Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4373.486ON23023011821e-166
YGR126W3.486ON23023010641e-148
Suva_7.4143.486ON23023010561e-147
Smik_6.2223.486ON23023010441e-145
NCAS0E008503.486ON2302285416e-69
CAGL0I10604g3.486ON2112235171e-65
NDAI0G009803.486ON2342295043e-63
SAKL0F02904g3.486ON2222214477e-55
TDEL0D055403.486ON2162264468e-55
KNAG0B008503.486ON2252304409e-54
KAFR0C019203.486ON2232404112e-49
KLTH0F14696g3.486ON2192203816e-45
Kwal_55.212153.486ON1421443233e-37
Kpol_1017.103.486ON2342432801e-29
TPHA0D032503.486ON2192262711e-28
KLLA0E04709g3.486ON1661672444e-25
Skud_16.4503.503ON6221471527e-11
Smik_16.4083.503ON6221471492e-10
KLLA0E03829g3.503ON609831473e-10
YPR156C (TPO3)3.503ON6221471464e-10
TBLA0D029003.503ON6912151448e-10
TDEL0D057103.503ON6162061431e-09
KAFR0C020303.503ON6241361421e-09
Suva_16.4843.503ON6221471369e-09
KLTH0G02266g3.503ON6441861323e-08
NDAI0I027703.503ON6261561305e-08
CAGL0I10384g3.503ON6301281289e-08
AFR322C3.503ON592631262e-07
NCAS0F036203.503ON6341571234e-07
Skud_7.4483.503ON611831226e-07
Smik_6.2333.503ON614831226e-07
Kpol_1017.33.503ON6211441226e-07
Kwal_47.189193.503ON640671226e-07
TPHA0D033103.503ON6131711217e-07
YGR138C (TPO2)3.503ON614831217e-07
KNAG0B007303.503ON6221071201e-06
NCAS0E007503.503ON6201441182e-06
SAKL0F02442g3.503ON6101061172e-06
Suva_7.4253.503ON613831172e-06
ZYRO0G19646g3.503ON5941071163e-06
Skud_4.7405.587ON14481741032e-04
TBLA0I01170singletonON2239176930.003
KLLA0C05676g6.111ON511214900.006
ZYRO0G03872g7.156ON1199130880.013
Kpol_479.38.604ON795176870.016
TBLA0H037708.566ON821199870.016
KLTH0G18612g8.34ON1524157860.023
KAFR0G022906.111ON508103840.035
NDAI0G030908.32ON1009151820.069
Suva_12.1797.463ON1433124820.072
KAFR0C044401.360ON2153109820.074
Ecym_11474.335ON422142810.078
Suva_10.5114.255ON441211810.079
KLLA0C09691g8.704ON821164810.090
NDAI0C058808.604ON846230810.090
NDAI0F022306.175ON899168810.091
KNAG0E003407.39ON902174810.091
Kwal_26.74904.61ON345195800.096
TDEL0F014502.192ON579163800.11
TBLA0J013707.249ON741217800.12
TBLA0A026905.453ON916164800.12
Smik_15.4028.636ON51591790.15
Suva_10.1295.123ON888137790.16
Suva_10.4054.46ON916164780.21
KLTH0G08250g2.199ON1252224780.22
TBLA0B045908.543ON151851780.23
Kpol_1010.68.786ON564103770.26
CAGL0K05445g5.677ON603108770.27
NCAS0A024504.238ON1928139770.30
TDEL0B062901.377ON494213760.34
ZYRO0E02596g8.121ON578221760.35
ADL209C2.292ON704187760.37
Ecym_22696.148ON877154760.38
CAGL0I02090g5.88ON1136222760.39
YGR070W (ROM1)4.219ON1155167760.39
NCAS0B091201.4ON43399750.44
TDEL0F029104.61ON436176750.44
KLTH0H10494gna 1ON48975750.45
KAFR0D030202.446ON677114750.48
Smik_2.3556.104ON736116750.49
TBLA0A030205.333ON1030158750.51
YJL084C (ALY2)1.282ON1046193750.51
KAFR0B024108.207ON2097145750.54
YOR216C (RUD3)8.636ON48491740.60
Smik_13.208.838ON510171740.61
KLLA0D09240g6.70ON748185740.65
ZYRO0F03828g8.68ON1217170740.69
NDAI0A076203.307ON1297154740.69
Kpol_1025.28.228ON1507172740.70
TBLA0A010807.154ON1590110740.70
NDAI0F039601.117ON199201720.71
Skud_4.2493.214ON395123730.76
TBLA0B011502.130ON444207730.79
NDAI0K023706.367ON567103730.83
TPHA0B011201.247ON719163730.87
Smik_8.2335.107ON729141730.87
NCAS0A034604.100ON811234730.88
SAKL0E13816g2.31ON281224720.89
TPHA0B013907.460ON892165730.89
Suva_14.2572.212ON89254730.89
NDAI0F017006.201ON921223730.89
KAFR0D041001.52ON1117171730.91
Kpol_1038.203.22ON1313200730.92
Skud_12.3616.75ON1342154730.92
NCAS0D047306.367ON1442115730.93
KNAG0B017801.271ON1580198730.94
Kpol_505.312.127ON327148720.95
TDEL0D023001.360ON2081205730.95
TPHA0K019104.61ON416151721.0
Kpol_1059.365.399ON505131721.1
Smik_2.4131.323ON545166721.1
NDAI0K024106.375ON24572711.1
TPHA0F009704.165ON996146721.2
SAKL0B09064g3.408ON1024156721.2
KLTH0A06578g6.333ON1071201721.2
NCAS0B084901.141ON1294175721.2
Suva_10.4064.45ON1587106721.2
Smik_12.1658.295ON4909175721.3
Suva_2.6753.83ON38891711.3
YBR270C (BIT2)1.323ON545182711.5
NCAS0C007908.779ON675169711.5
KLLA0C17204g4.46ON768222711.5
KLLA0F23199g1.373ON940111711.6
Suva_13.47singletonON974113711.6
Suva_13.468.813ON1092113711.6
TPHA0H014705.368ON1375155711.6
Kwal_26.90808.736ON1428198711.6
NDAI0G035208.126ON1548179711.6
Smik_5.3448.238ON2161142711.7
TDEL0E034905.277ON34594701.7
NDAI0C018605.373ON20992691.8
TBLA0C049903.533ON487179701.9
Kpol_1008.29singletonON538154701.9
Smik_7.3094.159ON547151701.9
TDEL0A061108.665ON568194702.0
TBLA0H019905.202ON688204702.0
Smik_6.2263.492ON839233702.1
CAGL0A02486g5.407ON866163702.1
Ecym_83744.46ON914227702.1
NDAI0B022508.234ON1156160702.1
Kpol_1066.468.279ON1225149702.2
YFR016C1.377ON1233218702.2
TDEL0C00460na 2ON1652178702.2
SAKL0E14916g5.702ON1779202702.2
Ecym_83564.39ON181183702.2
NDAI0D044204.238ON1914216702.2
YJL005W (CYR1)5.206ON2026101702.2
ZYRO0A09966g8.450ON37198692.3
NCAS0A041002.408ON484174692.5
AFR266W3.567ON562155692.6
TDEL0H04520singletonON612109692.6
KNAG0M016305.311ON650118692.7
TDEL0E021705.407ON809144692.7
TBLA0J009405.655ON921141692.8
TBLA0B001502.8ON107958692.8
TBLA0G030703.258ON1147210692.8
ZYRO0E08514g3.522ON1251210692.9
SAKL0H05104g8.736ON1665118692.9
Smik_14.661.82ON1952136692.9
Skud_5.12singletonON34482683.0
KLTH0G08822g2.219ON544121683.4
KLLA0C12551g2.591ON607126683.5
ZYRO0G14608g5.694ON615198683.5
CAGL0A04257g7.372ON644178683.5
Suva_4.4706.104ON66335683.5
Kwal_23.28615.247ON669100683.5
TBLA0B017902.192ON719114683.6
Skud_5.2237.390ON74872683.6
TBLA0G022802.538ON769138683.6
CAGL0L12914g2.590ON885212683.7
NDAI0C054408.526ON941165683.7
Suva_5.66.16ON99948683.7
Smik_4.394na 3ON1240134683.8
NDAI0G061601.224ON1248151683.8
CAGL0M01738g3.307ON1385171683.8
TBLA0B018102.199ON1504198683.8
TPHA0J00100singletonON1516222683.8
CAGL0D00924g4.238ON1980163683.9
NDAI0H00400singletonON36669674.1
TBLA0F018907.281ON451154674.4
Kpol_541.258.867ON49470674.4
NCAS0G020102.88ON517167674.5
Kpol_1049.17.27ON53758674.5
KAFR0I013704.38ON541144674.6
KLLA0D14355g7.125ON588202674.6
TPHA0H024707.116ON619177674.7
KLTH0G04246g5.548ON66376674.7
SAKL0E07700g2.285ON71214674.7
TBLA0D032508.838ON683158674.7
KLLA0F01122g8.617ON71264674.8
YOR014W (RTS1)7.106ON757157674.8
NDAI0C023205.241ON764110674.8
NCAS0A011606.201ON792145674.8
ZYRO0D06072g8.306ON823134674.8
ZYRO0D17468g6.371ON860124674.9
YLR045C (STU2)5.123ON888139674.9
Kwal_5.492singletonON894116674.9
YLR309C (IMH1)4.46ON911163674.9
Skud_4.3548.234ON916161674.9
SAKL0H25344g4.34ON927200674.9
Kpol_1020.352.212ON957200674.9
CAGL0J03564g6.333ON1029163675.0
TBLA0B066205.162ON1097238675.0
KLLA0E05787g7.488ON1228178675.0
Ecym_15088.34ON1694150675.1
Kwal_56.237078.282ON320135665.3
NCAS0I025303.83ON33076665.3
Suva_2.1723.250ON19737655.5
TPHA0E033701.168ON39248665.6
Suva_11.3285.694ON402211665.7
SAKL0G07568g5.399ON522103666.0
TPHA0O004301.479ON54892666.1
TPHA0F019302.130ON600212666.2
SAKL0H19448g8.171ON69160666.2
Suva_4.5221.342ON66382666.3
YBR212W (NGR1)6.104ON67235666.3
TBLA0B059102.282ON692113666.3
KLTH0D09856g8.617ON71864666.3
Kpol_1053.303.100ON794201666.4
Kpol_365.35.376ON88896666.5
Smik_12.1075.123ON888135666.5
TDEL0E055304.46ON906181666.5
KNAG0H013003.258ON980148666.5
NDAI0I018106.94ON27591656.6
TPHA0C015607.163ON1151150666.6
TDEL0E015404.219ON1312145666.7
Smik_4.7435.587ON1441155666.7
Kwal_23.43265.48ON294110656.8
TPHA0H014105.694ON327213657.1
Kpol_1039.62.222ON40358657.5
YNL136W (EAF7)2.130ON425107657.6
Skud_13.2922.400ON208195647.7
KLLA0F16280g5.656ON47282657.8
Kpol_1076.93.57ON516163658.0
Kpol_331.26.380ON551163658.1
TBLA0E026403.148ON695161658.4
CAGL0G04125g5.225ON763123658.5
KAFR0A037308.654ON788149658.5
TBLA0B052006.184ON812188658.5
NDAI0A016707.390ON846249658.6
SAKL0G04928g5.527ON89281658.6
Kpol_1071.133.290ON27356648.8
KNAG0C007001.69ON121246658.8
NDAI0J028504.351ON153744658.9
Skud_14.1982.134ON174163639.0
Kpol_1024.298.562ON199673659.1
TBLA0A09870singletonON3931326410.0
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Skud_7.437
         (693 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   459   e-166
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   414   e-148
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   411   e-147
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   406   e-145
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   213   6e-69
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   203   1e-65
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   198   3e-63
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   176   7e-55
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   176   8e-55
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   174   9e-54
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   162   2e-49
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   151   6e-45
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   129   3e-37
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...   112   1e-29
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...   108   1e-28
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    99   4e-25
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    63   7e-11
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    62   2e-10
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    61   3e-10
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    61   4e-10
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    60   8e-10
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    60   1e-09
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    59   1e-09
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    57   9e-09
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    55   3e-08
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     55   5e-08
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    54   9e-08
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    53   2e-07
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    52   4e-07
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    52   6e-07
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    52   6e-07
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    52   6e-07
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    52   6e-07
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    51   7e-07
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    51   7e-07
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    51   1e-06
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               50   2e-06
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    50   2e-06
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    50   2e-06
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    49   3e-06
Skud_4.740 Chr4 (1308858..1313204) [4347 bp, 1448 aa] {ON} YDR46...    44   2e-04
TBLA0I01170 Chr9 (245439..252158) [6720 bp, 2239 aa] {ON}              40   0.003
KLLA0C05676g Chr3 (506539..508074) [1536 bp, 511 aa] {ON} weakly...    39   0.006
ZYRO0G03872g Chr7 complement(309117..312716) [3600 bp, 1199 aa] ...    39   0.013
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    38   0.016
TBLA0H03770 Chr8 (917128..919593) [2466 bp, 821 aa] {ON} Anc_8.5...    38   0.016
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    38   0.023
KAFR0G02290 Chr7 complement(477075..478601) [1527 bp, 508 aa] {O...    37   0.035
NDAI0G03090 Chr7 (720183..723212) [3030 bp, 1009 aa] {ON} Anc_8....    36   0.069
Suva_12.179 Chr12 (277003..281304) [4302 bp, 1433 aa] {ON} YJR09...    36   0.072
KAFR0C04440 Chr3 (875307..881768) [6462 bp, 2153 aa] {ON} Anc_1....    36   0.074
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    36   0.078
Suva_10.511 Chr10 (873646..874971) [1326 bp, 441 aa] {ON} YLR394...    36   0.079
KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly...    36   0.090
NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8...    36   0.090
NDAI0F02230 Chr6 (539524..542223) [2700 bp, 899 aa] {ON} Anc_6.1...    36   0.091
KNAG0E00340 Chr5 (49652..52360) [2709 bp, 902 aa] {ON} Anc_7.39 ...    36   0.091
Kwal_26.7490 s26 (386917..387954) [1038 bp, 345 aa] {ON} YGR159C...    35   0.096
TDEL0F01450 Chr6 complement(260621..262360) [1740 bp, 579 aa] {O...    35   0.11 
TBLA0J01370 Chr10 complement(316749..318974) [2226 bp, 741 aa] {...    35   0.12 
TBLA0A02690 Chr1 complement(653373..656123) [2751 bp, 916 aa] {O...    35   0.12 
Smik_15.402 Chr15 complement(697238..698785) [1548 bp, 515 aa] {...    35   0.15 
Suva_10.129 Chr10 complement(236449..239115) [2667 bp, 888 aa] {...    35   0.16 
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    35   0.21 
KLTH0G08250g Chr7 (672012..675770) [3759 bp, 1252 aa] {ON} some ...    35   0.22 
TBLA0B04590 Chr2 (1061040..1065596) [4557 bp, 1518 aa] {ON} Anc_...    35   0.23 
Kpol_1010.6 s1010 (15270..16112,16114..16965) [1695 bp, 564 aa] ...    34   0.26 
CAGL0K05445g Chr11 (534680..536491) [1812 bp, 603 aa] {ON} some ...    34   0.27 
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    34   0.30 
TDEL0B06290 Chr2 (1112253..1113737) [1485 bp, 494 aa] {ON} Anc_1...    34   0.34 
ZYRO0E02596g Chr5 complement(202673..204409) [1737 bp, 578 aa] {...    34   0.35 
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...    34   0.37 
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...    34   0.38 
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    34   0.39 
YGR070W Chr7 (627806..631273) [3468 bp, 1155 aa] {ON}  ROM1GDP/G...    34   0.39 
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    33   0.44 
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    33   0.44 
KLTH0H10494g Chr8 complement(904424..905893) [1470 bp, 489 aa] {...    33   0.45 
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    33   0.48 
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    33   0.49 
TBLA0A03020 Chr1 complement(723036..726128) [3093 bp, 1030 aa] {...    33   0.51 
YJL084C Chr10 complement(274862..278002) [3141 bp, 1046 aa] {ON}...    33   0.51 
KAFR0B02410 Chr2 complement(467555..473848) [6294 bp, 2097 aa] {...    33   0.54 
YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON} ...    33   0.60 
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...    33   0.61 
KLLA0D09240g Chr4 complement(775848..778094) [2247 bp, 748 aa] {...    33   0.65 
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...    33   0.69 
NDAI0A07620 Chr1 complement(1745936..1749829) [3894 bp, 1297 aa]...    33   0.69 
Kpol_1025.2 s1025 complement(4571..9094) [4524 bp, 1507 aa] {ON}...    33   0.70 
TBLA0A01080 Chr1 complement(241869..246641) [4773 bp, 1590 aa] {...    33   0.70 
NDAI0F03960 Chr6 (941691..942290) [600 bp, 199 aa] {ON} Anc_1.11...    32   0.71 
Skud_4.249 Chr4 complement(432630..433817) [1188 bp, 395 aa] {ON...    33   0.76 
TBLA0B01150 Chr2 (249125..250459) [1335 bp, 444 aa] {ON} Anc_2.1...    33   0.79 
NDAI0K02370 Chr11 (532190..533893) [1704 bp, 567 aa] {ON}              33   0.83 
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    33   0.87 
Smik_8.233 Chr8 complement(371188..373377) [2190 bp, 729 aa] {ON...    33   0.87 
NCAS0A03460 Chr1 (681704..684139) [2436 bp, 811 aa] {ON} Anc_4.1...    33   0.88 
SAKL0E13816g Chr5 complement(1138187..1139032) [846 bp, 281 aa] ...    32   0.89 
TPHA0B01390 Chr2 complement(313019..315697) [2679 bp, 892 aa] {O...    33   0.89 
Suva_14.257 Chr14 (472064..474742) [2679 bp, 892 aa] {ON} YNL082...    33   0.89 
NDAI0F01700 Chr6 (413683..416448) [2766 bp, 921 aa] {ON} Anc_6.2...    33   0.89 
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    33   0.91 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    33   0.92 
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    33   0.92 
NCAS0D04730 Chr4 complement(904979..909307) [4329 bp, 1442 aa] {...    33   0.93 
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    33   0.94 
Kpol_505.31 s505 (77169..78152) [984 bp, 327 aa] {ON} (77169..78...    32   0.95 
TDEL0D02300 Chr4 complement(444459..450704) [6246 bp, 2081 aa] {...    33   0.95 
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    32   1.0  
Kpol_1059.36 s1059 (78595..80112) [1518 bp, 505 aa] {ON} (78595....    32   1.1  
Smik_2.413 Chr2 complement(728446..730083) [1638 bp, 545 aa] {ON...    32   1.1  
NDAI0K02410 Chr11 complement(541731..542468) [738 bp, 245 aa] {O...    32   1.1  
TPHA0F00970 Chr6 complement(219516..222506) [2991 bp, 996 aa] {O...    32   1.2  
SAKL0B09064g Chr2 (771705..774779) [3075 bp, 1024 aa] {ON} simil...    32   1.2  
KLTH0A06578g Chr1 complement(547101..550316) [3216 bp, 1071 aa] ...    32   1.2  
NCAS0B08490 Chr2 (1627460..1631344) [3885 bp, 1294 aa] {ON} Anc_...    32   1.2  
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    32   1.2  
Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa]...    32   1.3  
Suva_2.675 Chr2 complement(1197698..1198864) [1167 bp, 388 aa] {...    32   1.3  
YBR270C Chr2 complement(742761..744398) [1638 bp, 545 aa] {ON}  ...    32   1.5  
NCAS0C00790 Chr3 (137927..139954) [2028 bp, 675 aa] {ON} Anc_8.7...    32   1.5  
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    32   1.5  
KLLA0F23199g Chr6 complement(2159245..2162067) [2823 bp, 940 aa]...    32   1.6  
Suva_13.47 Chr13 (70528..73452) [2925 bp, 974 aa] {ON} YMR261C (...    32   1.6  
Suva_13.46 Chr13 (70171..70287,70291..73452) [3279 bp, 1092 aa] ...    32   1.6  
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    32   1.6  
Kwal_26.9080 s26 (1067363..1071649) [4287 bp, 1428 aa] {ON} YMR2...    32   1.6  
NDAI0G03520 Chr7 complement(844269..848915) [4647 bp, 1548 aa] {...    32   1.6  
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    32   1.7  
TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277     32   1.7  
NDAI0C01860 Chr3 complement(411874..412503) [630 bp, 209 aa] {ON...    31   1.8  
TBLA0C04990 Chr3 (1214716..1216179) [1464 bp, 487 aa] {ON} Anc_3...    32   1.9  
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    32   1.9  
Smik_7.309 Chr7 (520619..522262) [1644 bp, 547 aa] {ON} YGR023W ...    32   1.9  
TDEL0A06110 Chr1 (1069675..1070355,1070357..1071382) [1707 bp, 5...    32   2.0  
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    32   2.0  
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    32   2.1  
CAGL0A02486g Chr1 (266055..268655) [2601 bp, 866 aa] {ON} some s...    32   2.1  
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    32   2.1  
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    32   2.1  
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    32   2.2  
YFR016C Chr6 complement(177042..180743) [3702 bp, 1233 aa] {ON} ...    32   2.2  
TDEL0C00460 Chr3 (67471..72429) [4959 bp, 1652 aa] {ON}                32   2.2  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    32   2.2  
Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar ...    32   2.2  
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    32   2.2  
YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}  CYR1Aden...    32   2.2  
ZYRO0A09966g Chr1 (804999..806114) [1116 bp, 371 aa] {ON} simila...    31   2.3  
NCAS0A04100 Chr1 complement(827360..828814) [1455 bp, 484 aa] {O...    31   2.5  
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...    31   2.6  
TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {O...    31   2.6  
KNAG0M01630 Chr13 (289388..291340) [1953 bp, 650 aa] {ON} Anc_5....    31   2.7  
TDEL0E02170 Chr5 complement(405306..407735) [2430 bp, 809 aa] {O...    31   2.7  
TBLA0J00940 Chr10 complement(209827..212592) [2766 bp, 921 aa] {...    31   2.8  
TBLA0B00150 Chr2 (20203..23442) [3240 bp, 1079 aa] {ON} Anc_2.8 ...    31   2.8  
TBLA0G03070 Chr7 complement(812624..816067) [3444 bp, 1147 aa] {...    31   2.8  
ZYRO0E08514g Chr5 (678434..682189) [3756 bp, 1251 aa] {ON} some ...    31   2.9  
SAKL0H05104g Chr8 complement(454375..459372) [4998 bp, 1665 aa] ...    31   2.9  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...    31   2.9  
Skud_5.12 Chr5 complement(11107..12141) [1035 bp, 344 aa] {ON} Y...    31   3.0  
KLTH0G08822g Chr7 (723401..725035) [1635 bp, 544 aa] {ON} weakly...    31   3.4  
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    31   3.5  
ZYRO0G14608g Chr7 complement(1166287..1168134) [1848 bp, 615 aa]...    31   3.5  
CAGL0A04257g Chr1 complement(422355..424289) [1935 bp, 644 aa] {...    31   3.5  
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    31   3.5  
Kwal_23.2861 s23 complement(45793..47802) [2010 bp, 669 aa] {ON}...    31   3.5  
TBLA0B01790 Chr2 complement(405022..407181) [2160 bp, 719 aa] {O...    31   3.6  
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    31   3.6  
TBLA0G02280 Chr7 (588554..590863) [2310 bp, 769 aa] {ON} Anc_2.5...    31   3.6  
CAGL0L12914g Chr12 complement(1379249..1381906) [2658 bp, 885 aa...    31   3.7  
NDAI0C05440 Chr3 complement(1260473..1263298) [2826 bp, 941 aa] ...    31   3.7  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...    31   3.7  
Smik_4.394 Chr4 (718158..721880) [3723 bp, 1240 aa] {ON} YDR150W...    31   3.8  
NDAI0G06160 Chr7 (1522574..1526320) [3747 bp, 1248 aa] {ON} Anc_...    31   3.8  
CAGL0M01738g Chr13 (197743..201900) [4158 bp, 1385 aa] {ON} simi...    31   3.8  
TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {...    31   3.8  
TPHA0J00100 Chr10 complement(3..4550) [4548 bp, 1516 aa] {ON}          31   3.8  
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    31   3.9  
NDAI0H00400 Chr8 (83321..84421) [1101 bp, 366 aa] {ON}                 30   4.1  
TBLA0F01890 Chr6 complement(473942..475297) [1356 bp, 451 aa] {O...    30   4.4  
Kpol_541.25 s541 (76077..77561) [1485 bp, 494 aa] {ON} (76077..7...    30   4.4  
NCAS0G02010 Chr7 complement(362692..364245) [1554 bp, 517 aa] {O...    30   4.5  
Kpol_1049.1 s1049 (504..2117) [1614 bp, 537 aa] {ON} (504..2117)...    30   4.5  
KAFR0I01370 Chr9 complement(282658..284283) [1626 bp, 541 aa] {O...    30   4.6  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...    30   4.6  
TPHA0H02470 Chr8 (581837..583696) [1860 bp, 619 aa] {ON} Anc_7.1...    30   4.7  
KLTH0G04246g Chr7 (338413..340404) [1992 bp, 663 aa] {ON} simila...    30   4.7  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...    30   4.7  
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...    30   4.7  
KLLA0F01122g Chr6 complement(102765..104903) [2139 bp, 712 aa] {...    30   4.8  
YOR014W Chr15 (357674..359947) [2274 bp, 757 aa] {ON}  RTS1B-typ...    30   4.8  
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241     30   4.8  
NCAS0A01160 Chr1 (226660..229038) [2379 bp, 792 aa] {ON} Anc_6.2...    30   4.8  
ZYRO0D06072g Chr4 complement(516283..518754) [2472 bp, 823 aa] {...    30   4.8  
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    30   4.9  
YLR045C Chr12 complement(235037..237703) [2667 bp, 888 aa] {ON} ...    30   4.9  
Kwal_5.492 s5 complement(6364..9048) [2685 bp, 894 aa] {ON} YAL0...    30   4.9  
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    30   4.9  
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    30   4.9  
SAKL0H25344g Chr8 (2209672..2212455) [2784 bp, 927 aa] {ON} simi...    30   4.9  
Kpol_1020.35 s1020 complement(75767..78640) [2874 bp, 957 aa] {O...    30   4.9  
CAGL0J03564g Chr10 (340647..343736) [3090 bp, 1029 aa] {ON} simi...    30   5.0  
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    30   5.0  
KLLA0E05787g Chr5 (515081..518767) [3687 bp, 1228 aa] {ON} weakl...    30   5.0  
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    30   5.1  
Kwal_56.23707 s56 complement(670523..671485) [963 bp, 320 aa] {O...    30   5.3  
NCAS0I02530 Chr9 complement(474132..475124) [993 bp, 330 aa] {ON...    30   5.3  
Suva_2.172 Chr2 complement(298817..299410) [594 bp, 197 aa] {ON}...    30   5.5  
TPHA0E03370 Chr5 (716679..717857) [1179 bp, 392 aa] {ON} Anc_1.1...    30   5.6  
Suva_11.328 Chr11 complement(597257..598465) [1209 bp, 402 aa] {...    30   5.7  
SAKL0G07568g Chr7 (630838..631109,631353..632649) [1569 bp, 522 ...    30   6.0  
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...    30   6.1  
TPHA0F01930 Chr6 complement(435235..437037) [1803 bp, 600 aa] {O...    30   6.2  
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    30   6.2  
Suva_4.522 Chr4 complement(904325..906316) [1992 bp, 663 aa] {ON...    30   6.3  
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    30   6.3  
TBLA0B05910 Chr2 complement(1387647..1389725) [2079 bp, 692 aa] ...    30   6.3  
KLTH0D09856g Chr4 complement(815253..817409) [2157 bp, 718 aa] {...    30   6.3  
Kpol_1053.30 s1053 (46793..49177) [2385 bp, 794 aa] {ON} (46793....    30   6.4  
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    30   6.5  
Smik_12.107 Chr12 complement(216043..218709) [2667 bp, 888 aa] {...    30   6.5  
TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4...    30   6.5  
KNAG0H01300 Chr8 (230236..233178) [2943 bp, 980 aa] {ON} Anc_3.2...    30   6.5  
NDAI0I01810 Chr9 (430179..431006) [828 bp, 275 aa] {ON} Anc_6.94       30   6.6  
TPHA0C01560 Chr3 complement(356865..360320) [3456 bp, 1151 aa] {...    30   6.6  
TDEL0E01540 Chr5 complement(301613..305551) [3939 bp, 1312 aa] {...    30   6.7  
Smik_4.743 Chr4 (1310183..1314508) [4326 bp, 1441 aa] {ON} YDR46...    30   6.7  
Kwal_23.4326 s23 complement(669535..670419) [885 bp, 294 aa] {ON...    30   6.8  
TPHA0H01410 Chr8 complement(316871..317854) [984 bp, 327 aa] {ON...    30   7.1  
Kpol_1039.6 s1039 complement(13298..14509) [1212 bp, 403 aa] {ON...    30   7.5  
YNL136W Chr14 (370368..371645) [1278 bp, 425 aa] {ON}  EAF7Subun...    30   7.6  
Skud_13.292 Chr13 complement(508550..509176) [627 bp, 208 aa] {O...    29   7.7  
KLLA0F16280g Chr6 complement(1508963..1510381) [1419 bp, 472 aa]...    30   7.8  
Kpol_1076.9 s1076 complement(18964..20514) [1551 bp, 516 aa] {ON...    30   8.0  
Kpol_331.2 s331 complement(3808..4614,5119..5967) [1656 bp, 551 ...    30   8.1  
TBLA0E02640 Chr5 (668887..670974) [2088 bp, 695 aa] {ON} Anc_3.1...    30   8.4  
CAGL0G04125g Chr7 (393879..396170) [2292 bp, 763 aa] {ON} weakly...    30   8.5  
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    30   8.5  
TBLA0B05200 Chr2 complement(1221706..1224144) [2439 bp, 812 aa] ...    30   8.5  
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    30   8.6  
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...    30   8.6  
Kpol_1071.13 s1071 (30311..31132) [822 bp, 273 aa] {ON} (30311.....    29   8.8  
KNAG0C00700 Chr3 complement(119584..123222) [3639 bp, 1212 aa] {...    30   8.8  
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    30   8.9  
Skud_14.198 Chr14 complement(364246..364770) [525 bp, 174 aa] {O...    29   9.0  
Kpol_1024.29 s1024 (83563..89553) [5991 bp, 1996 aa] {ON} (83563...    30   9.1  
TBLA0A09870 Chr1 (2426725..2427906) [1182 bp, 393 aa] {ON}             29   10.0 

