Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4383.487ON31331316020.0
Suva_7.4153.487ON31331313270.0
YGR127W3.487ON31231313080.0
Smik_6.2233.487ON31331312960.0
NCAS0E008403.487ON3363258011e-105
NDAI0G009703.487ON3323397569e-99
CAGL0I10582g3.487ON3193247358e-96
KAFR0C019303.487ON3133236826e-88
SAKL0F02882g3.487ON2983166755e-87
KNAG0B008403.487ON3133236392e-81
Kpol_1017.93.487ON3103216219e-79
TDEL0D055503.487ON3103166141e-77
KLLA0E04687g3.487ON3063215852e-73
TPHA0D032603.487ON3143245792e-72
KLTH0F14718g3.487ON3003165201e-63
ZYRO0D10098g3.487ON2762615172e-63
Kwal_55.212173.487ON3033085122e-62
Ecym_12423.487ON3113235043e-61
AFR305W3.487ON3093234931e-59
TBLA0D029903.487ON3183204837e-58
SAKL0A03762g6.242ON693100810.16
Suva_16.846.242ON689103731.1
Skud_16.566.242ON689103702.6
Smik_4.5955.386ON122473703.2
YDR335W (MSN5)5.386ON122473703.2
Suva_2.5055.386ON122473677.1
CAGL0D02882g5.230ON66773677.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.438
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   621   0.0  
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   515   0.0  
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   508   0.0  
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   503   0.0  
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   313   e-105
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   295   9e-99
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   287   8e-96
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   267   6e-88
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   264   5e-87
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   250   2e-81
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   243   9e-79
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   241   1e-77
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   229   2e-73
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   227   2e-72
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   204   1e-63
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   203   2e-63
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   201   2e-62
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   198   3e-61
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   194   1e-59
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   190   7e-58
SAKL0A03762g Chr1 (348183..350264) [2082 bp, 693 aa] {ON} simila...    36   0.16 
Suva_16.84 Chr16 (139477..141546) [2070 bp, 689 aa] {ON} YPL222W...    33   1.1  
Skud_16.56 Chr16 (103657..105726) [2070 bp, 689 aa] {ON} YPL222W...    32   2.6  
Smik_4.595 Chr4 (1067533..1071207) [3675 bp, 1224 aa] {ON} YDR33...    32   3.2  
YDR335W Chr4 (1141168..1144842) [3675 bp, 1224 aa] {ON}  MSN5Kar...    32   3.2  
Suva_2.505 Chr2 (898544..902218) [3675 bp, 1224 aa] {ON} YDR335W...    30   7.1  
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    30   7.3  

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/313 (96%), Positives = 302/313 (96%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 61  GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN 120
           GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN
Sbjct: 61  GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN 120

Query: 121 TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW 180
           TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW
Sbjct: 121 TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW 180

Query: 181 KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT 240
           KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT
Sbjct: 181 KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT 240

Query: 241 IYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV 300
           IYV           GASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV
Sbjct: 241 IYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV 300

Query: 301 ATPKEEKRFEFKL 313
           ATPKEEKRFEFKL
Sbjct: 301 ATPKEEKRFEFKL 313

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/313 (77%), Positives = 275/313 (87%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCILMATRAHP YELILISNRDEFL RKTHATCWHNDDFILSPYD+AKTS EKQIFGTWS
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 61  GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN 120
           GIN+EGKLATILNLK+D QR   KSKSRG+LPFTFL++HKA FQ+WD+Y+KFE +YDGL 
Sbjct: 61  GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR 120

Query: 121 TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW 180
           TTGDFNFFYGDVIEK+YK+IDSLG TF+VL STC+ + +SYM +SNG+++NS SISEQAW
Sbjct: 121 TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW 180

Query: 181 KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT 240
           +KVK+ARD LE L+L NI+SDEET+ISNCFQLASKSS+P T  KP+ LQML DPNV MNT
Sbjct: 181 EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT 240

Query: 241 IYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV 300
           IYV           GASIPDGDYYGTRSQIVLLVSK+SSKVTFIER+LYSSDEDV+HYS 
Sbjct: 241 IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA 300

