ++ L       ++ +P +  S S+   ++F  V  +R+ L + N IYLLDL   S+L+H 
Sbjct: 208 IFELTTLNEIGVVNIPFL--SASKGAPLTFTVVGDSRVCLALANEIYLLDLHLGSVLSHN 265

Query: 354 ELTHVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTS-SLEIINIDVGTNTLKDSL 412
           +   +K  +L+  A           + AI +S  +GP   + SL+IIN+++G+ ++KDSL
Sbjct: 266 KFAQLKQVELIAGA--------RDGSFAIALS--HGPQDNAVSLDIINLELGSRSIKDSL 315

Query: 413 GKSFQV-----GKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVL 467
           GK F          ++ V L+P+ D  D T    KR+          F Y  +++KL+  
Sbjct: 316 GKGFATFMKERRSAESQVTLRPILDAGDKT----KRS----------FDYASILKKLTA- 360

Query: 468 KNNDIASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFG---GNDYPKAXX 524
              D A FD+IFF +L + +E YTE DRFI D  FL++ + +I   +     + YP A  
Sbjct: 361 AAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFT 420

Query: 525 XXXXXXXXXXNRTHGLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISF 584
                     ++T  LLS ++  PRL+KQ IVTC            F I N EL LD+S 
Sbjct: 421 YLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSL 480

Query: 585 RVLQDFTRDSIKQEMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHXXXXXXXX------ 638
           ++LQD+T+DSIK+EMK L ++++ NFI+ +            N+N+              
Sbjct: 481 KILQDYTKDSIKKEMKALPRVNVTNFIKFVIG----------NYNNSDESSVATPQLFQL 530

Query: 639 -XXXXXXIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFA-TLSSGST 696
                  IGLF+L+G LL  L  YID  VKIAE NTELWNL++ + ++   A +  S   
Sbjct: 531 LSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYV 590

Query: 697 TSQKQALPAYAMEYLDI 713
            +QK+  P Y +++L+I
Sbjct: 591 KTQKKVFPPYLVDHLEI 607

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 7/75 (9%)

Query: 3  SLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPTPK 62
          S+SQPF +A +P+ AS +        V ++  +   + N + +            NPTPK
Sbjct: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 63 LTFDYPIPSTNVITA 77
          L     IPS   +TA
Sbjct: 57 LVNSKAIPSNLTVTA 71

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  135 bits (339), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 129/248 (52%), Gaps = 36/248 (14%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPS+SQPFRL  LPKIASL+N++ Q  Y+QVAD T   +TN + +            NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVAD-TLTPATNRVNVGISGSAISQYVINPT 59

Query: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120
           PKL ++ PI STNV+TAC  AEV              +N+E       T    E+  +  
Sbjct: 60  PKLVYNLPISSTNVVTACDVAEVA------------GTNNEG------TAEAHEVLCYAL 101

Query: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180
             NK  +++    K + S           DS     +A        HK+    + +N+K+
Sbjct: 102 QANK-TFSICAVKKPIPS--------AATDSSFGETYA-------THKVALANQAVNVKV 145

Query: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWF-TENGTDFVFVLCPLEDD 239
                 I+AVL +GLI+F+D  LKL +S D SY N+++ + F +E+  DF+F+L  L+  
Sbjct: 146 FPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYGNVQFVQHFVSESKQDFMFLLSDLDGR 205

Query: 240 KVCYKMLE 247
           KV +K+L+
Sbjct: 206 KVSFKLLK 213

>ZYRO0E08074g Chr5 complement(633136..634914) [1779 bp, 592 aa] {ON}
           similar to uniprot|P38687 Saccharomyces cerevisiae
           YPL243W SRP68 Component of the signal recognition
           particle (SRP) ribonucleoprotein (RNP) complex that
           functions in protein targeting to the endoplasmic
           reticulum (ER) membrane
          Length = 592

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 646 GLFSLEGALLENLTLYIDKQVKIAERNTELWNLIDI 681
           GL+ L+G  LE+L L++D   K+ ER TE+ N  DI
Sbjct: 420 GLYQLKGRYLESLALHVDAHQKLEERLTEMGNFQDI 455

>NDAI0K01250 Chr11 (283367..284596) [1230 bp, 409 aa] {ON} Anc_8.696
           YPL168W
          Length = 409

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 12/96 (12%)

Query: 397 EIINIDVGTNTLKDSLGKSFQVGKNDASVILKP---LFDDEDVTNNMVKRNDIDGNINVP 453
           ++IN D+    LK+   K++  G+   S I KP   LF+   ++NN++ R  +D  IN  
Sbjct: 214 KLINEDIQKKKLKELQWKTYNWGQVVESPIFKPGSTLFEQYRLSNNILLR-IVDKVINAR 272

Query: 454 IFHYDEVIEKLSVLKNNDIASFDEIFFNDLKVKEEH 489
            + Y+      +  +NN+IA    IF  DLK K  H
Sbjct: 273 NYLYN------NKARNNNIAKEYLIF--DLKDKSRH 300

>TPHA0J02140 Chr10 complement(479106..480911) [1806 bp, 601 aa] {ON}
           Anc_6.174 YGL095C
          Length = 601

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 28/43 (65%)

Query: 250 DFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKI 292
           D ++ +N PI+++   ++ G +FE S+L ++F +  K ++G I
Sbjct: 538 DKKASNNYPIQDVVIFMVGGVTFEESRLVHEFNEAMKSSEGNI 580

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,883,110
Number of extensions: 3656211
Number of successful extensions: 14995
Number of sequences better than 10.0: 101
Number of HSP's gapped: 15524
Number of HSP's successfully gapped: 104
Length of query: 713
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 596
Effective length of database: 40,065,477
Effective search space: 23879024292
Effective search space used: 23879024292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)