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  459 bits (1182), Expect = e-166
 Identities = 230/230 (100%), Positives = 230/230 (100%)
 Frame = +1

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 180
           MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE
Sbjct: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 60

Query: 181 NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 360
           NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP
Sbjct: 61  NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 120

Query: 361 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 540
           DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST
Sbjct: 121 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 180

Query: 541 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
           RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  414 bits (1064), Expect = e-148
 Identities = 202/230 (87%), Positives = 218/230 (94%)
 Frame = +1

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 180
           MPVPSV+VTTDNEYEDISSFSSIDSYKPEPFTGFKDS+APEQPLLKNDTIVGK Q E++ 
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60

Query: 181 NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 360
           N+D+QHRHSDV+SHHSSSTLKRP+SNSIEKM+THNALEGNSET DSLK +GLNLNKKALP
Sbjct: 61  NVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120

Query: 361 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 540
           DITAPVTNSAH+ AFPEEYRLETETGLVKLKTLE+LKREDSRVSS KKEH NDH D HST
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180

Query: 541 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
           RSKVTT SQGSSLE +KLNMAVEKNKK+IE+Y+KHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  411 bits (1056), Expect = e-147
 Identities = 199/230 (86%), Positives = 217/230 (94%)
 Frame = +1

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 180
           M VP+VSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGK QSEN++
Sbjct: 1   MAVPTVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKGQSENDD 60

Query: 181 NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 360
           ++D+QHRHSDV+SHHSSSTLKRP+SNSIEKM+THNALEGNSET DSLK+EGLNLNKK  P
Sbjct: 61  SVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTP 120

Query: 361 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 540
           DITAPVTNSAH+ AFPEEYRLETETGLVKLKTLETLKREDSRVS AKK+H +DH DAHST
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHST 180

Query: 541 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
           RSK T YSQGSSLESDKLN+AVEKNKK+IE+Y+KHK EKGIKG FHR+FD
Sbjct: 181 RSKATAYSQGSSLESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  406 bits (1044), Expect = e-145
 Identities = 199/230 (86%), Positives = 214/230 (93%)
 Frame = +1

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 180
           MPVPSV+VTTDNEYEDISSFSSIDSYKPEPFTGFKDSQ P+QPL+KNDTIVGK QSEN++
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60

Query: 181 NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 360
            +D+QHRHSDV+SHHSSSTLKRP+SNSIEKM+T NALEG SET DSLK +GLNL KKALP
Sbjct: 61  ILDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120

Query: 361 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 540
           DITAPVTNSAH+  FPEEYRLETETGLVKLKTLETL+REDSRVSS KKEH NDH D HST
Sbjct: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180

Query: 541 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
           RSKVTT SQGSSLE +KLNMAVEKNKKKIEQY+KHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  213 bits (541), Expect = 6e-69
 Identities = 113/228 (49%), Positives = 159/228 (69%), Gaps = 4/228 (1%)
 Frame = +1

Query: 19  SVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENID--- 189
           + +T++++ED+SSFSSIDSY+PEPFTG K+  A +    K DT+ G      +E+ +   
Sbjct: 7   TTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRK-DTLSGDETELKQEHTNATA 65

Query: 190 -EQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
              H    + S  S STL+RP SN+IE++IT NA EGN+ET  SL  +GL+LNKKA  DI
Sbjct: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDI 125

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 546
            AP+T++  + AFPEEY LETETGLVK KT+ETL+RE SRVSS ++    D   +H +++
Sbjct: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRR---GDDVVSHKSQA 182

Query: 547 KVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
              +     SL+++KLN+AVEKNKK++E+  KHK +KG+KGF +R+FD
Sbjct: 183 TGKSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  203 bits (517), Expect = 1e-65
 Identities = 113/223 (50%), Positives = 154/223 (69%), Gaps = 2/223 (0%)
 Frame = +1

Query: 28  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS 207
           TD E EDISSFSS+DSYKPEPFTG + +        KN+ +  KA + ++    +     
Sbjct: 10  TDYEVEDISSFSSVDSYKPEPFTGLEHT--------KNENLSRKATNASQGTYMD----- 56

Query: 208 DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 387
           D  S HS +TLK+  S +IEK++T NA+ GNSET +SLK +GL++ +KA+PD  AP+T +
Sbjct: 57  DATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTT 116

Query: 388 AHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDH--ADAHSTRSKVTTY 561
             N  FPEEYRLET+TGLVK+KTLETLKR+ ++VS      + D   + + S +S+V+  
Sbjct: 117 GTN-QFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNSDLSSKDKSISKSQSNKSEVSDI 175

Query: 562 SQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
           +Q       K+NMAVE+NKK+I +Y+KHKSEKGIKGFFHR+FD
Sbjct: 176 AQ-------KINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  198 bits (504), Expect = 3e-63
 Identities = 110/229 (48%), Positives = 154/229 (67%), Gaps = 8/229 (3%)
 Frame = +1

Query: 28  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPE-QPLLKNDTIVGKAQSENEENIDEQH-- 198
           TDNE++DISSFSSIDSY+PEPFTG K ++ P  QP     T     + ++++ +   H  
Sbjct: 13  TDNEFDDISSFSSIDSYQPEPFTGLKGNELPNAQP----STTATTTEQDHDDTVISSHSH 68

Query: 199 --RHSDVYSHHSSSTLKRPSSN--SIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
             +H +  S  S++TLK+  SN   IEK +T N +   +ET DSL ++GLN  KK++ DI
Sbjct: 69  DTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADI 128

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 546
             P+  +A    FPEEYR+ETETGLVK KT+E+L+R++S ++SA    + D     S R+
Sbjct: 129 NTPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQES-IASANSRRSQDQGSFKSART 185

Query: 547 KVTTYSQ-GSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
             T  S+  SSL+ +KLNMAVEKNKK++E+Y KHK +KGIKGFF+R+FD
Sbjct: 186 NNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  176 bits (447), Expect = 7e-55
 Identities = 99/221 (44%), Positives = 141/221 (63%)
 Frame = +1

Query: 25  TTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRH 204
           TT     ++SS SS +S++P+ FTG   S   EQP + ++ +  +   E       +   
Sbjct: 9   TTGGTDMELSSLSSTESFEPQAFTGADPSV--EQPTIDHE-LEDEIDPEPLSGNPVRPNS 65

Query: 205 SDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTN 384
            ++ S  SS+TLK+  SN+IEK++THNA+EGN+ET +SLK  GL+L KKA+PD   P  +
Sbjct: 66  EEILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMH 125

Query: 385 SAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYS 564
           +     FPEEY++ETETGLVK+KTL++L R D+RVS   K  TN + +A S   +     
Sbjct: 126 T-DRSQFPEEYQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDE----Q 180

Query: 565 QGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 687
           +    + +KL  AV+KNKKKIE+Y+KHK EKGIKGF  R+F
Sbjct: 181 RPVGYDEEKLKKAVDKNKKKIEKYQKHKHEKGIKGFMSRLF 221

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  176 bits (446), Expect = 8e-55
 Identities = 95/226 (42%), Positives = 132/226 (58%), Gaps = 7/226 (3%)
 Frame = +1

Query: 34  NEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDV 213
           N+++++SSFSSIDSY+P+PFTG                   + +   E+N D   R S  
Sbjct: 14  NQFDEVSSFSSIDSYQPQPFTG-------------------QEELPQEKNPDSSSRRSS- 53

Query: 214 YSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAH 393
               S +TL    SN+IEK +THNA+ G SETA SL++ GL+  KKA+PDI  P+T +A 
Sbjct: 54  ---KSGTTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNAD 110

Query: 394 NGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST-------RSKV 552
              FPEEYR+ET+TGLVKLKTL  L R D+RVS       +  +    T       +   
Sbjct: 111 TSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDT 170

Query: 553 TTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
               Q ++  ++ L  A+EKNK +IE++ KH+ EKG+KGF HR+FD
Sbjct: 171 AKAEQEAAQNAENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  174 bits (440), Expect = 9e-54
 Identities = 100/230 (43%), Positives = 151/230 (65%), Gaps = 8/230 (3%)
 Frame = +1

Query: 22  VTTDNEYEDISSFSSIDSYKPEPFTGF-KDSQAPEQPLLKNDTIVGKAQ-SENEENIDEQ 195
           + TD E++++SSFSS+DSYKPEPF GF  + +  +  L KNDTI+     +EN  N    
Sbjct: 7   IVTDPEFDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENTANTP-- 64

Query: 196 HRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKA-LPDITA 372
              SD+ S  SS+TL +  SN+IE+++T NA+   SE+AD+L+ +GL+  K+  +PDI A
Sbjct: 65  ---SDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINA 121

Query: 373 PVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKV 552
           P+T +  +  FPEEY++ETETGLVK+KT+E+LK   S  +     H +  +   STRSK 
Sbjct: 122 PLTLTQSH--FPEEYQVETETGLVKMKTIESLKSRHSGGT-----HNSKKSKGASTRSKN 174

Query: 553 TTYSQ-----GSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 687
           +  S       + L ++KLN AVE+N+K++E+Y K++ +KGIKGF  ++F
Sbjct: 175 SLTSSMEEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  162 bits (411), Expect = 2e-49
 Identities = 92/240 (38%), Positives = 144/240 (60%), Gaps = 17/240 (7%)
 Frame = +1

Query: 22  VTTDNEYEDISSFSSIDSYKPEPFTG----------------FKDSQAPEQPLLKNDTIV 153
           ++ + + EDISSFSSI+SYKPEPF G                 KD+Q+      + + + 
Sbjct: 1   MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVD 60

Query: 154 GKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREG 333
              Q +  ++       S+  S  SS  LK+  S  IE+++T NA+ G +ET DSL+  G
Sbjct: 61  PLKQVQTNDSFWSFRSVSNT-SRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATG 119

Query: 334 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT 513
           L+L K+A+PDI +P++   H     +E + ET+TGL+K KTLETL R ++R SS+K++  
Sbjct: 120 LDLTKRAVPDINSPIS---HESKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKIL 176

Query: 514 -NDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
            ND+++              S L+ +++NM VE+N+KK+E+Y++HK EKG+KGFF++IFD
Sbjct: 177 GNDNSNT-------------SGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  151 bits (381), Expect = 6e-45
 Identities = 91/220 (41%), Positives = 131/220 (59%), Gaps = 5/220 (2%)
 Frame = +1