Query: 301 ATPKEEKRFEFKL 313
           + PKEEKRFEF+L
Sbjct: 301 SAPKEEKRFEFEL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/313 (77%), Positives = 274/313 (87%), Gaps = 1/313 (0%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHN+DFILSPYDLAKTS EKQIFGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 61  GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN 120
           GIN+EGKLATILNLKLD +++  KS+SRGLLPF FLS HKADF++WDNY KFE +YDGL 
Sbjct: 61  GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK 120

Query: 121 TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW 180
           +TGDFNFFYGDVI+KQYK+IDSLGRTF+VL STC+ +L+SYM VSNG+FY+S SI  QAW
Sbjct: 121 STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW 180

Query: 181 KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT 240
           +KVKVARD LE LVL NI+SDEE IIS+CFQLASKSS+P T S P+ LQM+ DPNV MNT
Sbjct: 181 EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMV-DPNVTMNT 239

Query: 241 IYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV 300
           IYV           GASIPDGDYYGTRSQIVLLVSK+S++VTFIER+LYSSDEDV  YSV
Sbjct: 240 IYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSV 299

Query: 301 ATPKEEKRFEFKL 313
            +PKEEKRF+FKL
Sbjct: 300 TSPKEEKRFKFKL 312

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  503 bits (1296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/313 (76%), Positives = 270/313 (86%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLA+TSKE Q FGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 61  GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN 120
           GIN+EGKLATILNLKL  +R TIKSKSRGLLP+ FLS H+A+F++WD+Y KF  +YDGL 
Sbjct: 61  GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK 120

Query: 121 TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW 180
            TGDFNFFYGDVIEKQYK+IDSLGRTF+VL STC+ +L+SYM +SNG FYN+ SI E+AW
Sbjct: 121 ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW 180

Query: 181 KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT 240
           +KVK+ARD LE LV  NI  DEETIIS+CFQLASKSS+PGT SKP+ LQML DPNV M+T
Sbjct: 181 EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST 240

Query: 241 IYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV 300
           IYV           GASIPDGD+YGTRSQIVLL+SK+S+K TFIERI+YSSDEDV  YSV
Sbjct: 241 IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV 300

Query: 301 ATPKEEKRFEFKL 313
           + PKEEKRFEF+L
Sbjct: 301 SAPKEEKRFEFEL 313

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  313 bits (801), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 207/325 (63%), Gaps = 24/325 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSK--EKQIFGT 58
           MCIL+AT AHP YELILISNRDEF  RKTH +CWHNDDFILSP+D+AK+ +  EK+IFGT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 59  WSGINREGKLATILNLKLDGQRDT---IKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMN 115
           W GINR+ K+ATILNLKL+ Q D    +K +SRG++PF FLS H +DF  WD Y+KF+  
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136

Query: 116 YDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSI 175
           Y+ L  TGDFNFFYGD +  +Y++IDS G TF VL        + Y+ VSN  F      
Sbjct: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG------DPYLTVSNDMFATGGIT 190

Query: 176 SEQA-------WKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSV-PGTASKPNA 227
            E+A       W+K+K  +  L+ LV  +   DE+ +I  CF+LAS  SV P   +K N 
Sbjct: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQ 250

Query: 228 LQMLADPNVIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERI 287
              L      M TI+V           G S+  G YYGTRSQIV+L+SKN  +V  +E I
Sbjct: 251 NSTLP-----METIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHI 305

Query: 288 LYSSDEDVNHYSVATPKEEKRFEFK 312
           LY+SD D+ HYS   PKE K FEFK
Sbjct: 306 LYTSDNDIQHYSSTNPKEVKSFEFK 330

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  295 bits (756), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 158/339 (46%), Positives = 209/339 (61%), Gaps = 35/339 (10%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSK--EKQIFGT 58
           MCIL+AT AHPDYELILISNRDEFL RKTH +CWHNDDFILSPYD+AK  K  +K++FGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 59  WSGINREGKLATILNLKLDGQ---RDTIKSKSRGLLPFTFLSTHKAD-FQNWDNYDKFEM 114
           W GIN++GK+AT+LNLKL+     +  +  KSRG+LPF +LS    D F  WD YD F  
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 115 NYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPS 174
            Y GL +TGDFN FYGDV  KQY+++DS+G T + L+S C+     Y+ VSN  F  +  
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-----YLVVSNDVFTCNGQ 175

Query: 175 ISE------------------QAWKKVKVARDGLEKLVLGNI--DSDEETIISNCFQLAS 214
           + E                  + W KVK+    L+ LV  +I    DE+TIIS CF+L+S
Sbjct: 176 LGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS 235

Query: 215 KSSVPGTASKPNALQMLADPNVIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLV 274
             SV    +  +  +   +  +   TI V           G S+P G+YYGTRSQIV+L+
Sbjct: 236 TCSV----TVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILI 291

Query: 275 SKNSSKVTFIERILYSSDEDVNHYSVATPKEEKRFEFKL 313
            + + +V F E ++Y+SD D+  +S A PKE  RF+F L
Sbjct: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  287 bits (735), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 204/324 (62%), Gaps = 17/324 (5%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAK--TSKEKQIFGT 58
           MCIL ATR HPDYELI+ISNRDEFL RKTH+TCWHNDDFILSPYDLA+    +    FGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 59  WSGINREGKLATILNLKLDGQRD---TIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMN 115
           W+G+NR+G++AT+LNL++  + D    I  +SRG LPF FL+  + +F++WD Y KF   
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 116 YDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCK------SNLNSYMAVSNGEF 169
           Y  +  TGDFN FYGD  E +Y LIDSLG T  +     K      +N++  + + + + 
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180

Query: 170 YNSPSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQ 229
            + P    + W K+K  +  +E+ V  N +  +E +I NCF+LAS + +    ++     
Sbjct: 181 NSGP----EEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITE--EFD 234

Query: 230 MLADPNVIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILY 289
           ++    V   TIYV           G+ +  G YYGTRSQIVLLV K+ +K TFIERI+Y
Sbjct: 235 LVKSLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIY 294

Query: 290 SSDEDVNHYSVATPKEEKRFEFKL 313
           SSD+D++ YS + PKEE R+E+ +
Sbjct: 295 SSDQDISLYSTSNPKEELRYEYDI 318

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  267 bits (682), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 140/323 (43%), Positives = 204/323 (63%), Gaps = 21/323 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKE-KQIFGTW 59
           MCIL ATR+H +YELILISNRDE+L RKTH TCWHND+FILSPYD+++      +IFGTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 60  SGINREGKLATILNLKLDGQ---RDTIKSKSRGLLPFTFLS---THKADFQNWDNYDKFE 113
            G+N++GK+ATILNL+       ++ +K +SRGL+PFTFL    T++  F+ W+ ++KF+
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120

Query: 114 MNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSP 173
             Y  L ++GDFNFFYGD+ E  Y++IDSLG TF VLD     N N  M +SN  + +  
Sbjct: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLD-----NNNRNMIISNDLYQHKD 175

Query: 174 SI-SEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLA 232
               +  W K+K+  + L K +     S+E+ +++ CF+LAS  S+  + ++        
Sbjct: 176 EYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITRE------E 229

Query: 233 DPN--VIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYS 290
           +PN  +   TIYV           G +  +G YYGTR+QIV+LV K+   VT +E  +++
Sbjct: 230 NPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHN 289

Query: 291 SDEDVNHYSVATPKEEKRFEFKL 313
           SDE++  YS   PKE +R +F +
Sbjct: 290 SDEEIYKYSGLNPKEVQRLDFTI 312

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  264 bits (675), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 138/316 (43%), Positives = 194/316 (61%), Gaps = 21/316 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCIL+ T AHP Y LILISNRDEF  R+TH TC H+DDFI+SP+D++ T+K +  FGTW 
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN-FGTWC 59

Query: 61  GINREGKLATILNLKL---DGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYD 117
           G+N++GK+A ILNL++      ++    +SRG++P  FL+    DF NWD+Y+KF  +Y 
Sbjct: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119

Query: 118 GLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISE 177
           G+  TG+FN FYGD  + +YKLI SL  T +        N + YM VSN         S+
Sbjct: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGF-----QNDDGYMVVSNDLIS-----SK 169

Query: 178 QAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVI 237
           + W K+ +A++ L  LV  ++D  +++I+  CF+LAS S+            ++   +V 
Sbjct: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKI-------VVKHESVT 222