Query: 46  DISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHH 225
           ++SS SS DS++P  F G         P  +  ++  +   +   +ID +    D +   
Sbjct: 16  ELSSLSSSDSFEPRAFEG---------PPSEIKSLEPEGSVQASPSIDSK----DFHRVK 62

Query: 226 SSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAF 405
           S+ TL++  SN+IE+++THNA EG SET +SLK+ GLNL KKA+PDI  P  N   N AF
Sbjct: 63  SNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN-YKNCAF 121

Query: 406 PEEYRLETETGLVKLKTLETLKREDSRVS-----SAKKEHTNDHADAHSTRSKVTTYSQG 570
           PEEY++ET+TGLVK +TL  L R +SR S     S KK     ++  +S  +       G
Sbjct: 122 PEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTING 181

Query: 571 SSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
             L+ +KL  AVEKN+KKI++Y+KHKS  G++ F  +IFD
Sbjct: 182 --LDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  129 bits (323), Expect = 3e-37
 Identities = 71/144 (49%), Positives = 96/144 (66%), Gaps = 5/144 (3%)
 Frame = +1

Query: 274 ITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLK 453
           +THNA EG SET DSL+R GLN+N+KA+PD   P  N   N  FPEEY+LET+TGLVK++
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFT-NCEFPEEYQLETDTGLVKVQ 59

Query: 454 TLETLKREDSRVS-----SAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNK 618
           TL+ L R +SR S     S +K   +  +  HS  S     S  S L+++KL  AVEKNK
Sbjct: 60  TLQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSI-SPSAGRSSNSGLDAEKLRKAVEKNK 118

Query: 619 KKIEQYRKHKSEKGIKGFFHRIFD 690
           ++I++Y+KHK+  G+K F  +IFD
Sbjct: 119 RQIDKYQKHKASGGLKKFLGKIFD 142

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score =  112 bits (280), Expect = 1e-29
 Identities = 81/243 (33%), Positives = 120/243 (49%), Gaps = 21/243 (8%)
 Frame = +1

Query: 25  TTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDT-IVGKAQSENEENIDEQHR 201
           T  + +EDISSF S +S+ P+ F G  DS         NDT +  K +S   E       
Sbjct: 13  TDSSNFEDISSFDSQNSFAPQEFKGNLDSNND------NDTGVFNKTKSGTSE------- 59

Query: 202 HSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVT 381
                    ++TLK  SSN IEK++T NALE N+ET  +L+     L+K    ++  P T
Sbjct: 60  ---------TNTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENVL-PAT 109

Query: 382 NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTN------DHADAHSTR 543
              +N AFPEEYR+ET+TGLV +KTLE +    S   + + EH N      +H + H   
Sbjct: 110 ME-NNAAFPEEYRIETKTGLVPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHH 168

Query: 544 SK-------------VTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSE-KGIKGFFHR 681
            K                +     LE   +++ VE+NKK++E++ +HK E   +K F ++
Sbjct: 169 EKNDEDKDVEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYK 228

Query: 682 IFD 690
             D
Sbjct: 229 FLD 231

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score =  108 bits (271), Expect = 1e-28
 Identities = 73/226 (32%), Positives = 129/226 (57%), Gaps = 5/226 (2%)
 Frame = +1

Query: 25  TTDNE-YEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDE-QH 198
           TTD+E ++D+SSF+S +SY P+ F G              DT+  ++ ++ ++      H
Sbjct: 10  TTDSENFDDVSSFNSDNSYTPQEFIG--------------DTLGKESSTKMDDRASHLSH 55

Query: 199 RHSDVYSHHS-SSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAP 375
              +  S  S ++T+K  +SN + ++++ N ++ N E+ ++LK +  N+  +   DI  P
Sbjct: 56  AIKETRSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRA-DIILP 114

Query: 376 VTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVS-SAKKEHTNDHADAHSTRSKV 552
            +    N  FPEEY +ET TGLV +KTLE +K++ +  S +++K   +    A  + + V
Sbjct: 115 ASMEG-NSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTV 173

Query: 553 TTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKG-IKGFFHRIF 687
            + ++G  L   KLN AVEKNK+++E+Y+ HK+EK  IK    ++F
Sbjct: 174 KSRNEG-GLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 98.6 bits (244), Expect = 4e-25
 Identities = 60/167 (35%), Positives = 92/167 (55%), Gaps = 9/167 (5%)
 Frame = +1

Query: 214 YSHHSSSTLKRPSSNSIEKMIT---------HNALEGNSETADSLKREGLNLNKKALPDI 366
           +SHHS S+L +  S+ + K+ T          N  +G +++ DSLK   L+L+KKA+P  
Sbjct: 17  HSHHSMSSLVQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGF 76

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 546
             P+   A    FPEEY +ET TGLVK+ TL  L R D+RV++        H+   ST+ 
Sbjct: 77  NQPIAEGAE---FPEEYEIETRTGLVKVATLHQLNRLDTRVTT--------HSSKKSTKE 125

Query: 547 KVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 687
           K T+       ++DKL   +E+N+K+I+ Y K   + G K F  ++F
Sbjct: 126 KNTS----CGYDNDKLQKCIERNQKEIDSYHK---KSGFKKFIGKLF 165

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 63.2 bits (152), Expect = 7e-11
 Identities = 51/147 (34%), Positives = 73/147 (49%), Gaps = 1/147 (0%)
 Frame = +1

Query: 151 VGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKR 327
           + + +S N  N DE    SDV S      +  PS N  +  +  N L+   +ET  SL+ 
Sbjct: 1   MNRQESINSFNSDETSSLSDVESQQPQQYI--PSENGSKSNMAPNQLKLTRTETVKSLQD 58

Query: 328 EGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKE 507
            G++ +K  +PD+ AP   S+ N  FPEEY LET TGLV + TL ++ R  + +S  +  
Sbjct: 59  MGVS-SKAPIPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAISRTRTR 115

Query: 508 HTNDHADAHSTRSKVTTYSQGSSLESD 588
                 D  ST S     S   +LESD
Sbjct: 116 ----QIDGASTPS-----SNEDALESD 133

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 62.0 bits (149), Expect = 2e-10
 Identities = 45/147 (30%), Positives = 69/147 (46%), Gaps = 1/147 (0%)
 Frame = +1

Query: 151 VGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKR 327
           + + +S N  N DE    SDV S      +  PS N  +  +  N L+   +ET  SL+ 
Sbjct: 1   MNRQESINSFNSDETSSLSDVESQQPQQYI--PSENGSKSNMAPNQLKLTRTETVKSLQD 58

Query: 328 EGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKE 507
            G++ +K  +PD+ AP   S  N  FPEEY LET TGLV + TL ++ R  + +S  +  
Sbjct: 59  MGVS-SKAPVPDVNAP--QSGKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAISRTRTR 115

Query: 508 HTNDHADAHSTRSKVTTYSQGSSLESD 588
                +   S    + + +     E D
Sbjct: 116 QIEGASSPSSNEDALESDNNEKGKEGD 142

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 61.2 bits (147), Expect = 3e-10
 Identities = 36/83 (43%), Positives = 48/83 (57%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ETA SL+  GL  ++  +PD  AP T+ A N  FPEEY LET TGLV + TL +L R  
Sbjct: 48  TETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSLGRTP 106

Query: 481 SRVSSAKKEHTNDHADAHSTRSK 549
           + +S  +     D  DA S+  K
Sbjct: 107 TAISRTRTRQM-DRQDASSSEEK 128

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 60.8 bits (146), Expect = 4e-10
 Identities = 44/147 (29%), Positives = 71/147 (48%), Gaps = 1/147 (0%)
 Frame = +1

Query: 151 VGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKR 327
           + + +S N  N DE    SDV S      +  PS +  +  +  N L+   +ET  SL+ 
Sbjct: 1   MNRQESINSFNSDETSSLSDVESQQPQQYI--PSESGSKSNMAPNQLKLTRTETVKSLQD 58

Query: 328 EGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKE 507
            G++ +K  +PD+ AP   S+ N  FPEEY LET TGLV + TL ++ R  + +S  +  
Sbjct: 59  MGVS-SKAPVPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAISRTRTR 115

Query: 508 HTNDHADAHSTRSKVTTYSQGSSLESD 588
             +  +   S    + + +     E D
Sbjct: 116 QIDGASSPSSNEDALESDNNEKGKEGD 142

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 60.1 bits (144), Expect = 8e-10
 Identities = 58/215 (26%), Positives = 97/215 (45%), Gaps = 2/215 (0%)
 Frame = +1

Query: 46  DISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHH 225
           D+ S SS DS +    TG +D+Q P+Q +               +++  Q R  D+ S  
Sbjct: 3   DLESISSYDSSQSSN-TGLEDTQ-PQQYIY--------------QSVSRQSR-DDLQSSI 45

Query: 226 SSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAF 405
           +S     P++ S             +ET  SL   G++ +    P I AP T+      F
Sbjct: 46  NSYLTTTPTNRSSNASTNQRLKLVKTETVKSLIDMGVS-SYIPNPAINAPKTSK--KAIF 102

Query: 406 PEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAH--STRSKVTTYSQGSSL 579
           PEEY LETETGLV + TL +L R ++ +S  +  HT    +    S+    TT  +  ++
Sbjct: 103 PEEYTLETETGLVPVSTLHSLGRTNTNLSRQRTRHTLSRRNTRIASSAQHDTTLEKKITI 162

Query: 580 ESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRI 684
            S   + +++K ++      K   ++  + F H+I
Sbjct: 163 NSTSSSSSIDKQEQSFS--NKVSPQQSPESFTHKI 195

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 59.7 bits (143), Expect = 1e-09
 Identities = 49/206 (23%), Positives = 85/206 (41%)
 Frame = +1

Query: 49  ISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHS 228
           +S   S+DSY  +  + F+D Q P++ +  N+                            
Sbjct: 1   MSEVQSVDSYNSDSSSAFRDDQQPQEYIPSNNN--------------------------- 33

Query: 229 SSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFP 408
                   +N +   +T       +ET  SL+  G+      +PD+ AP T +A    FP
Sbjct: 34  -------KNNGLPLNLTR------TETVKSLQEMGMTATAP-VPDVNAPQT-TARPQIFP 78

Query: 409 EEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESD 588
           EEY +ET TGLV + TL+++ R  + +S ++            TR    T S+ SS++  
Sbjct: 79  EEYTMETPTGLVPVATLQSIGRTSTAISRSR------------TRQMERTSSESSSMDGT 126

Query: 589 KLNMAVEKNKKKIEQYRKHKSEKGIK 666
             +  + K  K  E   +H+ +  I+
Sbjct: 127 NSDAEINKEGKASEPQEEHELDPEIE 152

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 59.3 bits (142), Expect = 1e-09
 Identities = 43/136 (31%), Positives = 64/136 (47%), Gaps = 9/136 (6%)
 Frame = +1

Query: 169 ENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGN---------SETADSL 321
           E+  + D Q  +S V             SNS      HN++  +         +ET  SL
Sbjct: 5   ESVTSFDSQESNSVVEDQQQPQQYVPSISNS------HNSINNDERTRLKLIRTETVKSL 58

Query: 322 KREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAK 501
           +  G+N    A+PD+ AP +N   N  FPEEY +ET TGLV + TL++L R  + +S  +
Sbjct: 59  QDMGMNATP-AVPDVNAPQSN--RNAIFPEEYTIETTTGLVPVATLQSLGRTSTAISRTR 115

Query: 502 KEHTNDHADAHSTRSK 549
               +      S+RSK
Sbjct: 116 TRQMDRSISVVSSRSK 131

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.0 bits (136), Expect = 9e-09
 Identities = 41/147 (27%), Positives = 71/147 (48%), Gaps = 1/147 (0%)
 Frame = +1

Query: 151 VGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKR 327
           + + +S N  N DE    S+V S      +  PS    +  ++ N L+   +ET  SL+ 
Sbjct: 1   MNRQESINSFNSDETSSLSNVESQQPQQYI--PSERGSKSNMSPNQLKLTRTETVKSLQD 58

Query: 328 EGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKE 507
            G++ ++  +PD+ AP   S+ N  FPEEY +ET TGLV + TL ++ R  + +S  +  
Sbjct: 59  MGVS-SRAPVPDVNAP--QSSKNKIFPEEYTIETPTGLVPVATLHSIGRTSTAISRTRTR 115

Query: 508 HTNDHADAHSTRSKVTTYSQGSSLESD 588
             +  +   S    + + +     E D
Sbjct: 116 QIDGASSPSSNEDALESDNNEKGKEGD 142

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 55.5 bits (132), Expect = 3e-08
 Identities = 52/186 (27%), Positives = 78/186 (41%)
 Frame = +1

Query: 31  DNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSD 210
           D++ E I+SF+S DSY          +Q P+  +  + T   +A   +            
Sbjct: 2   DSDQESINSFNSRDSY----------TQVPQTYVPSDATSARRAGRRS------------ 39

Query: 211 VYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSA 390
                S+S      S+ +  + T        ET  SL+  G+   +  LPD+ AP T   
Sbjct: 40  -----SASASSAVGSDRLRLVPT--------ETVKSLQDMGVT-PEAPLPDVNAPTTGKG 85

Query: 391 HNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQG 570
               FPEEY LET TGLV + TL++L R  S VS  +     + A A    S   + ++ 
Sbjct: 86  GAAIFPEEYTLETATGLVPVATLQSLGRTQSAVSRTRTRVMREGAAARRRGSDAGSENEQ 145

Query: 571 SSLESD 588
               SD
Sbjct: 146 KLTLSD 151

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 54.7 bits (130), Expect = 5e-08
 Identities = 43/156 (27%), Positives = 76/156 (48%)
 Frame = +1

Query: 166 SENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLN 345
           S N  +IDEQ +      + +++T    ++N  +  +T       +ET  +L+  G+  +
Sbjct: 17  STNSSSIDEQQQPQQYIPNTTTTT----TTNGAQLKLTR------TETVKTLQDLGVTRD 66

Query: 346 KKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHA 525
              +PD+ AP T SA N  FPEEY +ET TGLV + TL++L R  + ++      T    
Sbjct: 67  AP-VPDVNAPQT-SARNTIFPEEYTMETTTGLVPVSTLQSLGRTATSIT-----RTRTRQ 119

Query: 526 DAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQ 633
               + S  +T S     E ++     E++ K++ +
Sbjct: 120 IERRSTSGFSTTSNSKGEEEEEEEEEEEEDTKEVPE 155

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 53.9 bits (128), Expect = 9e-08
 Identities = 42/128 (32%), Positives = 61/128 (47%), Gaps = 8/128 (6%)
 Frame = +1

Query: 217 SHHSSSTLKRPSSNSIEKMITHNALEGN--------SETADSLKREGLNLNKKALPDITA 372
           S   +S +   S     + I  N  +GN        +ET  SL+  G+  +   +PD+ A
Sbjct: 15  SQSINSDIDIESQQQPRQYIPSNEKDGNKERLHLTRTETVKSLQEMGMTQDAP-IPDVNA 73

Query: 373 PVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKV 552
           P T +  N  FPEEY +ET TGLV + TL++L R  + +S   K  T     + S RS+ 
Sbjct: 74  PQTTTK-NAIFPEEYTMETPTGLVPVATLQSLGRTSTAIS---KSRTRQIERSVSRRSQN 129

Query: 553 TTYSQGSS 576
              S  SS
Sbjct: 130 IAASSNSS 137

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 53.1 bits (126), Expect = 2e-07
 Identities = 31/63 (49%), Positives = 42/63 (66%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ET  SL+  GL+ ++K +PD+ AP T++     FPEEY LET TGLVK+ TL +L R  
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTSAGV--IFPEEYTLETPTGLVKIATLVSLGRTG 101

Query: 481 SRV 489
           S V
Sbjct: 102 SAV 104

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 52.0 bits (123), Expect = 4e-07
 Identities = 48/157 (30%), Positives = 68/157 (43%), Gaps = 1/157 (0%)
 Frame = +1

Query: 34  NEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSE-NEENIDEQHRHSD 210
           NE + I SF S  S   +      +SQAPEQ + K  T  G+A S  N+ N+        
Sbjct: 2   NEQQSIKSFDSSSSSIGD------ESQAPEQYVPKEYTADGEANSRGNQLNLTR------ 49

Query: 211 VYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSA 390
                                         +ETA +L+  G+  ++  LPDI AP   S 
Sbjct: 50  ------------------------------TETAKTLQDMGMT-SEAPLPDINAP-QGSK 77

Query: 391 HNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAK 501
               FPEEY +ET TGLV + TL+++ R  S +S  +
Sbjct: 78  KPAIFPEEYTMETPTGLVPVVTLQSIGRNSSAISRTR 114

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 51.6 bits (122), Expect = 6e-07
 Identities = 32/83 (38%), Positives = 47/83 (56%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ET  SL+  G+  +   +PDI AP T  A N  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAPKT--AKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 481 SRVSSAKKEHTNDHADAHSTRSK 549
           S +S  + +  N  A   S+  K
Sbjct: 102 SALSRTRTKQLNRSATNSSSTGK 124

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 51.6 bits (122), Expect = 6e-07
 Identities = 32/83 (38%), Positives = 47/83 (56%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ET  SL+  G+  N   +PDI AP T  A N  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVTSNAP-VPDINAPQT--AKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 481 SRVSSAKKEHTNDHADAHSTRSK 549
           + +S  + +  N  A   S+  K
Sbjct: 102 TALSRTRTKQMNRTATNSSSTGK 124

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 51.6 bits (122), Expect = 6e-07
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 1/144 (0%)
 Frame = +1

Query: 205 SDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKREGLNLNKKALPDITAPVT 381
           +D+  H          SN +      N L+   +ET  SL+  G+  ++  +P + AP T
Sbjct: 19  ADLEDHQQPQQYMPSESNELNS----NPLKLSRTETVKSLQDMGMT-SEAPIPGVNAPQT 73

Query: 382 NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTY 561
           +      FPEEY +ET TGLV + TL++L R    V+  +    +  +  +++ S     
Sbjct: 74  SRVQ--IFPEEYTMETPTGLVPVATLQSLGRSSLAVTRTRTRQMDRQSQTNASIS----- 126

Query: 562 SQGSSLESDKLNMAVEKNKKKIEQ 633
             GS+ ESD+     EK+    E+
Sbjct: 127 --GSNSESDEYQKETEKSGSSGEE 148

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 51.6 bits (122), Expect = 6e-07
 Identities = 28/67 (41%), Positives = 40/67 (59%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ET  SL+  G+   +  LPD+ AP   ++    FPEEY LET TGLV + TL++L R  
Sbjct: 51  TETVKSLQEMGVT-PEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRTT 109

Query: 481 SRVSSAK 501
           S V+  +
Sbjct: 110 SGVTRTR 116

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 51.2 bits (121), Expect = 7e-07
 Identities = 46/171 (26%), Positives = 71/171 (41%)
 Frame = +1

Query: 34  NEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDV 213
           NEYEDI SF S +S      TG  + + P+Q +   D                       
Sbjct: 3   NEYEDIESFDSTESS-----TGVGNEEQPQQYVPSGD----------------------- 34

Query: 214 YSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAH 393
            +  ++  L R                  +ET  SL+  GL  +   +PD+ AP +N   
Sbjct: 35  -NGGAALNLSR------------------TETVKSLQDMGLT-SDAPIPDVNAPTSNK-- 72

Query: 394 NGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 546
           +  FPEEY +ET TGLV + TL +L R  + ++  + +   D +  H + S
Sbjct: 73  HSIFPEEYTMETPTGLVPVATLHSLGRNSTTITRTRTKQM-DRSQTHDSSS 122

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 51.2 bits (121), Expect = 7e-07
 Identities = 32/83 (38%), Positives = 47/83 (56%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ET  SL+  G+  +   +PDI AP T  A N  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAPQT--AKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 481 SRVSSAKKEHTNDHADAHSTRSK 549
           S +S  + +  N  A   S+  K
Sbjct: 102 SALSRTRTKQLNRTATNSSSTGK 124

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 50.8 bits (120), Expect = 1e-06
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 11/107 (10%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ET  SL+  G+  N   +PD+ AP T +     FPEEY +ET TGLV + TL+++ R  
Sbjct: 51  TETVKSLQDMGMTKNAP-IPDVNAPQT-AKKTAIFPEEYTMETPTGLVPVATLQSIGRTA 108

Query: 481 SRVS-----------SAKKEHTNDHADAHSTRSKVTTYSQGSSLESD 588
           + +S           S +  H+ND  +      +    S+   L+ D
Sbjct: 109 TSISRTRTRQMDRSISMRSSHSNDKEEEEEAAEEDEDGSEDQHLDPD 155