Query: 238 MNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNH 297
             TIYV             S+P G YYGTRSQIV+LVSK+  K+TF+ER+LY+ DEDV  
Sbjct: 223 NETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLK 282

Query: 298 YSVATPKEEKRFEFKL 313
           Y    PKE+  FEF +
Sbjct: 283 YGPKNPKEQIEFEFDI 298

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  250 bits (639), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 194/323 (60%), Gaps = 22/323 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKT--SKEKQIFGT 58
           MCIL+ TR HPDY+L+LISNRDEF  R TH T WH+ D+ILSPYD+ K      K + GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 59  WSGINREGKLATILNLKLDGQ------RDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKF 112
           W G+NR G+++T+LNLKL+G+      ++ +K +SRGL+PF FLS  +     WD+++KF
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSD-RGFIDQWDSFEKF 119

Query: 113 EMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEF--Y 170
              Y  L  +GDFN F GD+ ++ YK++DS G TF+VL+ T   N    M VSN  +  +
Sbjct: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYKEF 175

Query: 171 NSPSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQM 230
           N   ISE  W KVK+ +  L +LV   ++ D+ + I  CF  AS  S+  +        +
Sbjct: 176 NENDISE--WNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHE-----DI 228

Query: 231 LADPNVIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYS 290
              P VI NTI+V           G +   G Y+GTRSQ+V LVSK+  +VT  ERIL++
Sbjct: 229 SKTPEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHT 288

Query: 291 SDEDVNHYSVATPKEEKRFEFKL 313
           SD D +  S   PKE K+F F L
Sbjct: 289 SDLDRDFNSPHNPKEVKQFTFDL 311

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  243 bits (621), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 140/321 (43%), Positives = 199/321 (61%), Gaps = 19/321 (5%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDF--ILSPYDLAKTSKEKQI--F 56
           MCIL+A+R HP+Y+LILISNRDEFL R+TH TCW+  ++  IL PYD++K S EK +   
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSK-SNEKNVNKI 59

Query: 57  GTWSGINREGKLATILNLKLDGQ-RDTIKS--KSRGLLPFTFLSTHKAD-FQNWDNYDKF 112
           GTW GIN  G+++TILNLK D   + ++ S  KSRG LP  FL   + D   NWD+Y+KF
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119

Query: 113 EMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNS 172
              Y  +  TGDFNFFYGDV   +Y +IDS+G T  VL        N Y+ +SN +F  S
Sbjct: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVD-----NPYLVISNDKFGKS 174

Query: 173 PSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLA 232
              S + W+K+ +A++ L+ L L   + D   +I  CF +AS +++     K   ++ L 
Sbjct: 175 NGKSTKEWEKITLAKNLLKHLPLCETEDD---LIHKCFDIASTNTLNEDLIKDVDVRELM 231

Query: 233 DPNVIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSD 292
              +++  + V           GAS+P G YYGTRSQIV+LV+KN +KV FIERILY+SD
Sbjct: 232 TETILVPPLNVMTKEEKEKI--GASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSD 289

Query: 293 EDVNHYSVATPKEEKRFEFKL 313
           +DV    +++P ++  + F +
Sbjct: 290 DDVTTQKLSSPIQDLTYNFTI 310

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  241 bits (614), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 185/316 (58%), Gaps = 11/316 (3%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCIL+AT  HP Y+L+L+SNRDE+ ARK     W  D+F+L P D    S  + + GTW 
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDL-GTWI 59

Query: 61  GINREGKLATILNLKLDGQ---RDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYD 117
           G NR+GK+ T+LNLKL      R  +  +SRG +P +FLS+  A+F++WD YDKF   + 
Sbjct: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119

Query: 118 GLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISE 177
           GL  T DFNFFYGD     Y++IDSLG T  VL  T +     Y+ VSN + +   S   
Sbjct: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNE----KYIVVSN-DIFQGESNKN 174

Query: 178 QAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVI 237
           + W K+ +A   L  LV    D+DE+  I  CF +AS +  P  +   +    +    + 
Sbjct: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASIN--PFHSKHDHGNYYMKAVELS 232

Query: 238 MNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNH 297
           M T++V           GAS+P G+YYGTRSQ V+LVSK+ S +T++ERI++ SD D   
Sbjct: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292

Query: 298 YSVATPKEEKRFEFKL 313
           YS    KE+KR++F L
Sbjct: 293 YSRDHYKEQKRYDFDL 308

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  229 bits (585), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 179/321 (55%), Gaps = 25/321 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCIL ATRAHPDY+LIL+SNRDEF  RKTHATCW++D FILSPYD+A   K+ Q +GTW 
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-IEKKGQGYGTWL 59

Query: 61  GINREGKLATILNLKLDGQRDTI------KSKSRGLLPFTFLSTH-KADFQNWDNYDKFE 113
           GINR G++A ILNLK+D   D+       + +SRG++P  FL     A F NWD+++KF 
Sbjct: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119

Query: 114 MNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSP 173
             +  L  TG F  FYGD    +Y +ID L  + N  +         +M +SN  F+ + 
Sbjct: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM------EHMVISNDIFHCAV 173

Query: 174 SISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLAD 233
                 W K +     L+ L        +E ++  CF+L S  +                
Sbjct: 174 GEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDV--------- 224

Query: 234 PNVIMNTIYVXXXXXXXXX-XXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSD 292
            +V  ++IYV            G S+P GDYYGTRSQIV+LV K+ ++VT+ E ++Y SD
Sbjct: 225 DSVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESD 283

Query: 293 EDVNHYSVATPKEEKRFEFKL 313
           ED   YS   PKE  +F+F +
Sbjct: 284 EDCETYSFMDPKEVIQFQFNM 304

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  227 bits (579), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 128/324 (39%), Positives = 190/324 (58%), Gaps = 22/324 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWH--NDDFILSPYDLAKTSKEKQIFGT 58
           MCIL  TR+HPDYELILISNRDEFL RKT  +CW+  ++  +L PYDL++   +   FGT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 59  WSGINREGKLATILNLKLDGQR---DTIKSKSRGLLPFTFLSTHKAD-FQNWDNYDKFEM 114
           W GIN  G+++++LNLK+D  +     ++ KSRG LP  FL   K + F +W++Y KF  
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120

Query: 115 NYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPS 174
            Y  L  TG FN F GDV +++Y LIDS G+T  +LD     N  S + +SN EF    S
Sbjct: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGK-DENGKSSVVISNSEFI---S 176

Query: 175 ISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGT--ASKPNALQMLA 232
             ++ W K+      +++ +  +I  DE ++I +CF++AS S +      S  + L ++ 
Sbjct: 177 NDKERWHKISNGEKLMDEFLSKDI-RDENSVIESCFKIASTSELTNEYLHSHDDILDLMT 235

Query: 233 DPNVIMNTIYV---XXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILY 289
           +      T++V              GAS+P G +YGTRSQIV+LV+K  + V ++ER+LY
Sbjct: 236 E------TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLY 289

Query: 290 SSDEDVNHYSVATPKEEKRFEFKL 313
             D+DV+   +  P  E  FE+ +
Sbjct: 290 ECDDDVSKAGIEKPINELNFEYNI 313

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  204 bits (520), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 175/316 (55%), Gaps = 22/316 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCILMA+ AHP Y LI ISNRDEF  RKT  TC ++DD+ILSP D A  S  K   GTW 
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 61  GINREGKLATILNL--KLDGQRDTIKSK-SRGLLPFTFLSTHKADFQNWDNYDKFEMNYD 117
           G+NR+G++A ILNL  K   +R  +KS  SRG +P  +L   +    +W++++KF   Y 
Sbjct: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYL-MDRGPSTDWNSFEKFVSKYP 119

Query: 118 GLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISE 177
            + T  +FN FYGD I  +Y  IDSLG +   L +  K NL     +SN    +S     
Sbjct: 120 QI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTAN-KPNL----VLSNDHIDSS----- 168

Query: 178 QAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVI 237
             W KV+ A   L++LV  +    EE +I  CF LAS        ++P  +         
Sbjct: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALASN-------TEPAEIDNSDKEEFT 221