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 50.1 bits (118), Expect = 2e-06
 Identities = 38/144 (26%), Positives = 63/144 (43%)
 Frame = +1

Query: 166 SENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLN 345
           SE+ +N D+Q     +           P+ +       +N     +ET  +L+  G+  +
Sbjct: 12  SEDSQNNDDQQPQQYI-----------PTESENNNNAINNLHLTRTETVKTLQDLGVT-S 59

Query: 346 KKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHA 525
              +PDI AP  +S  N  FPEEY +ET TGLV + TL+++ R  S +S  +       +
Sbjct: 60  HVPVPDINAP-QSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTASAISRTRTRQMQGRS 118

Query: 526 DAHSTRSKVTTYSQGSSLESDKLN 597
                 SK  +  +    E +  N
Sbjct: 119 SMSILSSKSNSKEELEEEEEEMTN 142

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 49.7 bits (117), Expect = 2e-06
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 3/106 (2%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ETA SL+  G++ ++  +PDI AP   +  +  FPEEY +ET TGLV + TL ++ R  
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAP--QNVKSPIFPEEYTMETPTGLVPVATLHSIGRTT 100

Query: 481 SRVSSAKKEHTNDHADAHSTRSKVTTYSQ---GSSLESDKLNMAVE 609
           S VS  +    +    + S  S      +   G + E  +L+  +E
Sbjct: 101 SAVSRTRTRQLDRQESSSSFDSSSENQKKKFTGDNDEEQELDTDIE 146

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 49.7 bits (117), Expect = 2e-06
 Identities = 31/83 (37%), Positives = 46/83 (55%)
 Frame = +1

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           +ET  SL+  G+  +   +PDI AP T  A N  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAPQT--AKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 481 SRVSSAKKEHTNDHADAHSTRSK 549
           S +S  +    N      S+ +K
Sbjct: 102 SALSRTRTRQLNRTGTNSSSTAK 124

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 49.3 bits (116), Expect = 3e-06
 Identities = 37/107 (34%), Positives = 55/107 (51%)
 Frame = +1

Query: 187 DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
           D     S V S  +S   +      +E+ +T  AL  + ETA++L+  G+      LPD+
Sbjct: 3   DRSSLDSSVRSSIASWQPREKPQQLLEQDVTSRALSRH-ETAETLQTMGM-ARGTPLPDV 60

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKE 507
            AP   +A    FPEEY +ET +G+V L  LE+L R  + VS   +E
Sbjct: 61  VAPTYAAAP--VFPEEYTMETPSGIVPLAQLESLGRTVTTVSKKGEE 105

>Skud_4.740 Chr4 (1308858..1313204) [4347 bp, 1448 aa] {ON} YDR464W
           (REAL)
          Length = 1448

 Score = 44.3 bits (103), Expect = 2e-04
 Identities = 43/174 (24%), Positives = 83/174 (47%), Gaps = 14/174 (8%)
 Frame = +1

Query: 178 ENIDEQHRHSDVYSH---HSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNK 348
           +NID+  R S   SH    S      P  ++ EK       E + E A  L++E L ++K
Sbjct: 93  QNIDDD-RGSKSQSHLENESEQVAPDPMDDNREK-------EQHQEWAHILQQEILQVDK 144

Query: 349 KALPDITAPVTNSAHNGAFPE-EYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHA 525
           ++L + T    +++H+   P  + +L+ +   +++  LE+L+  ++  +  KK+H ++HA
Sbjct: 145 ESLSEHTERRVSTSHHHPPPRTDEQLDQDDENLRMAILESLQELNTSDNQEKKQHKHEHA 204

Query: 526 -------DAHSTRSKVTTYSQGSSLESD---KLNMAVEKNKKKIEQYRKHKSEK 657
                     S++ K    S+   L+ D   K + +   +KK ++   K KS K
Sbjct: 205 APGGKSTGKKSSKKKKKDRSKNKELQKDKSSKKSKSSSHSKKHVKDRNKDKSSK 258

>TBLA0I01170 Chr9 (245439..252158) [6720 bp, 2239 aa] {ON} 
          Length = 2239

 Score = 40.4 bits (93), Expect = 0.003
 Identities = 43/176 (24%), Positives = 68/176 (38%), Gaps = 30/176 (17%)
 Frame = +1

Query: 175  EENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKA 354
            + NI+ +   S V S+ S  T++  S  S+ K +  N+  G      S K+       KA
Sbjct: 1737 DRNIESKPNKSRVPSNISKKTIEESSKPSLNKNVKKNSNFGKKLAKKSPKKSFTKAPVKA 1796

Query: 355  LPDITAPVTNSAHNGAFP-----EEYRL-------------------ETETGLVKLKTLE 462
            L   T P+  +  N A+P     ++Y +                   E  T +     L 
Sbjct: 1797 LKHPTTPINETIKNSAYPTAPVIDDYDMNESDIQDVITADIAEANSDEYGTSMFNTSDLN 1856

Query: 463  TLKR----EDSRVSSAKKEHT--NDHADAHSTRSKVTTYSQGSSLESDKLNMAVEK 612
             + +    E   +SS K++ T  NDH   +S   K     Q S    DKL  ++EK
Sbjct: 1857 LINKVSQTEPLEISSPKRKITTNNDHPATNSLNIKHKEL-QASMTSLDKLKKSIEK 1911

 Score = 34.7 bits (78), Expect = 0.23
 Identities = 44/180 (24%), Positives = 69/180 (38%), Gaps = 17/180 (9%)
 Frame = +1

Query: 157  KAQSENE-ENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREG 333
            + +SE E E+I  +HRH     H    TLK+ + NS                  S  R  
Sbjct: 608  ETESETEVESIHNKHRHRRHPHHQHGRTLKKSARNS-----------------SSNSRNN 650

Query: 334  LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT 513
            L   K +   + +   NS H+ ++    R +  T   K +   +    DS V+S   +  
Sbjct: 651  LLKKKSSKSTVQSKRLNSPHHQSYSRRRRSQLPT---KHRKNRSSAYYDSEVTSEDDDQI 707

Query: 514  NDHADAHSTRSKVTTYSQ-GSSLESD---------------KLNMAVEKNKKKIEQYRKH 645
            +       TRS+  +Y+Q GS  ES+               K+   V + K K +Q  KH
Sbjct: 708  S--ISGSETRSETESYTQSGSQSESELGSEPSQDDEDEYITKVLKKVNERKLKQKQDNKH 765

>KLLA0C05676g Chr3 (506539..508074) [1536 bp, 511 aa] {ON} weakly
           similar to uniprot|Q01448 Saccharomyces cerevisiae
           YBR215W HPC2 Highly charged basic protein required for
           normal cell-cycle regulation of histone gene
           transcription mutants display strong synthetic defects
           with subunits of FACT a complex that allows RNA Pol II
           to elongate through nucleosomes
          Length = 511

 Score = 39.3 bits (90), Expect = 0.006
 Identities = 46/214 (21%), Positives = 89/214 (41%), Gaps = 7/214 (3%)
 Frame = +1

Query: 34  NEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDV 213
           N + ++    SI S   +P         P +P+++  TI+  +Q     NI+E   +  +
Sbjct: 53  NSHNNVKKQISISSLLSDP--------QPPKPVIRAPTIILPSQRPGTSNIEETDTNDIL 104

Query: 214 YSHHSSST---LKRPSSNSIEKMITHN-ALEGNSETADSLKREGLNLNKKALPDITAPVT 381
            +   S     L RP SN+     +H+  L     + D+L + G  ++       TAP T
Sbjct: 105 IARTKSPVSVLLDRPQSNTQNPTDSHDRGLTIPVTSIDTLLKNGSAMS-------TAPAT 157

Query: 382 NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTND---HADAHSTRSKV 552
           +S  N A   +   + ++  ++  +  T   +D +     KE TN+      A +T+S  
Sbjct: 158 DST-NAAL--KINGDGDSTKIEPASSTTSSTKDQKTKGKTKEETNNKVPRTTAKNTKSAA 214

Query: 553 TTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSE 654
           +  ++ S   + K      K   + +Q  K+K +
Sbjct: 215 SKSAKNSKATTAKNKKEPVKKDSRAKQDNKNKQD 248

>ZYRO0G03872g Chr7 complement(309117..312716) [3600 bp, 1199 aa]
           {ON} some similarities with uniprot|P40563 Saccharomyces
           cerevisiae YIR003W Hypothetical ORF
          Length = 1199

 Score = 38.5 bits (88), Expect = 0.013
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 10/130 (7%)
 Frame = +1

Query: 232 STLKRPSSNSIEKMITHNAL--EGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAF 405
           S L     NS+EK +++ +   + N E         L++  +  P+   PV  ++ + + 
Sbjct: 453 SFLPEEKPNSLEKKLSNESSLSQKNPEPIGKKPSAELSVASEERPE---PVEKNSTSESL 509

Query: 406 ------PEEYRLETETGL--VKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTY 561
                 PE    E  TG+     K LETLK+E S  S+   E T +  +  S+   +   
Sbjct: 510 VLPEKRPEALEKELSTGINAQSEKELETLKKEPSNDSTTVPERTTESEEKKSSTEPLKKE 569

Query: 562 SQGSSLESDK 591
           S  SSLES+K
Sbjct: 570 STASSLESEK 579

>Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)
            [2388 nt, 796 aa]
          Length = 795

 Score = 38.1 bits (87), Expect = 0.016
 Identities = 40/176 (22%), Positives = 70/176 (39%), Gaps = 2/176 (1%)
 Frame = +1

Query: 133  LKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSI--EKMITHNALEGNSE 306
            LKN+ I  +  +E E+  D      D    ++ S  K    N I  EK++ +  +  NS+
Sbjct: 629  LKNNNIEAEHLAELEQLHDNMTSLQDTMKENAESINKLKDENRILQEKLLANEEVTSNSQ 688

Query: 307  TADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSR 486
            T+  +K + +N  K  + D             F E+  L+ +    +LK L     ED  
Sbjct: 689  TSSEVKEQEINELKNKIKD-------------FQEKLDLKEQDTNKRLKLL----AEDLY 731

Query: 487  VSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSE 654
            V  + K             +K  +     SL++  L   +E+ K ++   RK K +
Sbjct: 732  VQYSSKHEQKVKLLKKGYDTKYQSKIDQISLQNQGLVQEIEQIKNQLSTERKEKQK 787

>TBLA0H03770 Chr8 (917128..919593) [2466 bp, 821 aa] {ON} Anc_8.566
           YBR182C
          Length = 821

 Score = 38.1 bits (87), Expect = 0.016
 Identities = 40/199 (20%), Positives = 83/199 (41%), Gaps = 3/199 (1%)
 Frame = +1

Query: 10  PSVSVTTDNEYEDISSFSS-IDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENI 186
           P+ + TT N     ++ S  + + K EP         P  P + ND+      + N  N 
Sbjct: 224 PTTNTTTTNTTNTTTTSSMPMSTIKQEPLN-------PIAPSILNDSNNNNNNNNNNNNN 276

Query: 187 DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPD- 363
           +  + +++    +SSS +  PS  SI    T  +L   S     L+      + +A  + 
Sbjct: 277 NNNNNNNNNNKSNSSSNILNPSQRSINTSTT--SLPNTSSNTLPLRTTSNTHSLRANSNT 334

Query: 364 ITAPVTNSAHNGAFPEEYRLETETGL-VKLKTLETLKREDSRVSSAKKEHTNDHADAHST 540
           I  P ++ +++  F  + +L     L V++     +K  ++  +S    +TN +   +S 
Sbjct: 335 INNPTSSPSNSNTFSHQRKLSMRPVLRVQIPNHHNIKNTNTNTNS--NSNTNSNTTNNSN 392

Query: 541 RSKVTTYSQGSSLESDKLN 597
               T     ++++SD ++
Sbjct: 393 SESNTNTKNNTNVKSDPIS 411

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 37.7 bits (86), Expect = 0.023
 Identities = 39/157 (24%), Positives = 60/157 (38%), Gaps = 9/157 (5%)
 Frame = +1

Query: 160  AQSENEENIDEQH-RHSDVYSHHSSSTLKRP-------SSNSIEKMITHNALEGNSETAD 315
            AQ E+    D++H R +D+  H S    KR        SS  ++K+   + LE   E+  
Sbjct: 1100 AQLEDFSESDQEHPRANDLIEHSSERAPKRTNSERSSQSSTPVQKLTIGSVLEPPQES-- 1157

Query: 316  SLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETL-KREDSRVS 492
                 G N +      I   +          +   ++TE G    + L  L K     ++
Sbjct: 1158 -----GSNHSSPTTKYIPLAIPPHLRERRVSKLNEVQTEFGSFNFRNLPALDKANKDAIN 1212

Query: 493  SAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMA 603
              K EH  +HA  H    +  + S  SS  S KL  A
Sbjct: 1213 RLKSEHLAEHAHHHLHHHRGLSGSSSSSDTSSKLRYA 1249

>KAFR0G02290 Chr7 complement(477075..478601) [1527 bp, 508 aa] {ON}
           Anc_6.111 YBR215W
          Length = 508

 Score = 37.0 bits (84), Expect = 0.035
 Identities = 37/103 (35%), Positives = 50/103 (48%), Gaps = 6/103 (5%)
 Frame = +1

Query: 343 NKKALPDITAPVT-NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTND 519
           N   +P  ++  T +S    A      L+TET L  LKT  TLK+  S +SS KK  ++ 
Sbjct: 208 NTDNIPSTSSTKTIDSVSTTAANTNVTLKTETPL--LKTEPTLKKTQSNLSSNKKGPSSI 265

Query: 520 HADAHSTRSK----VTTYSQGSSLESD-KLNMAVEKNKKKIEQ 633
              A + +SK    VTT S   S  ++ K    V  NKKK EQ
Sbjct: 266 TPAAKAKKSKSTGVVTTSSSSLSNSTEPKKKSNVNSNKKKSEQ 308

>NDAI0G03090 Chr7 (720183..723212) [3030 bp, 1009 aa] {ON} Anc_8.32
           YFL034W
          Length = 1009

 Score = 36.2 bits (82), Expect = 0.069
 Identities = 39/151 (25%), Positives = 66/151 (43%), Gaps = 10/151 (6%)
 Frame = +1

Query: 133 LKNDTIVGKAQSENEENIDEQHRHSD-----VYSHHSSSTLKRPSSNSIEKMITHNALEG 297
           LK DT   ++Q  NEE  +++   S      +   HS +      SNS    ++ N   G
Sbjct: 21  LKKDTETNRSQQSNEEKHNDEGLGSTPLQETLIEEHSDTNEAEDHSNSESSSLSDN--NG 78

Query: 298 NSETADSLKREGLNLN-KKALPDITAPVTNSAHNGAFPEEYR--LETETGLVKLKTLETL 468
           N  T DSL     N+N ++   D+   + NS+ N +    ++    +ET  +  +     
Sbjct: 79  NL-TIDSLPMSYRNMNLEEGQKDV---IENSSLNQSLSPSFQPIRSSETPSISSRNEPHQ 134

Query: 469 KREDSRVS--SAKKEHTNDHADAHSTRSKVT 555
           ++++  +S   A  +  NDH D HS  S  T
Sbjct: 135 QKQEQDISPNDAIPKAKNDHEDTHSLSSDDT 165

>Suva_12.179 Chr12 (277003..281304) [4302 bp, 1433 aa] {ON} YJR092W
           (REAL)
          Length = 1433

 Score = 36.2 bits (82), Expect = 0.072
 Identities = 29/124 (23%), Positives = 52/124 (41%)
 Frame = +1

Query: 28  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS 207
           T+ EY+DI +   ++ +  E  T  KD  A +  +  ND      ++E+ EN ++   H 
Sbjct: 441 TEQEYQDIENPPLMNKHTDEDPTALKDDVAEKDSINSND------ENESFENFEDATNHE 494

Query: 208 DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 387
            V+S               +++I +    G S+T DS     +NL++     +  P T  
Sbjct: 495 IVHSEE-------------QQLIRNIQYSGGSKTHDS----QINLDQGETVTVNGPPTEG 537

Query: 388 AHNG 399
              G
Sbjct: 538 KDGG 541

>KAFR0C04440 Chr3 (875307..881768) [6462 bp, 2153 aa] {ON} Anc_1.360
           YFR019W
          Length = 2153

 Score = 36.2 bits (82), Expect = 0.074
 Identities = 26/109 (23%), Positives = 46/109 (42%), Gaps = 8/109 (7%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDIS-SFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTI-------VGK 159
           P P +++    + E +  SFSS  + K +      + +  +   LK+  I        G 
Sbjct: 410 PPPKMAIPATKQGESLEISFSSNSTLKKDLNPSHTNGKTRDSYTLKDFDIYSPYSEHTGS 469

Query: 160 AQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSE 306
            QS    +  + ++ S  + HHS +   + S NS+ K I H    G S+
Sbjct: 470 PQSHKHSHYSDPYQQSIKHHHHSKNQNHKTSVNSLRKSIFHYVSNGKSQ 518

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 35.8 bits (81), Expect = 0.078
 Identities = 32/142 (22%), Positives = 60/142 (42%), Gaps = 23/142 (16%)
 Frame = +1

Query: 277 THNALEGNSETADSLKREGLNLNKKALPD--ITAPVTNSAHNGAFPE---------EYRL 423
           THN  +G  E      RE + L     P   I +P+ N  +  A P+         +Y  
Sbjct: 83  THNLNKGFHEVITKGMRENMQLTSPLTPTSGIVSPIINKDYPSALPDVSTRKFNFTKYVD 142

Query: 424 ETETGLVKLKT------------LETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQ 567
             +  ++K+K+            L+ +K    R+    +E  N   D +S  SKV  Y+Q
Sbjct: 143 RFKKAIIKIKSDQKQFQTRVIQPLQQIKEMGLRIQKPLEERKNLILDINSYSSKVERYNQ 202

Query: 568 GSSLESDKLNMAVEKNKKKIEQ 633
              +++++L +  E+ + K ++
Sbjct: 203 --RVQTNELTLKGEQKRMKYDK 222

>Suva_10.511 Chr10 (873646..874971) [1326 bp, 441 aa] {ON} YLR394W
           (REAL)
          Length = 441

 Score = 35.8 bits (81), Expect = 0.079
 Identities = 42/211 (19%), Positives = 81/211 (38%), Gaps = 7/211 (3%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEEN 183
           P P+V +T D+        +S++ ++ + F          Q L KN ++   A++ N+  
Sbjct: 169 PPPTVDLTIDD--------NSLEEFEAKSFI---------QKLKKNSSLRNTAKNNNDST 211

Query: 184 IDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPD 363
               + H +        TLK PS+NSI     + +   N     ++  E  N+N+ +   
Sbjct: 212 TPSINHHVNKNQSLYIETLKNPSNNSIASPDLNPSANHNLPNISTI-AESTNVNRFSYSP 270

Query: 364 ITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT-------NDH 522
           +         NG  P  +   T  G +  K +  L     + SS     +       N+ 
Sbjct: 271 VH---VGKDFNGKIP-NFNTPTNNGSLSSKNISRLSSASFQPSSPLSSSSSRLILPNNNL 326

Query: 523 ADAHSTRSKVTTYSQGSSLESDKLNMAVEKN 615
            + H   + +T+ S       +KL +  ++N
Sbjct: 327 EELHHLNTPMTSTSTQFPSALEKLKITRKRN 357

>KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|P33420 Saccharomyces cerevisiae
           YPL174C NIP100 Large subunit of the dynactin complex
           which is involved in partitioning the mitotic spindle
           between mother and daughter cells putative ortholog of
           mammalian p150(glued)
          Length = 821

 Score = 35.8 bits (81), Expect = 0.090
 Identities = 40/164 (24%), Positives = 69/164 (42%)
 Frame = +1

Query: 103 KDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITH 282
           ++ Q   +  L+  + +     E  + +DE  +H    S+         S+N IE + T 
Sbjct: 240 EELQTQAETYLRTISALESKLFETTKTLDELKQHFSANSN---------SNNIIESLTTE 290

Query: 283 NALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLE 462
           N     S   D LK E L L +  L D            A  +E   E  + + KL+  E
Sbjct: 291 N--HQLSTELDCLKSELLKLKQTQLADEELE--------ALYKEVESELNSQIAKLQ--E 338

Query: 463 TLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKL 594
           TL  ++S +++ K+ +     +  S ++K   YSQ  S E ++L
Sbjct: 339 TLSTDESIINALKENNKTLKNELQSLQNKSGQYSQEMSPEVEEL 382

>NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8.604
            YOR195W
          Length = 846