Query: 238 MNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNH 297
            ++I++           GAS+P G +YGTRSQIV+LV ++   ++F ER+L+ SD +V  
Sbjct: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281

Query: 298 YSVATPKEEKRFEFKL 313
           +S   PKE+ +F   +
Sbjct: 282 HSEKHPKEKLQFNLHV 297

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  203 bits (517), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 163/261 (62%), Gaps = 11/261 (4%)

Query: 56  FGTWSGINREGKLATILNLKLD--GQR-DTIKSKSRGLLPFTFLSTHKADFQNWDNYDKF 112
           FGTW GIN++G++ T+LNLKLD   QR   +   SRG +P  FLS H  D++ W++Y+KF
Sbjct: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82

Query: 113 EMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNS 172
              +  L+ TGDFNFFYGD    QYK+IDSL +T +VL +    + +SYM VSN  +   
Sbjct: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142

Query: 173 PSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLA 232
               E+ W KV++A+  L KL+  N++ D+++ IS CFQ+AS S  PG   +  + ++L 
Sbjct: 143 ---GEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTS--PGLDWQ--SEELLK 195

Query: 233 DPNVIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSD 292
             +V   +I+V           G +   G +YGTRSQIVLLVSK+  KVTF+ER+L++SD
Sbjct: 196 SSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSD 254

Query: 293 EDVNHYSVATPKEEKRFEFKL 313
           E V+  S   P E+ +F+F L
Sbjct: 255 EQVSQRSPDHPAEQLKFQFDL 275

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  201 bits (512), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 166/308 (53%), Gaps = 23/308 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           MCIL+A+ AHP Y LILISNRDEF+ R+T  TC ++DD+++SP D+      +   GTW 
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 61  GINREGKLATILNLKLDGQRDTIKSK---SRGLLPFTFLSTHKADFQNWDNYDKFEMNYD 117
           G NR G++A ILNL+  G  +  K+K   SRG +   +L T K    +W++Y KF     
Sbjct: 61  GANRNGRIAVILNLRT-GNTNQTKTKRIVSRGNVTMRYL-TDKQPASDWNSYAKFASKCP 118

Query: 118 GLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISE 177
            + +  +FN FYGD     Y  IDS G +F VL S      N Y+ +SN         S 
Sbjct: 119 DIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQ-----NPYLVISNDSIE-----SA 167

Query: 178 QAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVI 237
             W K+++A   +  LV  +++  E+ +++ CF LAS         +   +  +    V 
Sbjct: 168 TKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH-------KQDYNVDHMDKEKVT 220

Query: 238 MNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNH 297
            + I+V           GAS+P G +YGTRSQIV+LVSK    + F+E +LY SD +  H
Sbjct: 221 SSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTH 280

Query: 298 YSVATPKE 305
           +  A PK+
Sbjct: 281 FCAANPKK 288

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  198 bits (504), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 171/323 (52%), Gaps = 23/323 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKT------SKEKQ 54
           MCIL+AT  HPDY+LILISNRDEF  R+TH TCWH D  IL+PYD++ +      SK + 
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 55  IFGTWSGINREGKLATILNLKLDGQR---DTIKSKSRGLLPFTFL-STHKADFQNWDNYD 110
            +GTW GINR G ++ +LNLK   +         KSRG +   FL      ++  W+NY+
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 111 KFEMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFY 170
           KF  ++  L+ T  F  FYGD+    + LIDS  R+ N   S        Y+ +SN    
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK-----QPYVVISNSRV- 174

Query: 171 NSPSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQM 230
            +       WKKV      L++LV GN++  +E ++  CF+LA  S         N +  
Sbjct: 175 -NCEDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQF-----DVNGVIQ 228

Query: 231 LADPNVIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYS 290
           + D ++   TI+V           G S   G+YYGTR+ IV+LV  N + VT  E +++ 
Sbjct: 229 VTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHD 287

Query: 291 SDEDVNHYSVATPKEEKRFEFKL 313
           SD+D+   S   PK +  +EF +
Sbjct: 288 SDKDIGLSSAMNPKTKVAYEFDI 310

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  194 bits (493), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/323 (38%), Positives = 176/323 (54%), Gaps = 27/323 (8%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKE----KQIF 56
           MCIL AT AHP Y+L+LISNRDE+ ARKTH TCW ++D IL+PYD+A    +        
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 57  GTWSGINREGKLATILNLK---LDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDN---YD 110
           GTW GINR G ++ +LNL     DG        SRG +   +L     D  NWD+   Y+
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLK--DFDHNNWDSWNTYE 118

Query: 111 KFEMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFY 170
           KF  ++  L  T  F  FYGDV+  Q+ +I+SLG+T   LD   +S    Y  VSNG   
Sbjct: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQT---LDPFSQS---PYYVVSNGPSD 172

Query: 171 NSPSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQM 230
            + ++ +  W KV       +K++  ++D  EE ++  CF LAS S     +++P  +  
Sbjct: 173 GAKALGQ--WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQY--VSNQPIGVH- 227

Query: 231 LADPNVIMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYS 290
             D ++   TI+V             S   G YYGTRS IV+LVS++ + VT  E +++ 
Sbjct: 228 --DDSIPKRTIFV-PALYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHD 283

Query: 291 SDEDVNHYSVATPKEEKRFEFKL 313
           SD+D++ YS+  PKE+    F L
Sbjct: 284 SDQDLDSYSILNPKEQVTHRFSL 306

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  190 bits (483), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 120/320 (37%), Positives = 175/320 (54%), Gaps = 35/320 (10%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAK--------TSKE 52
           MCIL+ T AHP Y+LILISNRDE   R+TH+TCW+++  IL PYD++K          + 
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 53  KQIFGTWSGINREGKLATILNL--KLDGQRDTIKS---KSRGLLPFTFLSTHKADFQNWD 107
           K   GTW G+N++GK+ T+LNL  + + +RD   +   +SRGL+P  +L      FQ+W+
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN 120

Query: 108 NYDKF-EMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSN 166
            YDKF E N       G FN F GD+   +Y +I+S+G++  VLD       N YM VSN
Sbjct: 121 TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEE-----NPYMVVSN 175

Query: 167 GEFYNSPSISEQAWKKVKVARDGLEKLV---LGNIDSDEETIISNCFQLASKSSVPGTAS 223
             + +   + E  W K+K     LE L+   L N + DE  I+ +CFQ++S  ++ G   
Sbjct: 176 INWGDPKKMGE--WSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKI 233

Query: 224 KPNALQMLADPNVIM--------NTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVS 275
             N  ++    ++I           +             G S+    YYGTRSQIV+L  
Sbjct: 234 DGNIERLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVK---YYGTRSQIVVLCE 290

Query: 276 KNSSKVTFIERILYSSDEDV 295
           + S+KVTF+ERIL+  +ED 
Sbjct: 291 RKSNKVTFVERILHCKNEDA 310

>SAKL0A03762g Chr1 (348183..350264) [2082 bp, 693 aa] {ON} similar
           to uniprot|Q08968 Saccharomyces cerevisiae YPL222W FMP40
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 693

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 3   ILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWSGI 62
           +L +T+A  D  L + S   E +        +++ +  + PY +A    +   FG ++G 
Sbjct: 98  LLTSTKALKDLGLRMDSKMMEII---NGEQIYYDKEKQIFPYSIAYAGFQ---FGQFAGQ 151

Query: 63  NREGKLATILNLK-LDGQRDTIKSKSRGLLPFTFLSTHKA 101
             +G++  + ++K + GQR T++ K  GL PF+  +  KA
Sbjct: 152 LGDGRVTNLFDVKDVRGQRQTLQIKGAGLTPFSRFADGKA 191

>Suva_16.84 Chr16 (139477..141546) [2070 bp, 689 aa] {ON} YPL222W
           (REAL)
          Length = 689

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 17/103 (16%)

Query: 11  PDYELILISNR--DEFLARKTH--------ATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           P Y+ +L+S+R  DEF  ++             + +DD    PY +  +  +   FG+++
Sbjct: 75  PHYKPLLLSHRALDEFGLKQDRDLEKILAGEEVFFSDDIF--PYSMVYSGFQ---FGSFA 129