 Score = 35.8 bits (81), Expect = 0.090
 Identities = 53/230 (23%), Positives = 90/230 (39%), Gaps = 21/230 (9%)
 Frame = +1

Query: 37   EYEDISSFSSIDSYKP----EPFTGFKDSQAP-EQPLLKNDTIVGKAQSENEENIDE--- 192
            +YED++  ++I   +     E     K+S+   E  + K +T+V + +++ E    E   
Sbjct: 592  QYEDVNDDANIKGAEVSELCEDLKELKESKTYLEGTISKLETVVDEWKTKYETQTTELKK 651

Query: 193  --------QHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNK 348
                    Q R+SD+ + H    LK      +        L+ +S T   L+ E  NL K
Sbjct: 652  VTVELESLQLRNSDIEAEH----LKELEHLHVNMSSLQEMLKDHSTTITELQEENENLKK 707

Query: 349  KALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHAD 528
                  T    N   NG    E     +   +  + +E+LK+E        KE  N H  
Sbjct: 708  MLKDSKTLFHENKEENGEGEGEAPENNDENNIDKREIESLKKE----VEEWKEKYNTHEK 763

Query: 529  AHSTRSKVTT---YSQGSSLESDKLNMAVE--KNKKKIEQYRKHKSEKGI 663
              + R K+     Y Q SS    K+ +  +  +NK + E  R +    G+
Sbjct: 764  DTNKRLKLLAEDLYIQYSSKHEQKVKLLKKGYENKYQGELSRLNLQNSGL 813

>NDAI0F02230 Chr6 (539524..542223) [2700 bp, 899 aa] {ON} Anc_6.175
           YPL180W
          Length = 899

 Score = 35.8 bits (81), Expect = 0.091
 Identities = 35/168 (20%), Positives = 67/168 (39%), Gaps = 7/168 (4%)
 Frame = +1

Query: 106 DSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHN 285
           D    +QPLL N   V  A ++N  N + + +HSD+ +  + +     +S+S       +
Sbjct: 459 DQAFAQQPLLPNTDRVPTATNKNINNQNLRLKHSDIGTLSTENKADTRTSHSRHNSTNQH 518

Query: 286 A-------LEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLV 444
           A       L  N + A   + +G       +P      TN+  N        L  E    
Sbjct: 519 AFSTSIPSLTSNLQNALQQQPQGSYHKTSRIPSNILDATNNNSNTNIRYHSALRNE---- 574

Query: 445 KLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESD 588
               + T+   D + S  K+  T+++   ++  +  TT +  ++ +SD
Sbjct: 575 ---NINTINNIDRKKSKLKENGTSNYHINNNYTTNTTTTNNNNNTKSD 619

>KNAG0E00340 Chr5 (49652..52360) [2709 bp, 902 aa] {ON} Anc_7.39
           YOR353C
          Length = 902

 Score = 35.8 bits (81), Expect = 0.091
 Identities = 39/174 (22%), Positives = 68/174 (39%), Gaps = 20/174 (11%)
 Frame = +1

Query: 130 LLKNDTIVGKAQSENEENIDEQHRHSDVYS---HHSSSTLKRPSSNSIEKMITHNALEGN 300
           L  N    G A S    NI+     S++ S   H +++T    ++      I+  +    
Sbjct: 496 LSSNVVATGSAISSPNSNIETTKSLSNIMSLNAHVNANTTNGSNNGQSMTPISQKSDVST 555

Query: 301 SETADSLKREG-----LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLET 465
           S  A S+   G     ++ N   +       T+   NG++P            +L ++  
Sbjct: 556 SSAASSINTGGTSHTVVDGNSSGVRANDHSTTSVQSNGSYP-----------ARLSSISL 604

Query: 466 LKREDSRVSSAKKEH------------TNDHADAHSTRSKVTTYSQGSSLESDK 591
            +R+D++ S A  EH            TN    + STR+KV T S  S + ++K
Sbjct: 605 YQRQDNQASEADYEHTQEGKSATNGATTNMSGSSDSTRTKVGTTSANSPVTAEK 658

>Kwal_26.7490 s26 (386917..387954) [1038 bp, 345 aa] {ON} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] FULL
          Length = 345

 Score = 35.4 bits (80), Expect = 0.096
 Identities = 41/195 (21%), Positives = 76/195 (38%), Gaps = 12/195 (6%)
 Frame = +1

Query: 103 KDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITH 282
           K++ A +     +++    + S +E   + +   S+  S  SS +    SS+S E+    
Sbjct: 22  KEAVAAKSESSSSESSSSSSSSSSESESESESSSSESSSSSSSDSSSDSSSDSEEEQEVK 81

Query: 283 NAL--EGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETET------- 435
                E   E    +K++     KKA P        S+           +TE+       
Sbjct: 82  KEAKKETKKEAKKEVKKDAKKETKKAAPKKVVKKAESSSESDSDSGSESDTESSDSDSSS 141

Query: 436 ---GLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAV 606
                 + +T ET K E +  SS+K   +   +D+ S  S  ++ S  SS  SD  +   
Sbjct: 142 SSDSEAEAETEET-KAEVAEESSSKTSSSGSSSDSSSESSSSSSDSDSSSSSSDSESSDE 200

Query: 607 EKNKKKIEQYRKHKS 651
           EK +   ++ +  +S
Sbjct: 201 EKEEASPKKRKAEES 215

>TDEL0F01450 Chr6 complement(260621..262360) [1740 bp, 579 aa] {ON}
           Anc_2.192 YNL095C
          Length = 579

 Score = 35.4 bits (80), Expect = 0.11
 Identities = 42/163 (25%), Positives = 75/163 (46%), Gaps = 7/163 (4%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDISSFSSIDSY--KPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENE 177
           P  +++ +T +E ED+S+ SSIDS   +P   +G  ++Q+               Q+ N+
Sbjct: 209 PEKALTKSTGSESEDVSNSSSIDSVGDQPNSSSGSANTQS--------------VQTRND 254

Query: 178 ENI-----DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNL 342
           ENI       + R   V        L+RPS  +  + I  +  EG  +  + L RE  N+
Sbjct: 255 ENIWDFIAARRTRSQPVALTEEPVRLRRPSVATTIRSI--DLREGPPQDFNDLIREYSNV 312

Query: 343 NKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLK 471
           ++   P   + +++   +GA P  Y   + + L KLK+ +  K
Sbjct: 313 DQYGHPRRNSRLSDM--DGA-PVSYSKSSSSALEKLKSSDLKK 352

>TBLA0J01370 Chr10 complement(316749..318974) [2226 bp, 741 aa] {ON}
           Anc_7.249 YER068W
          Length = 741

 Score = 35.4 bits (80), Expect = 0.12
 Identities = 46/217 (21%), Positives = 87/217 (40%), Gaps = 4/217 (1%)
 Frame = +1

Query: 19  SVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQH 198
           + TT+N   +  S ++I+S      T    S +P   L        K+Q  N + ++  H
Sbjct: 319 TTTTNNNLSNTKSSTTINS------TTTTHSASPSPAL-------AKSQLHNSQQLNG-H 364

Query: 199 RHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSE----TADSLKREGLNLNKKALPDI 366
            + D  ++  S+TL   ++ +   ++    L   S     T  +     LNLNK ALP +
Sbjct: 365 SYLDQNNNSLSNTLSNNNTGTSTPILIPATLPAGSNPWGVTQSATPLTSLNLNKSALPTL 424

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 546
              ++NS  N    +E      T L +     + ++  ++    ++   N +   ++ + 
Sbjct: 425 NDTLSNSNSNLDSQDEI-----TSLYQQSQQASPRQHQTQYDEVQQSPQNSNT-TNNNKK 478

Query: 547 KVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEK 657
           K     Q      D +N AV    ++I     +KS K
Sbjct: 479 KNVNVEQDYVDPYDVVNNAVTFLDERIHDLSDYKSVK 515

>TBLA0A02690 Chr1 complement(653373..656123) [2751 bp, 916 aa] {ON}
           Anc_5.453 YDR379W
          Length = 916

 Score = 35.4 bits (80), Expect = 0.12
 Identities = 38/164 (23%), Positives = 65/164 (39%), Gaps = 1/164 (0%)
 Frame = +1

Query: 103 KDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITH 282
           K      + L  NDT       +N      +   S    HHSS+ +   SS+ I   I+H
Sbjct: 400 KHQNISRENLSSNDTNKNIKSVDNNPYFTNKSSSSSNPKHHSSAAVLTKSSSFISHKISH 459

Query: 283 NALEGNSE-TADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTL 459
           +A   +S+  +DS      N   K    +   +     +GA    ++LE +         
Sbjct: 460 SAASKDSKIKSDSNDMVSSNSRLKQSTSVRHSLDRKVSSGA--SSHKLEEKE-------- 509

Query: 460 ETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDK 591
           + L+ E  ++   K++   D     S R K+T   + + LE+DK
Sbjct: 510 KDLQNEIGKLEKRKQKLIEDIEGLESRRDKLT--KEVNYLENDK 551

>Smik_15.402 Chr15 complement(697238..698785) [1548 bp, 515 aa] {ON}
           YOR216C (REAL)
          Length = 515

 Score = 35.0 bits (79), Expect = 0.15
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 5/91 (5%)
 Frame = +1

Query: 409 EEYRLETETGLVKLKT-LETLKREDSRVSSA----KKEHTNDHADAHSTRSKVTTYSQGS 573
           +E   E E+  +KLK  LE  K E+S + S       E  N   +  +T      Y    
Sbjct: 196 QEQLTEYESQNLKLKKKLEATKTENSELQSTIVTLNNELENLEKEQENTEDVFLEYESRI 255

Query: 574 SLESDKLNMAVEKNKKKIEQYRKHKSEKGIK 666
               D+ N  +EK+ K++  YRK K +  I+
Sbjct: 256 EALQDENNGIIEKHSKELNSYRKEKDQLNIQ 286

>Suva_10.129 Chr10 complement(236449..239115) [2667 bp, 888 aa] {ON}
           YLR045C (REAL)
          Length = 888

 Score = 35.0 bits (79), Expect = 0.16
 Identities = 35/137 (25%), Positives = 59/137 (43%), Gaps = 11/137 (8%)
 Frame = +1

Query: 262 IEKMITHNALEGNSETADSLKREGLNLNKKALPDI-TAPVTNSAHNGAFPEEYRLETETG 438
           I K+   N      E+ D+LKR+ +    K LP+  T   +NS+ + A  +   +E +  
Sbjct: 529 IIKIFGTNMFMKTLESLDNLKRKKIEETVKTLPNFNTGSGSNSSASEAKKQARPVENKFL 588

Query: 439 LVKLKTLETLKREDSRVSSAKKEHTNDHAD----------AHSTRSKVTTYSQGSSLESD 588
           L K   L + +   S +    K   N  A           A S +S+V   S+  +   +
Sbjct: 589 LKKSSVLPSKRVASSPLRYDNKAKANPTASMASATKPTMVAGSNKSRVLLTSKSLTTPKN 648

Query: 589 KLNMAVEKNKKKIEQYR 639
                V+KN+K IE+Y+
Sbjct: 649 PAANNVDKNEKLIEEYK 665

>Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {ON}
           YLR309C (REAL)
          Length = 916

 Score = 34.7 bits (78), Expect = 0.21
 Identities = 39/164 (23%), Positives = 70/164 (42%), Gaps = 5/164 (3%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDE-QHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETA 312
           KN T++   +++N E  ++    + +V    +SST K       E+ +  N L   +E  
Sbjct: 442 KNATMIEAYETKNSELRNKLDSLNKEVECLKTSSTEKEK-----EQALLQNKLVKLNEDI 496

Query: 313 DSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVS 492
             L  E   + K+      +        G   E+ +   E      K+ E LK+E+S++S
Sbjct: 497 SQLALEKSIITKELTSLKISYKQKEKTVGYLEEQVKQFNEQKDAAEKSTEQLKKENSKIS 556

Query: 493 SA----KKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEK 612
           +     KKE+   H D     +   TY + +   S++LN+  EK
Sbjct: 557 NRLDLLKKENETLHNDIKKNGNSYETYLKENGKLSERLNILQEK 600

>KLTH0G08250g Chr7 (672012..675770) [3759 bp, 1252 aa] {ON} some
            similarities with uniprot|P53935 Saccharomyces cerevisiae
            YNL091W NST1 Protein of unknown function mediates
            sensitivity to salt stress interacts physically with the
            splicing factor Msl1p and also displays genetic
            interaction with MSL1
          Length = 1252

 Score = 34.7 bits (78), Expect = 0.22
 Identities = 48/224 (21%), Positives = 83/224 (37%), Gaps = 12/224 (5%)
 Frame = +1

Query: 22   VTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHR 201
            +   N  E+I  +   D Y  E ++ ++D +  E      D +        EEN + Q+ 
Sbjct: 531  IANQNIQEEID-YDDEDEYDEEEYSDYEDEEESEY----EDDVY------EEENNNGQYH 579

Query: 202  HSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADS------LKREGLNLNKKALPD 363
            H   Y HH S T        +E+     A  GN E  DS         EG  L + A+  
Sbjct: 580  HHQ-YHHHHSHTHHHEEELELEEEEVSTA--GNEEEYDSGIDEQERLEEGRRLIQIAITK 636

Query: 364  ITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED------SRVSSAKKEHTNDHA 525
            +       +++    E  RL     L +L+  E  KRE        R    +K+     A
Sbjct: 637  LLQKKLVDSYHEKQAENNRLRL---LQELEAEEQKKREKEEKKQRKREKEKEKKRAQQQA 693

Query: 526  DAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEK 657
                 R K    ++      ++     E  ++++E+ ++ K E+
Sbjct: 694  KEQERRKKEEEDARLKKEAEEREMQRREAQRQRVEEAKRKKDEE 737

>TBLA0B04590 Chr2 (1061040..1065596) [4557 bp, 1518 aa] {ON} Anc_8.543
            YPL075W
          Length = 1518

 Score = 34.7 bits (78), Expect = 0.23
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = +1

Query: 223  HSSSTLKRPSSNSIEKMITHN--ALEGNSETADSLKREGLNLNKKALPDIT 369
            HSS  L  P  NS+E++ T+N  A   N+E   +L     NLN K   DIT
Sbjct: 1136 HSSDELNNPQINSLERIDTNNTEASVANNEIDSTLLPANSNLNTKGNQDIT 1186

>Kpol_1010.6 s1010 (15270..16112,16114..16965) [1695 bp, 564 aa]
           {ON} (15270..16112,16114..16965) [1695 nt, 565 aa]
          Length = 564

 Score = 34.3 bits (77), Expect = 0.26
 Identities = 31/103 (30%), Positives = 46/103 (44%), Gaps = 11/103 (10%)
 Frame = +1

Query: 382 NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTY 561
           N+A + +  E  +L  E GL  + + E + + + + SS  K H  + A  H   S     
Sbjct: 3   NNAESLSLEETNKLRLELGLKPISS-EAVAKPNEQNSSKVKGHKENEAPKHKLESNYLCS 61

Query: 562 S-----------QGSSLESDKLNMAVEKNKKKIEQYRKHKSEK 657
           S           QGSS E+D     V KNKK I   R +KS++
Sbjct: 62  SSISENIADSNLQGSSNENDDWLSNVGKNKKLIT--RNYKSDQ 102

>CAGL0K05445g Chr11 (534680..536491) [1812 bp, 603 aa] {ON} some
           similarities with uniprot|Q08490 Saccharomyces
           cerevisiae YOR073w
          Length = 603

 Score = 34.3 bits (77), Expect = 0.27
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 10/108 (9%)
 Frame = +1

Query: 103 KDSQAPEQPLLKNDTI--VGKAQSENEENIDEQHRHS-DVYSHHSSSTLKRPSSNSIEKM 273
           K    P +P   N+T+  + K +  NEE  + +   S    S HS+S++KR SS   E +
Sbjct: 110 KKESLPSRPTSTNETVDRIKKRRQSNEEARNRRRSRSVSTGSAHSTSSMKRRSSTFGEDL 169

Query: 274 I-------THNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHN 396
           I         NA   + +T+D+L+          LP +    TN+ +N
Sbjct: 170 IDASIKRALDNAQSNSLQTSDTLR-------LSELPGLNEIDTNNVNN 210

 Score = 29.6 bits (65), Expect = 8.2
 Identities = 37/177 (20%), Positives = 72/177 (40%), Gaps = 6/177 (3%)
 Frame = +1

Query: 118 PEQPLLKNDTIVGKAQSENEENIDEQHR----HSDVYSHHSSSTLKRPSSNSIEKMITHN 285
           PE+  L    I+ + + + +  ++++ +    H       SSS  ++P  NSI       
Sbjct: 297 PEENTLPKQDILDETE-KRDTAVNQKKKLEIFHDPPVEELSSSKNEKPPENSITNDPAFI 355

Query: 286 ALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLET 465
            + GN++   S+K      NK ++ D + P T S  +  F    R   +T   +L +L  
Sbjct: 356 TVTGNNKVKHSMKSRKPKKNKGSV-DESMPCTQSTESVDFDRPRRTRGKTVDYRLPSLRA 414

Query: 466 LKRE--DSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIE 630
             R   +  V +    +  D    +    KV      + +++ K   + +KN+K  E
Sbjct: 415 KMRRPTEKLVDATTTVNIQDLQVKYKKSKKVLEKELKTDMKAMK---SPKKNEKTFE 468

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 34.3 bits (77), Expect = 0.30
 Identities = 37/139 (26%), Positives = 55/139 (39%), Gaps = 5/139 (3%)
 Frame = +1

Query: 256  NSIEKMITHNALEGNSETADSLKREGLNLNK-KALPDITAPVTN----SAHNGAFPEEYR 420
            N++EK+I           +   K E   L K + L  I   +T       +N    E+ +
Sbjct: 1753 NTLEKVIESQKTNMKKSQSTITKFEEAILQKDEELAAIKTKITEIENRDKNNSNVIEQLK 1812

Query: 421  LETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNM 600
            LETE    KLK  +T  RED +V + K E      D            Q   +E  KL  
Sbjct: 1813 LETE----KLKQEQTNDREDYQVKATKMEEAKKKCDEE---------KQEQIIELQKLRE 1859

Query: 601  AVEKNKKKIEQYRKHKSEK 657
             +EK + + E++ K    K
Sbjct: 1860 KLEKLEHEREEHAKAADNK 1878

>TDEL0B06290 Chr2 (1112253..1113737) [1485 bp, 494 aa] {ON}
           Anc_1.377 YFR016C
          Length = 494

 Score = 33.9 bits (76), Expect = 0.34
 Identities = 45/213 (21%), Positives = 83/213 (38%), Gaps = 5/213 (2%)
 Frame = +1

Query: 10  PSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE-NI 186
           P  S +T  E++   S SS +S K + F         +    K   I     S N E N+
Sbjct: 149 PETSGST-KEHKSPESDSSGNSKKRDDFDANAKKTDTDTNESKTAAIDSSVNSNNTEGNV 207

Query: 187 DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
           D +   SDV    + +T K  ++ S  K +  +      E   + K  G + N   + D+
Sbjct: 208 DSKPAESDV----NDTTKKAETATSESKAVESDVTSNTKEAEVNAKTPGSSNNANKIEDV 263

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 546
            A  T      A P+           K + +  +K   S V ++  +       A+  ++
Sbjct: 264 IADETPPLDLSASPK-----------KTQDVVEVKPTKSDVDTSPIKTAGPDVSANLNKT 312

Query: 547 KVTTYSQGSSLES----DKLNMAVEKNKKKIEQ 633
           ++TT    + + S    ++L     KNK ++++
Sbjct: 313 EITTSKNEAEVVSPTSTNELLSEEIKNKAQLDE 345

>ZYRO0E02596g Chr5 complement(202673..204409) [1737 bp, 578 aa] {ON}
           some similarities with uniprot|Q12495 Saccharomyces
           cerevisiae YPR018W RLF2 Chromatin Assembly Complex
           subunit 1: largest (p90) subunit of three-subunit
           protein complex (yeast CAF-I) involved in
           DNA-replication-linked nucleosome assembly. Homol. to
           p150 subunit human Chromatin Assembly Factor-I (CAF-I)
           p90 subunit of yeast Chromatin Assembly Factor-I (CAF-I)
          Length = 578

 Score = 33.9 bits (76), Expect = 0.35
 Identities = 50/221 (22%), Positives = 89/221 (40%), Gaps = 7/221 (3%)
 Frame = +1