Query: 61  GINREGKLATILNLK--LDGQRDTIKSKSRGLLPFTFLSTHKA 101
               +G++  + +LK   DGQ  T + K  GL PF+  +  KA
Sbjct: 130 AQLGDGRVVNLFDLKDNRDGQWQTFQLKGAGLTPFSRFADGKA 172

>Skud_16.56 Chr16 (103657..105726) [2070 bp, 689 aa] {ON} YPL222W
           (REAL)
          Length = 689

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 17/103 (16%)

Query: 11  PDYELILISNR--DEF-LARK-------THATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60
           P Y  +L+S +  DEF LA+             +++DD    PY  A +  +   FG+++
Sbjct: 75  PHYRPLLLSQKALDEFSLAQDRDLERILAGEEIYYSDDIF--PYSTAYSGFQ---FGSFA 129

Query: 61  GINREGKLATILNLK--LDGQRDTIKSKSRGLLPFTFLSTHKA 101
               +G++  + +LK   DGQ  T + K  G+ PF+  +  KA
Sbjct: 130 AQLGDGRVVNLFDLKDSRDGQLQTFQLKGAGMTPFSRFADGKA 172

>Smik_4.595 Chr4 (1067533..1071207) [3675 bp, 1224 aa] {ON} YDR335W
           (REAL)
          Length = 1224

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 7/73 (9%)

Query: 118 GLNTTGDFNFFYGDVIE--KQYKL-----IDSLGRTFNVLDSTCKSNLNSYMAVSNGEFY 170
            + T  DF    G +I   ++Y L     I SLG  F +LD +    LNS      G   
Sbjct: 846 AMQTLRDFADSVGHIIRYTREYTLLVLSAISSLGSVFYLLDESPDLLLNSIAIYKTGTNE 905

Query: 171 NSPSISEQAWKKV 183
            SP +S   WK +
Sbjct: 906 ISPGVSTHGWKHI 918

>YDR335W Chr4 (1141168..1144842) [3675 bp, 1224 aa] {ON}
           MSN5Karyopherin involved in nuclear import and export of
           proteins, including import of replication protein A and
           export of Swi6p, Far1p, and Pho4p; required for
           re-export of mature tRNAs after their retrograde import
           from the cytoplasm
          Length = 1224

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 7/73 (9%)

Query: 118 GLNTTGDFNFFYGDVIE--KQYKL-----IDSLGRTFNVLDSTCKSNLNSYMAVSNGEFY 170
            + T  DF    G +I   ++Y L     I SLG  F +LD +    LNS      G   
Sbjct: 846 AMQTLRDFADSVGHIIRYTREYTLLVLSAISSLGSVFYLLDESPDLLLNSIAIFKPGSNE 905

Query: 171 NSPSISEQAWKKV 183
            SP +S   WK +
Sbjct: 906 ISPGVSTHGWKHI 918

>Suva_2.505 Chr2 (898544..902218) [3675 bp, 1224 aa] {ON} YDR335W
           (REAL)
          Length = 1224

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 7/73 (9%)

Query: 118 GLNTTGDFNFFYGDVIE--KQYKL-----IDSLGRTFNVLDSTCKSNLNSYMAVSNGEFY 170
            + T  DF    G +I   ++Y L     I SLG  F  LD +    LNS      G   
Sbjct: 846 AMQTLRDFADSVGHIIRYTREYTLLVLSAISSLGSVFYFLDESPDLLLNSIAIFKPGTNE 905

Query: 171 NSPSISEQAWKKV 183
            SP +S   WK +
Sbjct: 906 ISPGVSTHGWKHI 918

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
           similar to uniprot|Q07084 Saccharomyces cerevisiae
           YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 6/73 (8%)

Query: 105 NWDNYDKFEMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAV 164
           NW  + K + N D +N      F   D IE      D   + FN L+ T  +  N  M+V
Sbjct: 30  NWKLWLKLDYNSDEINQAISIEFDENDTIE------DVKDKLFNRLNGTRWNRYNDMMSV 83

Query: 165 SNGEFYNSPSISE 177
             G + N P + E
Sbjct: 84  GIGIYTNVPDLQE 96

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,305,517
Number of extensions: 1491532
Number of successful extensions: 4432
Number of sequences better than 10.0: 41
Number of HSP's gapped: 4469
Number of HSP's successfully gapped: 41
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)