Query: 49  ISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHS 228
           +S F +I + + E      DS   ++ + K +    K QS+ E   +EQ +  +V     
Sbjct: 22  LSFFQNIKTKEEEEVIEVVDSDDEKRTVAKQEP-ESKPQSQLEVEKEEQDKDVNV-KDEP 79

Query: 229 SSTLKR-------PSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 387
           S+T+K+       P S + EK           +   S KRE +   K A       +   
Sbjct: 80  SNTMKQLKEVVVFPESTTEEKR--------KQKAEQSQKREDMKRQKDADKQRREELKRQ 131

Query: 388 AHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQ 567
                  ++ R E E    KLK  +  K +      AK+E      +      K+   S+
Sbjct: 132 KD----ADKQRREEE----KLKKEDEKKLKKENEKKAKEEERLKKEE----EKKLKKESE 179

Query: 568 GSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 690
             + E +K+    ++N+KK ++  K +S+  I  FF ++ D
Sbjct: 180 KKAKEEEKMK---KENEKKAKEEAKERSQARIGNFFKKVTD 217

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score = 33.9 bits (76), Expect = 0.37
 Identities = 44/187 (23%), Positives = 73/187 (39%), Gaps = 8/187 (4%)
 Frame = +1

Query: 133 LKNDTIVGKA--QSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSE 306
           L+N T +G+A    E+E    E+H   +  +   +S  KR +  + +      A E  S 
Sbjct: 19  LRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDD---GGARESQSY 75

Query: 307 TA--DSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
            A    L  E     KK L    A    +A  G  PEE      T  ++    +    ED
Sbjct: 76  GALLTLLSAEHGKQRKKRLRKAEAEAAEAAEAGEDPEE----AITAALENSAQDAEDAED 131

Query: 481 SRVSSAKKEHTNDHADAHSTRSKVTTYSQ-GSSLESDKLNMAVEKNKKKIEQYRKHK--- 648
           +   S + +   DH D H  R      +Q  ++ ++ +    V+K  +  E+    K   
Sbjct: 132 AFDDSGESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEEILYSKPVA 191

Query: 649 SEKGIKG 669
           S +G +G
Sbjct: 192 SSEGTEG 198

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
            similar to Ashbya gossypii AFL027C
          Length = 877

 Score = 33.9 bits (76), Expect = 0.38
 Identities = 34/154 (22%), Positives = 58/154 (37%)
 Frame = +1

Query: 172  NEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKK 351
            NEE   E+ RH D  S  +S+ +  P  +         A+   S++  S+ R   ++ K 
Sbjct: 720  NEEKHTEERRHFDADSGTASNDISEPGQDV--------AVTEESQSV-SVPRLDYSIKKM 770

Query: 352  ALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADA 531
              PD T+           P+  R E      K  TL ++K E     + K          
Sbjct: 771  VNPDGTSTYFAHVQINDLPQVVRWEA----TKFTTLSSIKHETGCSITNKGRFYPSGQGP 826

Query: 532  HSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQ 633
            H T  +   Y    S     +++A+E  + K+ +
Sbjct: 827  HDTTDEPKLYLLVESANDKDISLAIELLETKVRE 860

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] {ON}
            some similarities with uniprot|P38853 Saccharomyces
            cerevisiae YHR158c KEL1 involved in cell fusion and
            morphology
          Length = 1136

 Score = 33.9 bits (76), Expect = 0.39
 Identities = 49/222 (22%), Positives = 86/222 (38%), Gaps = 8/222 (3%)
 Frame = +1

Query: 28   TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS 207
            T  +YEDI +   +D+   E F G    Q+ +   LK   +     SE  E +  Q+   
Sbjct: 880  TLQQYEDILAAKVLDA---EKFNGIIKVQSDKIDELKLHVV----NSEEFEKLKIQNEVL 932

Query: 208  DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKK---ALPDITAPV 378
            +  +      LK   +N  + ++        S T D L +     +KK   +   + A  
Sbjct: 933  EKENQDLKDKLKEKDNNLDKSIVMF------SGTVDELLKNWRMTSKKDTSSASPVAATQ 986

Query: 379  TNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTT 558
            + S  N     +     +  LVK K L T   E       + E  N+   + +  S ++ 
Sbjct: 987  SQSTKNRNIISKMNNRLDDLLVKSKEL-TESEEQIDSEYEQLEIKNESIQSQARHSSISV 1045

Query: 559  YSQGSSLESDKLNMAVEKNKKKIEQYRKHKSE-----KGIKG 669
                S + +     A+ ++K+KIE Y+ H  +      G+KG
Sbjct: 1046 KETASDIAN-----AMNESKRKIEDYKAHTEKLQNEIDGLKG 1082

>YGR070W Chr7 (627806..631273) [3468 bp, 1155 aa] {ON}  ROM1GDP/GTP
           exchange protein (GEP) for Rho1p; mutations are
           synthetically lethal with mutations in rom2, which also
           encodes a GEP
          Length = 1155

 Score = 33.9 bits (76), Expect = 0.39
 Identities = 44/167 (26%), Positives = 68/167 (40%), Gaps = 6/167 (3%)
 Frame = +1

Query: 82  PEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSH---HSSSTLKRPS 252
           P+ FTG + S   ++  + + T   K  S    +   Q R + +  H   HSS +L   S
Sbjct: 103 PQSFTGDQISPTNKKISINDSTRQDKGNSCTTTSSPSQKRSNVLLPHVRKHSSPSLLSFS 162

Query: 253 SNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETE 432
            NS   M   N L     T  + K  G  +             +S+ NG    ++   + 
Sbjct: 163 KNSGSHMGDPNQLS----TPPTPKSAGHTME-----------LHSSFNG----KHSSSST 203

Query: 433 TGLVKLKTLETLKREDSRVS---SAKKEHTNDHADAHSTRSKVTTYS 564
           + L  L++L+T  R  S  S   S  + HTN H   H +RSK +  S
Sbjct: 204 SSLFALESLKTQNRRSSNSSNHSSQYRRHTNQH-QRHHSRSKSSPVS 249

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 33.5 bits (75), Expect = 0.44
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 2/99 (2%)
 Frame = +1

Query: 52  SSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQS--ENEENIDEQHRHSDVYSHH 225
           S+ SSI+S+KP+P      S       L   T + K  S  E+E N    H  S    H 
Sbjct: 143 STKSSIESFKPKPLRIISRSNTHSH--LHQQTSLDKKVSFNEDESNSSISHSRSMESLHE 200

Query: 226 SSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNL 342
           +S +L+   S  + K  T       S+  +S +R  +N+
Sbjct: 201 NSKSLRNTKSMDVLKRSTFKNHSDFSKLLNSRQRLSINI 239

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 33.5 bits (75), Expect = 0.44
 Identities = 35/176 (19%), Positives = 65/176 (36%), Gaps = 7/176 (3%)
 Frame = +1

Query: 103 KDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITH 282
           KD++   QP  +    V   +S +  + D     SD  S  SSS+    SS+S +   + 
Sbjct: 8   KDTKKAVQPKKEEKKAVKPVESSDSSDSDSSSSDSD--SSSSSSSSSSSSSSSSDSESSS 65

Query: 283 NALEGNSETADSLKREGLNLNKK-------ALPDITAPVTNSAHNGAFPEEYRLETETGL 441
           +  E +S   +  K+E     KK       +    ++  ++S  + +  EE   + E   
Sbjct: 66  SDSESSSSNEEEEKKETKKETKKEAKKEASSSSSSSSSSSSSDSDSSSDEEAEEKVEEKA 125

Query: 442 VKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVE 609
            K  +  +   +D    S+     ++  +    +S           ESD     VE
Sbjct: 126 EKTSSSSSDSSDDDSSDSSSSSSNDEEEEEEEKKSSKRKADDSEESESDSKKQKVE 181

>KLTH0H10494g Chr8 complement(904424..905893) [1470 bp, 489 aa] {ON}
           conserved hypothetical protein
          Length = 489

 Score = 33.5 bits (75), Expect = 0.45
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +1

Query: 40  YEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYS 219
           Y ++SS  +     P PF G     AP QPLL+       + S++     + H HS +++
Sbjct: 226 YANMSSGPAQPPLPPPPFHGVNQFYAPAQPLLQR-----PSHSQHAPQQLQSHPHSLMHA 280

Query: 220 -HHSSSTLKRPSSNS 261
             HS S  + PS NS
Sbjct: 281 LPHSKSQSELPSLNS 295

>KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.446
           YMR104C
          Length = 677

 Score = 33.5 bits (75), Expect = 0.48
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 8/114 (7%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDEQHRHSDVYSHHSSST-------LKRPSSNSIEKMITHNALE 294
           KN    GK++ E E+  D++ +HS  + H SSST       L    S SI  + +     
Sbjct: 5   KNRFKFGKSKEEKEK--DKETKHSGFFHHSSSSTSLSNQDELSHEKSKSITPIDSRKETI 62

Query: 295 GNSETADSLKREGLNLNKKALPDITA-PVTNSAHNGAFPEEYRLETETGLVKLK 453
            NS++     R   + N  +     A P  N   + A P +    + +G++ +K
Sbjct: 63  TNSDSVMVPTRSSYDANSSSTSTFGADPNINRNSSNATPVQNNQTSSSGIMTIK 116

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 33.5 bits (75), Expect = 0.49
 Identities = 28/116 (24%), Positives = 44/116 (37%), Gaps = 15/116 (12%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETAD 315
           KN  I   + S N  N  E++  +  ++ +S+  L         +MI  N +     +  
Sbjct: 69  KNLLIPCSSTSSNNNNTSEENGENQQFTSNSTEQLDN------SQMININGISFIDPSTT 122

Query: 316 SLKREG---------------LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETG 438
            L   G               L+LN   LP+  +P TNS  N  F   +RL   +G
Sbjct: 123 QLHHAGYCFVEFETQTDAQFALSLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASG 178

>TBLA0A03020 Chr1 complement(723036..726128) [3093 bp, 1030 aa] {ON}
           Anc_5.333 YDR310C
          Length = 1030

 Score = 33.5 bits (75), Expect = 0.51
 Identities = 35/158 (22%), Positives = 58/158 (36%), Gaps = 1/158 (0%)
 Frame = +1

Query: 127 PLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSE 306
           PL KND       S    NI ++H HS + S+ SSS                    G   
Sbjct: 261 PLAKNDDSANS--SNGLHNIKQEHTHSSITSNKSSS--------------------GPPS 298

Query: 307 TADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSR 486
           +A   KR G    K+ +  +   + N A       +    T+          +   +D  
Sbjct: 299 SAPIKKRRGRPPKKRTVDTVIININNPASTALNHRQLLSSTQDSPSAQSKKNSQGNQDLT 358

Query: 487 VSSAKKEHTNDHADAHSTRS-KVTTYSQGSSLESDKLN 597
            +S  K  T+ + ++   +S + TT S  +S + D +N
Sbjct: 359 ATSENKGTTDGNENSTKEQSVESTTVSPSASSDPDYIN 396

>YJL084C Chr10 complement(274862..278002) [3141 bp, 1046 aa] {ON}
            ALY2Alpha arrestin that controls nutrient-mediated
            intracellular sorting of permease Gap1p; interacts with
            AP-1 subunit Apl4p; phosphorylated by Npr1p and also by
            cyclin-CDK complex Pcl7p-Pho85p; promotes endocytosis of
            plasma membrane proteins
          Length = 1046

 Score = 33.5 bits (75), Expect = 0.51
 Identities = 35/193 (18%), Positives = 74/193 (38%), Gaps = 24/193 (12%)
 Frame = +1

Query: 106  DSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYS--HHSSSTLKRPSSNSIEKMIT 279
            +S+ P  P LK       +   + E ++++   S +    H   +T K+  +  ++ + T
Sbjct: 718  NSKHPTPPSLKASHPNKNSDKNSSETLNKKESMSKIEENKHKRETTPKKRENRDVKSLST 777

Query: 280  HNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTL 459
                E    T  S   +    N+K +  +++ + +S +N  F       +  G +  ++L
Sbjct: 778  PQREESKDST--STGNQSNEKNRKRVLSLSSSLHSSPNNSGFAH-----SALGNLSNESL 830

Query: 460  ETLKREDS----------------------RVSSAKKEHTNDHADAHSTRSKVTTYSQGS 573
             +L R +S                       +    K H  +  + HST +  T  S  S
Sbjct: 831  RSLNRRESVQDNLPSTIRHDNPFFTDLNQVLIEDELKNHDKNELNRHSTNTSSTPASARS 890

Query: 574  SLESDKLNMAVEK 612
            S +   +N++ +K
Sbjct: 891  SFDYSGINISKDK 903

>KAFR0B02410 Chr2 complement(467555..473848) [6294 bp, 2097 aa] {ON}
           Anc_8.207 YER155C
          Length = 2097

 Score = 33.5 bits (75), Expect = 0.54
 Identities = 32/145 (22%), Positives = 65/145 (44%), Gaps = 10/145 (6%)
 Frame = +1

Query: 220 HHSSSTLKRPSSNS--------IEKMITHNALEGNSETADSLKR--EGLNLNKKALPDIT 369
           H  SS LK  SS +        ++K  + ++L G+  ++ SL +   G + + +   +++
Sbjct: 10  HKKSSNLKTSSSPNSTGRDSYTVQKSSSRSSLSGSQSSSSSLSQYLHGTHHSSRNGRNLS 69

Query: 370 APVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSK 549
            P++NS  N   P E      T  + L+        +S ++    +      ++  TRS 
Sbjct: 70  LPLSNS--NSHLPTENYNRRSTSKLPLRD-----HSNSPLTHTTSDVYLSDPNSKLTRSS 122

Query: 550 VTTYSQGSSLESDKLNMAVEKNKKK 624
           ++T  + SSL S+ +     KN+ +
Sbjct: 123 LSTSRENSSLISEDIGSISSKNRSQ 147

>YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON}
           RUD3Golgi matrix protein involved in the structural
           organization of the cis-Golgi; interacts genetically
           with COG3 and USO1
          Length = 484

 Score = 33.1 bits (74), Expect = 0.60
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 5/91 (5%)
 Frame = +1

Query: 409 EEYRLETETGLVKLKT-LETLKREDSRVSSA----KKEHTNDHADAHSTRSKVTTYSQGS 573
           +E   E E+  +KLK  LE  K E+S + S       E  N   +  ST      Y    
Sbjct: 166 QEQLTEYESQNLKLKKKLEATKTENSELQSTIVTLNTELENLEKEQESTEEVFLEYESRI 225

Query: 574 SLESDKLNMAVEKNKKKIEQYRKHKSEKGIK 666
               D+ +  +EK+ K++  YRK K +  ++
Sbjct: 226 EALEDEKHDIIEKHSKELNTYRKEKDQLNLQ 256

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score = 33.1 bits (74), Expect = 0.61
 Identities = 46/171 (26%), Positives = 72/171 (42%), Gaps = 6/171 (3%)
 Frame = +1

Query: 160 AQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLN 339
           A + NEE  DE+   S++    S   +  P SN +EK+I              L     +
Sbjct: 139 ALAHNEE--DEEDELSNIEEQQSEINVLLPPSNPLEKLI-----------PSWLPNFPPD 185

Query: 340 LNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTN- 516
              K  P+   P+T+        +E   E+E      K L  L +  S +SSA   HT+ 
Sbjct: 186 HTYKFTPEFNHPITDLK---TIKKEIVKESEE---SEKALLNLNKRLSHLSSA--SHTSP 237

Query: 517 ----DHADAHSTRSKVTTYSQGSSLESDKLNM-AVEKNKKKIEQYRKHKSE 654
               D ADA   + ++     G++L+  K  + A   N+  IEQY K++ E
Sbjct: 238 PPVLDDADATEQQLEI----WGNALQERKPTITATSLNESNIEQYAKYRVE 284

>KLLA0D09240g Chr4 complement(775848..778094) [2247 bp, 748 aa] {ON}
           weakly similar to uniprot|P28006 Saccharomyces
           cerevisiae YOR178C GAC1 Regulatory subunit for Glc7p
           (protein phosphatase I) for glycogen synthesis
           regulatory role also predicted for glucose repression
           and ion homeostasis potential Cdc28p substrate
          Length = 748

 Score = 33.1 bits (74), Expect = 0.65
 Identities = 40/185 (21%), Positives = 71/185 (38%), Gaps = 24/185 (12%)
 Frame = +1

Query: 19  SVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQH 198
           ++T DN +  +S+ +    Y   P +GF  +          D+    + S N +N D+  
Sbjct: 47  TITLDNRHRRVSNSNKTVPYPETPRSGFGITHGCSNAGHSIDSFSNNSNSNNNDNNDDDK 106

Query: 199 RHSDVYSHH---------------------SSSTLKRPSSNSIEKMITHNALEGNSETAD 315
            +S+    +                     S+ T    S NS     + +  +G SET  
Sbjct: 107 NNSNTNDSNDDNGDDITKCISNLSVYDLLSSTQTASSSSENS-----SSDTSDGGSETDI 161

Query: 316 SLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLV-KLKTLETLKREDSR-- 486
            +        K AL    APV ++A +    + YR  +   ++ KLK+   L    S+  
Sbjct: 162 EMDHSQKLAIKSALSVNNAPVASTASSAITGKLYRQTSHPPIMRKLKSSLKLSSASSQSS 221

Query: 487 VSSAK 501
           +SS+K
Sbjct: 222 ISSSK 226

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1217

 Score = 33.1 bits (74), Expect = 0.69
 Identities = 38/170 (22%), Positives = 68/170 (40%), Gaps = 1/170 (0%)
 Frame = +1

Query: 148 IVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKR 327
           +V KA+S+ E+ I E  +  D Y  +   T    S N  EK +          + +S K+
Sbjct: 348 VVTKAKSDFEKEIKESSKDHDKYKLNEDDTKLYASLN--EKYLNQGGF-----SLESQKQ 400

Query: 328 EGLNLNKKALPDI-TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKK 504
             LN  ++ + ++ T    N        +E  +            E L+ + S +SS   
Sbjct: 401 LTLNDKQELMDEMETLKKRNDISRSRVTDELSV----------IAEKLESQLSEISSTLN 450

Query: 505 EHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSE 654
           E  + H+D      K+ +  + SS +   LN  + +   KIE+    + E
Sbjct: 451 ERNSTHSDKVKELQKLHSQIESSSNKEYDLNYKLREVLVKIEELSASQRE 500

>NDAI0A07620 Chr1 complement(1745936..1749829) [3894 bp, 1297 aa]
           {ON} Anc_3.307 YBR081C
          Length = 1297

 Score = 33.1 bits (74), Expect = 0.69
 Identities = 33/154 (21%), Positives = 65/154 (42%), Gaps = 25/154 (16%)
 Frame = +1

Query: 271 MITHNALEGNSETADSLKREGLNLNKKAL------PDIT----APVTNSAHNGAFPEEYR 420
           +I  N L  NS+ +  L+   + + KK+L      PDIT    A V          ++Y 
Sbjct: 508 LIWKNCLTYNSDPSHFLRAHAIAMQKKSLNLIPMIPDITIRNRADVEKEIEGNEKDKDYE 567

Query: 421 LETETG------------LVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYS 564
            E E              ++     +     ++ +++  +E TND     ++  +    S
Sbjct: 568 EEEEVAGSGRKGLNMGAHMLTKNNTQLPNGTETTMTNETEEETNDEQLPANSHLEKDISS 627

Query: 565 QGSSLESDKLNMAVEKNKKK---IEQYRKHKSEK 657
             SS   DKLN  V++ +K+   +E+  ++++E+
Sbjct: 628 TSSSKVEDKLNNKVDETRKEEDGVEEENENEAEE 661

>Kpol_1025.2 s1025 complement(4571..9094) [4524 bp, 1507 aa] {ON}
            complement(4571..9094) [4524 nt, 1508 aa]
          Length = 1507

 Score = 33.1 bits (74), Expect = 0.70
 Identities = 37/172 (21%), Positives = 64/172 (37%), Gaps = 9/172 (5%)
 Frame = +1

Query: 70   DSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRP 249
            D  K    +G  + + P  P  K    +    S    +   + + +   +  SS  LK P
Sbjct: 1297 DEPKDTDSSGSNNDKLPNGPTKKRPRKITATNSSKTNSPGLEKQDTGNGTEPSSKRLK-P 1355

Query: 250  SSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLET 429
                   +I +     NS T+ +  +   N          +P + S H   +PE    E 
Sbjct: 1356 LPKGPAGLIHNMRSSSNSPTSYTKSKTPKNHPHGGANKPISPASTSEHEKEYPEMDEDEC 1415

Query: 430  ETGLVKLKT-LETLKR--------EDSRVSSAKKEHTNDHADAHSTRSKVTT 558
               + K++T L  L++        E +++   +     DH D+H T SK TT
Sbjct: 1416 RQVMSKMRTSLMRLRKGGKGLDRKEWAKILKTELTAIGDHIDSHKTESKKTT 1467

>TBLA0A01080 Chr1 complement(241869..246641) [4773 bp, 1590 aa] {ON}
           Anc_7.154 YER008C
          Length = 1590

 Score = 33.1 bits (74), Expect = 0.70
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 9/110 (8%)
 Frame = +1

Query: 274 ITHNALEGNSETA--------DSLKREGLN-LNKKALPDITAPVTNSAHNGAFPEEYRLE 426
           +T N    N+ +A        +SL  E  N +N    P ++A +T++      PE  R  
Sbjct: 363 VTSNTKNSNTNSAPLQKISDSNSLTTEISNGMNTSIAPSVSADITSAPPVLQIPERSRAR 422

Query: 427 TETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSS 576
                +K K +E+ K+  S  S + K  +NDH+D   T + +   S  SS
Sbjct: 423 -----MKAKNVESKKQNSSHTSRSHK--SNDHSDPKYTETDLHNNSMISS 465

>NDAI0F03960 Chr6 (941691..942290) [600 bp, 199 aa] {ON} Anc_1.117
           YNL245C
          Length = 199

 Score = 32.3 bits (72), Expect = 0.71
 Identities = 46/201 (22%), Positives = 82/201 (40%), Gaps = 14/201 (6%)
 Frame = +1

Query: 67  IDSYKPEPFTGFKDSQAPEQPLLKNDT--IVGKAQSENEENIDE----QHRHSDVYSHHS 228
           + S+ P+     K     EQ +LK +   +  K + E E   +E    +     V S  S
Sbjct: 9   LKSWNPKLMKNRKKVWETEQEILKEEQKLLERKKEIEKERQFNELLNAERDIDGVDSSSS 68

Query: 229 SSTLKRPSSNSIEKMITHNA-------LEGNSETADS-LKREGLNLNKKALPDITAPVTN 384
           SST+K  +S  +E M  +N        L G  +   S +KR+  N  +  +   T   T+
Sbjct: 69  SSTIKNKASTGLEWMYENNVPDEKEDYLLGKKKLDTSVIKRQESNTEENKMLKKTGERTS 128

Query: 385 SAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYS 564
           +       +++ L +E  + K+K    LK++    S+ K+  T       +TR       
Sbjct: 129 T------KKKFDLSSEDPMAKMKQAYLLKKK----STLKRGSTTT-----NTRPSGGITK 173

Query: 565 QGSSLESDKLNMAVEKNKKKI 627
            G ++   +    V  +KKK+
Sbjct: 174 PGRNMVQSRSKPNVNASKKKL 194

>Skud_4.249 Chr4 complement(432630..433817) [1188 bp, 395 aa] {ON}
           YDL005C (REAL)
          Length = 395

 Score = 32.7 bits (73), Expect = 0.76
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 10/123 (8%)
 Frame = +1

Query: 10  PSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENID 189
           PS ++  D    DIS FS +DS      T F DS A   P       VG A+S ++ N+ 
Sbjct: 218 PSDAMFNDLNSMDISMFSGLDS------TAF-DSTAFNPP-------VGGAKSLDDNNLA 263

Query: 190 EQHRHSDV------YSHHSSSTLKRP----SSNSIEKMITHNALEGNSETADSLKREGLN 339
           + +   ++       S++SS+++K      ++N+       N+   N+ T  S+ +  +N
Sbjct: 264 DNYSEMNISPVENTNSNNSSNSIKNSNDNNNNNNNNNKTNDNSDNNNNHTNISVSKNNIN 323

Query: 340 LNK 348
           ++K
Sbjct: 324 VSK 326

>TBLA0B01150 Chr2 (249125..250459) [1335 bp, 444 aa] {ON} Anc_2.130
           YNL136W
          Length = 444

 Score = 32.7 bits (73), Expect = 0.79
 Identities = 43/207 (20%), Positives = 78/207 (37%), Gaps = 20/207 (9%)
 Frame = +1

Query: 103 KDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITH 282
           KD+   E+P  K + +      ENE +I E    SD  S    +    PS+N        
Sbjct: 164 KDNITSEKPPSKKNNL------ENEVSISESRPVSDTKSSKLDTHGNIPSTNESTTDTKE 217

Query: 283 NALEGNSETAD------------SLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLE 426
             LE    T+D            S+ +E +   KK+ PD    ++ S             
Sbjct: 218 KTLETKESTSDAKEITSEINETKSVTKENITNTKKSSPDTNEKISKS------------- 264

Query: 427 TETGLVKLKTLETL-----KREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSL---E 582
            E   + +K  +T+      ++ S V+S+ K+   D  +  S  ++  +   G++L   +
Sbjct: 265 -EDEHISIKGKDTVNVAASSKDTSCVASSSKDTYKDDKNTASEDAENNSPVNGANLKTAD 323

Query: 583 SDKLNMAVEKNKKKIEQYRKHKSEKGI 663
           S       + N   +E+    + EK +
Sbjct: 324 SKITEKGNDSNSNTVEEISVKEIEKEV 350

>NDAI0K02370 Chr11 (532190..533893) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 32.7 bits (73), Expect = 0.83
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 1/103 (0%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDISSFSSIDSYKP-EPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 180
           PVP V+ TT +E    SSFSS     P    T    ++    P + + +  G        
Sbjct: 465 PVPIVTKTTTSETSSSSSFSSTPVTTPATTMTSVTSTRTTPTPTISSPSTSG-------- 516

Query: 181 NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSET 309
                      + + SSS+   PSS+    ++T +  EGN  T
Sbjct: 517 -----------FIYQSSSSSSVPSSSGTSTVLTVSQYEGNGST 548

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 32.7 bits (73), Expect = 0.87
 Identities = 40/163 (24%), Positives = 60/163 (36%), Gaps = 33/163 (20%)
 Frame = +1

Query: 169 ENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEK----MITHNALEGNSETADSLKREGL 336
           ENE+  D       +   +S   LK  S N I      +I  + ++   E AD   +E L
Sbjct: 200 ENEKQFDTDR----ISRSYSLKYLKGLSENIIRTINLLLIKKDMIDDEVEAADKKLQEAL 255

Query: 337 NLNKKALPDITAPVTNSAHNG----------AFPEEYRLETET----------GLVKLKT 456
             ++KA   +    TN               +F EEY LE ET          G    KT
Sbjct: 256 KKSEKAKKKLKTAETNELQLDNILSLVKERISFIEEYDLEVETSCSKDSENVEGKTDEKT 315

Query: 457 LETLK---------REDSRVSSAKKEHTNDHADAHSTRSKVTT 558
            +  +         RED+R    +KE       +HS   K+++
Sbjct: 316 PDNTEVHTNTNLNTREDNRDDVTRKEEIKSSRISHSLNEKISS 358

>Smik_8.233 Chr8 complement(371188..373377) [2190 bp, 729 aa] {ON}
           YHR149C (REAL)
          Length = 729

 Score = 32.7 bits (73), Expect = 0.87
 Identities = 34/141 (24%), Positives = 60/141 (42%), Gaps = 12/141 (8%)
 Frame = +1

Query: 133 LKNDTIVGKAQSENEENIDEQHRHSDVYSHH-----SSSTLKRPSSNSIEKMITHNALEG 297
           ++ D I G   + N  N  +   H D +S+H     SS   +  S  S   +  +N +  
Sbjct: 199 VQGDGIGGYKVAANSRNASQTSLHPDNFSNHTPLRASSRFQESRSVQSHNSVTDNNQIPH 258

Query: 298 NSETADSLKREGL--NLNKKALPDITAPVTNSAH----NGAFPEEYRLETETGLVKLKTL 459
           +S TA + K+      L+K    D    ++N +H    N AF  E+  +  +     K+L
Sbjct: 259 SSATAIAYKQSTSPNELSKSTRFDEETEISNESHRLSGNDAF--EFEFDDASEKTHRKSL 316

Query: 460 ETLKREDSRVSSAKK-EHTND 519
           +    +D  +   K+ EH +D
Sbjct: 317 QVGNNDDYELQVIKEPEHVDD 337

>NCAS0A03460 Chr1 (681704..684139) [2436 bp, 811 aa] {ON} Anc_4.100
           YBL009W
          Length = 811

 Score = 32.7 bits (73), Expect = 0.88
 Identities = 51/234 (21%), Positives = 95/234 (40%), Gaps = 19/234 (8%)
 Frame = +1

Query: 22  VTTDNEYEDISSFSSIDSY--KPEPFTGFKD-----SQAPEQPLLKNDTIVGKAQSENEE 180
           V+ D +Y++     SI +   + EP    K+      Q  +QP++   +      S N+ 
Sbjct: 21  VSDDEDYDEEDENISISNIVIEEEPLKVVKEILTVPEQKKQQPVVATASTKSSRSSSNKN 80

Query: 181 NI------------DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLK 324
           N+             E+ +     S+HSSS+ KR S+ S     T+++    S+  DS  
Sbjct: 81  NVAQPPQTKQVKNKSEEKKRWSFMSNHSSSSKKRWSTLS---AFTNDSGNSTSKERDSQY 137

Query: 325 REGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKK 504
            + ++ +   +  ITA  T+S+ N              +    +L + +      S +  
Sbjct: 138 VKRISTHSSNI-SITAANTSSSSN------------KRMSLASSLSSNEHSTGADSMSHN 184

Query: 505 EHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIK 666
           E  N+H  +   RS     S GSSL   +L   +  N+ K    ++H S+  ++
Sbjct: 185 EMNNEHKHSLMKRS-----STGSSLR--QLFNKIVINEPKDGNIKQHASQDKLR 231

>SAKL0E13816g Chr5 complement(1138187..1139032) [846 bp, 281 aa]
           {ON} weakly similar to uniprot|Q75E48 Ashbya gossypii
           ABL178W ABL178Wp and some similarites with YNL215W
           uniprot|P40154 Saccharomyces cerevisiae YNL215W IES2
           Protein that associates with the INO80 chromatin
           remodeling complex under low-salt conditions
          Length = 281

 Score = 32.3 bits (72), Expect = 0.89
 Identities = 43/224 (19%), Positives = 84/224 (37%), Gaps = 6/224 (2%)
 Frame = +1

Query: 13  SVSVTTDNEYEDISSFSSIDSYK--PEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENI 186
           S  +  D E ++I      D Y+  PE     ++     +P  ++  I+ K   E +E I
Sbjct: 26  SQELVEDEENDEIPVQEEDDDYQYVPEYEEEEEEESVLPKPSARSGRIMAKVVDEADEYI 85

Query: 187 DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
           D+    +   +++  +T +R  +N  + +++    E + +  +          +KA  +I
Sbjct: 86  DDDGEFAATETYNPRATTRRTQANKAKGLLS-TPQEASDKEDEIASSSAPQRKRKATVEI 144

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKR----EDSRVSSAKKEHTNDHADAH 534
                         EE   E ET   ++KT    K      D + S  K++ T +     
Sbjct: 145 --------------EEEDEEDETEANEIKTTSRSKMIMELMDDQASRKKEKLTEEEIQLR 190

Query: 535 STRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIK 666
               +  T  +  +L   KL    +    K+ + R  KS   +K
Sbjct: 191 ----RAETARKRKNLSEKKLEEEKQDTINKLLKRRAGKSRSNVK 230

>TPHA0B01390 Chr2 complement(313019..315697) [2679 bp, 892 aa] {ON}
           Anc_7.460 YJR089W
          Length = 892

 Score = 32.7 bits (73), Expect = 0.89
 Identities = 41/165 (24%), Positives = 74/165 (44%), Gaps = 19/165 (11%)
 Frame = +1

Query: 163 QSENEENIDEQHR-HSDVYSHHSS-STLKRPSSNSIEKMITHNALEGNS-----ETADSL 321
           Q  N E+I+  +   SD Y+  S  ST+  P ++  +  I  N+LEG S     E  D  
Sbjct: 425 QVPNLEDINLSYSLSSDEYTSSSDLSTVSTPINSPSKSKIKDNSLEGASDRFSIEPVDLK 484

Query: 322 KREGLNLNKKALPDITA----PVTNSAHNGAFPEEYRLETETGLVKLKTLET-------- 465
                N+  K +  + +     + NS +     +EY   +E   V +  ++T        
Sbjct: 485 NDHNTNILTKEVEKVISVSSFQIKNSKNYHNNVKEYSSLSEDSDVNISLVDTGKLILETK 544

Query: 466 LKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNM 600
           +K ++S  S++K+E +N H D ++ +++   YS        KLN+
Sbjct: 545 VKSKESN-STSKEESSNAHGDKNNGQAQ---YSDRDRNTDQKLNV 585

>Suva_14.257 Chr14 (472064..474742) [2679 bp, 892 aa] {ON} YNL082W
           (REAL)
          Length = 892

 Score = 32.7 bits (73), Expect = 0.89
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%)
 Frame = +1

Query: 118 PEQPLLKNDTIVGKAQSENEENIDEQ---HRHSDVYSHHSSSTLKRPSSNSIEK 270
           PEQ   K   I  K Q  N+EN+  +   H + D+ + HS STL R   N++E+
Sbjct: 371 PEQQTPKRHRIEFKTQVANDENMAHETISHSYGDIGNKHSESTLTR-CDNTLEE 423

>NDAI0F01700 Chr6 (413683..416448) [2766 bp, 921 aa] {ON} Anc_6.201
            YPL195W
          Length = 921

 Score = 32.7 bits (73), Expect = 0.89
 Identities = 52/223 (23%), Positives = 89/223 (39%), Gaps = 13/223 (5%)
 Frame = +1

Query: 25   TTDNEYEDISSFSSIDSYKPEPFTGFKD-SQAPEQPLLKNDTIVGKAQSENEENIDEQHR 201
            T +N  E++ S  S++   P+  +G  D S+  ++  L N   + K +  NE+NI     
Sbjct: 694  TDENSPEELES--SLNEEYPQ--SGVNDLSRQEKKEQLSNPYYLNKLK--NEKNI----- 742

Query: 202  HSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNK-KALPDITAPV 378
            H +   + S  T+  P S S +  + +   E +     S ++ G NL     L D     
Sbjct: 743  HDNDLLNISDETIHSPESLSAKIKLVNKDQEQSPSPNSSSRKIGRNLIPVTVLADEVINT 802

Query: 379  TNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT-----------NDHA 525
              S       +E          K+      K E    SS+   H+           ND  
Sbjct: 803  NGSTRQTLASKENTFHPAHSKGKINFNIPSKLESFDFSSSTNIHSTVDIDDRVVDDNDTL 862

Query: 526  DAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSE 654
            +    R+K T   + S  E  +  + ++K KKK +++RK KS+
Sbjct: 863  ELEKLRNKFT---EASGEEVPEEVVIIKKKKKKNKEHRKSKSK 902

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 32.7 bits (73), Expect = 0.91
 Identities = 39/171 (22%), Positives = 67/171 (39%), Gaps = 17/171 (9%)
 Frame = +1

Query: 193 QHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITA 372
           Q R + +     SS+ K+P+S +    + HN L  +S T  +   +  ++NKK    + A
Sbjct: 395 QRRKNRISMISVSSSHKKPASFNRLSSVVHNNLSASSSTTTTPASKKFSMNKKL--SMIA 452

Query: 373 PVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSK- 549
             +NS  N + P        T ++       L +      S+K+     +    S  +K 
Sbjct: 453 DKSNS--NNSSPTPAHRNKRTSMINTDRQSILSKNKRASRSSKRLSVMANMKRGSITTKL 510

Query: 550 VTTYSQGSSLESDKLNMAVEKNKK----------------KIEQYRKHKSE 654
           + TY++ S  E D      ++ K+                K EQ RK K E
Sbjct: 511 IATYAKLS--EDDDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEE 559

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
            complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 32.7 bits (73), Expect = 0.92
 Identities = 48/200 (24%), Positives = 83/200 (41%), Gaps = 4/200 (2%)
 Frame = +1

Query: 43   EDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSH 222
            +D+ +F      K       KD    E+ +  ND+I  K + +  EN+D    H     +
Sbjct: 819  DDVPNFKIWTLIKDSLLWDLKDITGIEEAINSNDSIEIKDKFQYFENLD----HERALKN 874

Query: 223  HSSSTLKRPSSNSIEKMITHN--ALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHN 396
             SS T      + IE  +T N  AL   S   D+   EG   +K+ + ++   +   A N
Sbjct: 875  SSSQTQFSDIPSEIESFVTENPEALTSASLELDNDIEEGTKESKRPISNLQQQL--KAEN 932

Query: 397  GAFPEEYRLETETGLVKLKTLETLK-REDSRVS-SAKKEHTNDHADAHSTRSKVTTYSQG 570
             A      ++T + +    T +    R++S+V+    K  TND+ +  +   KV T    
Sbjct: 933  TAV-----MDTPSDVFVTATTDGGHFRDNSKVTRDENKIETNDNTNLLNI-GKVNT-ENA 985

Query: 571  SSLESDKLNMAVEKNKKKIE 630
              ++S+ +   V    K IE
Sbjct: 986  IKIDSESVIEDVAPGSKSIE 1005

>Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] {ON}
            YLR278C (REAL)
          Length = 1342

 Score = 32.7 bits (73), Expect = 0.92
 Identities = 37/154 (24%), Positives = 62/154 (40%), Gaps = 3/154 (1%)
 Frame = +1

Query: 169  ENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNK 348
            + +ENI ++   S   +H ++ST     SNS  K ++HN   G       +        K
Sbjct: 761  DGKENITDEAISSTTTAHSTASTAVSKQSNSKNKKVSHNG--GMPPAVARI------FGK 812

Query: 349  KALPDITAPVTNSAHNGAFPEEYRLE---TETGLVKLKTLETLKREDSRVSSAKKEHTND 519
                +    V NS  + A  E+++ +    E   V       L + D R       H ++
Sbjct: 813  GQAEEHAGFVENSQVDLAEQEKFKKKQGVLEKTSVPRSLAHLLTKMDDRT------HVSN 866

Query: 520  HADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKK 621
             + AH+T S  ++ S  SS  S     + E+N K
Sbjct: 867  SSMAHTTSSSSSSSSSSSSSSSLSFPSSQERNLK 900

>NCAS0D04730 Chr4 complement(904979..909307) [4329 bp, 1442 aa] {ON}
           Anc_6.367 YCR089W
          Length = 1442

 Score = 32.7 bits (73), Expect = 0.93
 Identities = 30/115 (26%), Positives = 47/115 (40%), Gaps = 7/115 (6%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDISSFSSIDSYK---PEPFTGFKDSQAPEQPLLKNDTIVGKAQSEN 174
           P  + S T  NE+E  SS ++  S+    P      ++S A    +L + ++V      +
Sbjct: 45  PALTFSSTLKNEFEKTSSSAAEYSFSTIIPSTSAALEESLAYSDLVLSSTSVVNNIAISS 104

Query: 175 EENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEG----NSETADSLKR 327
                     S   S  SS+T+K  SSN+  +  T   L      NS+ A S  R
Sbjct: 105 TVETSTSFFKSSTTSALSSTTIKNVSSNNFSRFETVGILSASSIENSDVATSSTR 159

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 32.7 bits (73), Expect = 0.94
 Identities = 40/198 (20%), Positives = 78/198 (39%), Gaps = 21/198 (10%)
 Frame = +1

Query: 157  KAQSENEENIDEQHRHSD---VYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKR 327
            +  ++ + +ID+    S+   + S H   T+K PS+    KM    + E   E  ++L+R
Sbjct: 1105 RTNTDQKMSIDKNESDSEKDNIGSDHDEHTIKTPSTTLTRKMTLRPSPE---EVYENLER 1161

Query: 328  --EGLNLNKKALPDITAPVTNSAHNGAFPEEYR-------------LETETGLVKLKTLE 462
                 NL+K  +  I +P +  +     PE+               L+ +    + KT+ 
Sbjct: 1162 FFPRANLDKPIVEGIMSPTSPKSTANMIPEKLTCPSDEDIFVPTVPLKRQKAPKRTKTIR 1221

Query: 463  TLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRK 642
            T+  E S    +  +    +     TR    T         +K  +++ K+K    +Y++
Sbjct: 1222 TIAHEASEARKSSLKLKRKNTKMWGTRMVEVT---------EKHMVSINKSKNSRGEYKE 1272

Query: 643  HKSEKGI---KGFFHRIF 687
                KG    KG F  ++
Sbjct: 1273 FAWMKGEMIGKGSFGAVY 1290

>Kpol_505.31 s505 (77169..78152) [984 bp, 327 aa] {ON}
           (77169..78152) [984 nt, 328 aa]
          Length = 327

 Score = 32.3 bits (72), Expect = 0.95
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 2/148 (1%)
 Frame = +1

Query: 226 SSSTLKRPSS--NSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNG 399
           +SST K   S    IE +   N    N+ T DS K+ G   +KK   D+ +    S  NG
Sbjct: 14  NSSTTKNSKSLIGRIEPVTRSNR---NATTVDSKKKSGNAKSKKTSKDLNSI---SVING 67

Query: 400 AFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSL 579
                     + G++  KT + L  +++R    KK ++ D                GS  
Sbjct: 68  KLVSS----DDIGILLRKTAKELSAKENR--EKKKSNSKD---------------SGSKK 106

Query: 580 ESDKLNMAVEKNKKKIEQYRKHKSEKGI 663
           +      ++ +   KIEQ ++HK   G+
Sbjct: 107 KGSLFGDSLTERTIKIEQAQRHKQNSGV 134

>TDEL0D02300 Chr4 complement(444459..450704) [6246 bp, 2081 aa] {ON}
            Anc_1.360 YFR019W
          Length = 2081

 Score = 32.7 bits (73), Expect = 0.95
 Identities = 44/205 (21%), Positives = 70/205 (34%), Gaps = 3/205 (1%)
 Frame = +1

Query: 46   DISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDV-YSH 222
            DI+  +S    K     G  D +  E+ L + D    +  S + + IDE  +H D     
Sbjct: 1339 DITRITSHQLKKLFTDFGSSDERTEEEGLDRVDDEEKEEDSTHAKEIDENSQHVDAEIPF 1398

Query: 223  HSSSTLKRPSSNSIEKMITHNALEGNSETAD--SLKREGLNLNKKALPDITAPVTNSAHN 396
            +SS   +  S N IE  +    L  N +T    +L    L  +       ++    S  N
Sbjct: 1399 YSSQNEQESSQNEIENNLNDVGLSENQKTRSNTALANSQLTADHPLGNRTSSSFNKSFDN 1458

Query: 397  GAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSS 576
            G   +  +      L    ++    R  ++V          H DA S             
Sbjct: 1459 GLVSDLQKSRGSESLSSSSSIAKEHRVSNKVGQLANFFDQMHFDALS-----------KE 1507

Query: 577  LESDKLNMAVEKNKKKIEQYRKHKS 651
             E  +    V+ NK K +  R H S
Sbjct: 1508 FELQREKERVQLNKNKYQALRIHTS 1532

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 32.3 bits (72), Expect = 1.0
 Identities = 34/151 (22%), Positives = 63/151 (41%), Gaps = 4/151 (2%)
 Frame = +1

Query: 151 VGKAQSENEENID----EQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADS 318
           +GK  S+ E   D    +Q + +   S  SSS+    SS+S E   + +  + +S+  + 
Sbjct: 1   MGKVTSKKESKKDMKSKKQEKATSSSSSSSSSSSSSSSSSSDESSSSSSDSDSSSDEEEE 60

Query: 319 LKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSA 498
            K E    +KK     +   ++S  + +  EE   + E+        E  K+E+S  SS 
Sbjct: 61  KKEEKKEESKKEESSSSDSDSDSNSSSSDEEEESKKQES---SSDEEEESKKEESSSSSD 117

Query: 499 KKEHTNDHADAHSTRSKVTTYSQGSSLESDK 591
             +  +D  +  S + K     +    +S K
Sbjct: 118 SSDSESDDEEKDSKKRKHEESEESEESDSKK 148

>Kpol_1059.36 s1059 (78595..80112) [1518 bp, 505 aa] {ON}
           (78595..80112) [1518 nt, 506 aa]
          Length = 505

 Score = 32.3 bits (72), Expect = 1.1
 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 2/131 (1%)
 Frame = +1

Query: 163 QSENEENIDEQHRHSD-VYSHHSSSTLKRPSSNSIEKMITHNALEGN-SETADSLKREGL 336
           ++ N +N   Q + S  VY+ + +S+ K P+S+  ++ +  + +E + S++ ++    G 
Sbjct: 113 ETSNRDNSHSQRQTSPPVYTDNKNSSRKYPTSSEEKERLRQSYMESSDSQSRNNNNNSGR 172

Query: 337 NLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTN 516
           +  ++   +   P       G     Y  E  T            R  S       EH +
Sbjct: 173 DGERERRGNAPPPAYEDVAAGKSRSSYPKEKHT-----------HRSSSSGEKEGGEHRH 221

Query: 517 DHADAHSTRSK 549
            H+  HS++SK
Sbjct: 222 HHSSRHSSKSK 232

>Smik_2.413 Chr2 complement(728446..730083) [1638 bp, 545 aa] {ON}
           YBR270C (REAL)
          Length = 545

 Score = 32.3 bits (72), Expect = 1.1
 Identities = 38/166 (22%), Positives = 68/166 (40%)
 Frame = +1

Query: 154 GKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREG 333
           G     + ++I+E++      +++S S    PSSN ++         G + + DSL    
Sbjct: 79  GSNSRRSTDSIEEEYSQG-TDNNNSHSERGSPSSNRVD---------GTNTSNDSLFSST 128

Query: 334 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT 513
              NK+ L    +  TNS  N            + ++   +  ++ R     S +K  HT
Sbjct: 129 SRGNKRRL----SMFTNSKENMRNRSRSGSRNPSVVINGASSSSVSR-----SGSKLFHT 179

Query: 514 NDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKS 651
             +  A+S +S ++T        S+K N    K  KK+  Y+ H S
Sbjct: 180 KSNKSANSLQSSMST----GHAHSNKGNNVFSKMAKKLLPYKSHNS 221

>NDAI0K02410 Chr11 complement(541731..542468) [738 bp, 245 aa] {ON}
           Anc_6.375 YNR049C
          Length = 245

 Score = 32.0 bits (71), Expect = 1.1
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 8/72 (11%)
 Frame = +1

Query: 79  KPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSD--VYSHHSS------S 234
           K EPF GF      ++ L     I+ K Q +   N   QH HS   V S  SS      S
Sbjct: 54  KQEPFQGFPGWLGHKEDLPDEQKILKKQQEKQAHNHHHQHHHSTPVVSSTVSSGGGGFVS 113

Query: 235 TLKRPSSNSIEK 270
           +L+R  S+S+++
Sbjct: 114 SLRRTGSSSLQQ 125

>TPHA0F00970 Chr6 complement(219516..222506) [2991 bp, 996 aa] {ON}
           Anc_4.165 YLR336C
          Length = 996

 Score = 32.3 bits (72), Expect = 1.2
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 5/146 (3%)
 Frame = +1

Query: 58  FSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSST 237
           FSS D      F  F DS   ++ L +   +   + SE+EEN +++      YS+ S + 
Sbjct: 112 FSSDDELSSGDFDDFADSDLNKEELEQLRELEEGSGSESEENSEDELLSESEYSNSSDND 171

Query: 238 LKRPSSNSIEKMITHNAL-EGNSETADSLKREGLNLNKKAL---PDITAPVTNSAHNGAF 405
            K  S  + E M    +L +  SE++D+  ++ +   K+ +    DI  P+  +      
Sbjct: 172 DKEIS--AAETMAKLKSLQQKKSESSDNKDKKAIKHRKRKIEEEEDIEFPMLPAERAALE 229

Query: 406 PEEYRLETETGLVKLK-TLETLKRED 480
            +E  ++     + LK  ++ +K +D
Sbjct: 230 KDEMEMQYYAKKLNLKGKVKKIKAKD 255

>SAKL0B09064g Chr2 (771705..774779) [3075 bp, 1024 aa] {ON} similar
           to uniprot|Q06839 Saccharomyces cerevisiae YPR097W
           mitochondrial protein
          Length = 1024

 Score = 32.3 bits (72), Expect = 1.2
 Identities = 37/156 (23%), Positives = 59/156 (37%), Gaps = 8/156 (5%)
 Frame = +1

Query: 49  ISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHS 228
           ISSFSS  S    P T   ++         N     +  SE +E  +E+  + D Y   +
Sbjct: 354 ISSFSSTSS---TPTTSLAETDGRSTGSQANVMSANEKGSEMQEEEEEEEENEDYYEEFA 410

Query: 229 SSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKK--------ALPDITAPVTN 384
            +   + S+   EKM T  +L     T    K    +++ K        +L D    V  
Sbjct: 411 DANDTKSSNLPREKMRT--SLRQYLRTLCQEKEVAFSMSLKKFFIKSVISLEDFPGKVQQ 468

Query: 385 SAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVS 492
              N    +   LE + G  KL    +L+ ++S  S
Sbjct: 469 DIKNRELMDVTNLENQIGFQKLAFERSLELQESMKS 504

>KLTH0A06578g Chr1 complement(547101..550316) [3216 bp, 1071 aa]
           {ON} similar to uniprot|P11655 Saccharomyces cerevisiae
           YNR026C SEC12 Guanine nucleotide exchange factor (GEF)
           glycosylated integral membrane protein of the
           endoplasmic reticulum important for the initiation of
           transport vesicle budding from the endoplasmic reticulum
           through activation of the GTPase Sar1p
          Length = 1071

 Score = 32.3 bits (72), Expect = 1.2
 Identities = 42/201 (20%), Positives = 73/201 (36%), Gaps = 1/201 (0%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEEN 183
           P  S SV T      +   S+       P++    S  PE PLL +D    +       +
Sbjct: 423 PTESSSVNTPIYETTVPELSTTS-----PYSSSWSSPVPEDPLLTSDASTVEEPEYFPSS 477

Query: 184 IDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPD 363
           ++E      + + + S+  +  SS ++   +T  ++ G  E+A S   E         P 
Sbjct: 478 LEE------ISAENESANSEASSSMTVSASMT-ASISGVQESAVSASEE--------KPT 522

Query: 364 ITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTR 543
                ++S       +   + TE GL K K  +     D  +       +   +D HS  
Sbjct: 523 QATQKSSSESEALLSDSNDISTENGLNKSKAQQQFYEVDKTLEQQPTPTSVQSSDVHSGI 582

Query: 544 SKVTTYSQGSSLE-SDKLNMA 603
           S     S+G     S K++ A
Sbjct: 583 SLTAGNSKGEEASPSHKISSA 603

>NCAS0B08490 Chr2 (1627460..1631344) [3885 bp, 1294 aa] {ON}
           Anc_1.141 YCR033W
          Length = 1294

 Score = 32.3 bits (72), Expect = 1.2
 Identities = 37/175 (21%), Positives = 69/175 (39%)
 Frame = +1

Query: 133 LKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETA 312
           +K ++ + +   +N  NI   +  S+ +  H +ST    S+ +I           +S T 
Sbjct: 214 IKENSTISQNSIQNPNNIPNYYSRSNTWKSHGASTKPDMSNYNI-----------SSSTT 262

Query: 313 DSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVS 492
            + +   L  +K++L + T+    + H G   +  R  +     K          D +  
Sbjct: 263 STSQPTILKNHKRSLIESTSTEVETNHIGNNEDRNRRVSNEHFNK----------DQQSY 312

Query: 493 SAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEK 657
            A KE    HA  +S+ +    +S GSSL +       E   K    ++K K+ K
Sbjct: 313 KAHKETHKHHASFNSSSNP---HSLGSSLFNSVPRTTRETEHKAASDFKKVKTLK 364

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] {ON}
            YLR310C (REAL)
          Length = 1587

 Score = 32.3 bits (72), Expect = 1.2
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 4/106 (3%)
 Frame = +1

Query: 217  SHHSSSTLKRPSSNSIEKMITHNALEGNSET---ADSLKREGLNLNKKALPDITAPVTNS 387
            S   +S++ R S    + + + +   GNSET   ADS       +   A   + AP    
Sbjct: 738  SSSKNSSITRISPKMADAIASASGYSGNSETNSQADS------KVGTAAYSSVIAPFNRP 791

Query: 388  AHNGAFPEEYRLETETGL-VKLKTLETLKREDSRVSSAKKEHTNDH 522
            +HN  F      + +    + + TL T+K++ S++       T DH
Sbjct: 792  SHNRTFSRARVSKRKKKYPLTVDTLNTMKKKSSQIFEKLNNATGDH 837

>Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa] {ON}
            YLR106C (REAL)
          Length = 4909

 Score = 32.3 bits (72), Expect = 1.3
 Identities = 38/175 (21%), Positives = 65/175 (37%), Gaps = 8/175 (4%)
 Frame = +1

Query: 31   DNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDT--------IVGKAQSENEENI 186
            +NE ++I   +  +    EP +   D  A E+  + ND         +    + ENEEN+
Sbjct: 4290 ENENKEIEQEADNEDNDDEPGS---DINAEEEETVSNDEKDAEMDVDMADGEERENEENV 4346

Query: 187  DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
             E    SD         LK+  S      +  N  +G  + A+ L       + + +   
Sbjct: 4347 PEDQNMSD------EEDLKQDDS------MEENKEKGGEQNAEGLDGIEEKADVEEIDQE 4394

Query: 367  TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADA 531
             A   +S   GA  +    + +  +    T E    ED   S+ K E + + A A
Sbjct: 4395 AAVQQDSGSKGAGADAKDTQEQEDVGGSGTTENTYEEDQEDSTKKNEESREEATA 4449

>Suva_2.675 Chr2 complement(1197698..1198864) [1167 bp, 388 aa] {ON}
           YDR498C (REAL)
          Length = 388

 Score = 32.0 bits (71), Expect = 1.3
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 12/91 (13%)
 Frame = +1

Query: 112 QAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIE-------- 267
           Q  ++ L  ND    +A   +  + ++ H+ SD    H +S+L  P+S S+E        
Sbjct: 151 QHHKRDLAWNDEERDRAIRSHAADYEKMHQGSD----HGASSLTTPASTSMENASTKDKL 206

Query: 268 ----KMITHNALEGNSETADSLKREGLNLNK 348
               K++T+N + GN      + +  LNL++
Sbjct: 207 LSKTKLLTNNLVRGNQILQSGILQSDLNLDE 237

>YBR270C Chr2 complement(742761..744398) [1638 bp, 545 aa] {ON}
           BIT2Subunit of TORC2, a membrane-associated complex that
           regulates actin cytoskeletal dynamics during polarized
           growth and cell wall integrity; interacts with Slm1p and
           Slm2p, homologous PH domain-containing TORC2 substrates;
           similar to Bit61p
          Length = 545

 Score = 32.0 bits (71), Expect = 1.5
 Identities = 44/182 (24%), Positives = 73/182 (40%), Gaps = 1/182 (0%)
 Frame = +1

Query: 109 SQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNA 288
           SQ   Q +  + +   ++    EE   +   ++D +S   SS+               N 
Sbjct: 68  SQVGFQSIFHDGSNARRSTDSIEEEYSQGTENNDGHSEIGSSS--------------SNR 113

Query: 289 LEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLET- 465
           +EGN+ + DSL       NK+ L    +  TNS  N       R  + +G     T+ T 
Sbjct: 114 MEGNTTSNDSLFSSNSRGNKRRL----SIFTNSKDN------MRNRSRSGSKNYGTVITG 163

Query: 466 LKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKH 645
               +   S +K  HT  +   +S +S ++T   G S  S+K +    K  KK+  Y+ H
Sbjct: 164 TSSNNISRSGSKLFHTKSNMSVNSLQSSLST---GHS-HSNKGSNVFSKMAKKLLPYKPH 219

Query: 646 KS 651
            S
Sbjct: 220 NS 221

>NCAS0C00790 Chr3 (137927..139954) [2028 bp, 675 aa] {ON} Anc_8.779
           YMR239C
          Length = 675

 Score = 32.0 bits (71), Expect = 1.5
 Identities = 35/169 (20%), Positives = 65/169 (38%)
 Frame = +1

Query: 175 EENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKA 354
           +  ++++ +     S  S    +   S+S  K    N      ET    K++  +  K+ 
Sbjct: 43  DSTVEKKRKKKSKKSKVSKEEHEPDKSDSASKKKKINGHRAEHETDHISKKKKKSKKKED 102

Query: 355 LPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAH 534
             ++   + N        EE++   E+GL++  T+   K ++   +S+K           
Sbjct: 103 SANLKGEL-NHILKTEKNEEHKKNKESGLIQKGTVNENKVKEELTNSSK----------- 150

Query: 535 STRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHR 681
               KVTT    S  E D ++   + NK K     K K E    GF ++
Sbjct: 151 ----KVTTKEDKSENELDHVSKKKKTNKNKQALASKEKGEPSKPGFSYK 195

>KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some
           similarities with uniprot|Q06704 Saccharomyces
           cerevisiae YLR309C IMH1 Protein involved in vesicular
           transport mediates transport between an endosomal
           compartment and the Golgi contains a Golgi-localization
           (GRIP) domain that interacts with activated Arl1p-GTP to
           localize Imh1p to the Golgi
          Length = 768

 Score = 32.0 bits (71), Expect = 1.5
 Identities = 46/222 (20%), Positives = 87/222 (39%), Gaps = 10/222 (4%)
 Frame = +1

Query: 19  SVTTDNEYEDISSFSSIDSYKPEPFTGFKDS--QAPEQPLLKNDTIVGKAQSENEENIDE 192
           + + +N  +++ S     S K +    FK+   +    P   + +    AQ E  EN   
Sbjct: 149 TTSVENLEKEVVSLKQEISTKDQLIDSFKNKIEELTSTPSSVDSSSATSAQ-ETTENTAS 207

Query: 193 QHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPD-IT 369
                       +   K+  +N+   +  +NA  G +ETA +      N   K + + IT
Sbjct: 208 STAQPTASGKKKNQKKKKGKANNNNNLQNNNANAGAAETAAAAPATEPNQKAKDITEAIT 267

Query: 370 APV---TNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 540
             V   T  A      +EY L T T     K  ET+K +D  + S +    +   D  + 
Sbjct: 268 LRVKLDTLQADYDKLNKEYELLTSTKADLAKLKETIKIKDEELESVRDMLKDVGNDLVAA 327

Query: 541 RSKVTTYSQGSSLESDKLNMAVE----KNKKKIEQYRKHKSE 654
           + ++ + +  S+ E + L + +E     N   ++ Y   ++E
Sbjct: 328 QDQLKSKNDASA-EVNNLKLQLESLRSNNADNLKSYELKQNE 368

>KLLA0F23199g Chr6 complement(2159245..2162067) [2823 bp, 940 aa] {ON}
            some similarities with uniprot|P43596 Saccharomyces
            cerevisiae YFR013W IOC3 Member of a complex (Isw1a) with
            Isw1p that has nucleosome-stimulated ATPase activity and
            represses transcription initiation by specific
            positioning of a promoter proximal dinucleosome has
            homology to Esc8p which is involved in silencing
          Length = 940

 Score = 32.0 bits (71), Expect = 1.6
 Identities = 21/111 (18%), Positives = 46/111 (41%)
 Frame = +1

Query: 37   EYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVY 216
            EY DIS+     + +    T    ++AP++P   ++ +V   + E ++  +E     +++
Sbjct: 825  EYGDISTTDR--NLRRSQRTKINYTEAPQEPSDDDEEVVANVEEEEDQPEEEMDEEPEIF 882

Query: 217  SHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDIT 369
            S H          +  ++ I       + +  D  K+ G  L K +   +T
Sbjct: 883  SEHEDHRNDYEDHSDNDEEIEEEYQLDSEDNEDVPKKRGRPLKKNSKNAVT 933

>Suva_13.47 Chr13 (70528..73452) [2925 bp, 974 aa] {ON} YMR261C
           (REAL)
          Length = 974

 Score = 32.0 bits (71), Expect = 1.6
 Identities = 26/113 (23%), Positives = 52/113 (46%)
 Frame = +1

Query: 226 SSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAF 405
           +SS+    +  SI+++  H A    +     L ++  NL    L DI++   +S HN + 
Sbjct: 102 ASSSTASAAPPSIKRISPHAAAXXAAAARPILAKQPSNLKYSELADISSSEASSQHNESD 161

Query: 406 PEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYS 564
           PE+     + G    + +  L+ +D     AK+++       +S +S++  YS
Sbjct: 162 PEDLSGAPDDG----EYVSDLEMDD-----AKQDYKVPKFGGYSNKSQLKKYS 205

>Suva_13.46 Chr13 (70171..70287,70291..73452) [3279 bp, 1092 aa]
           {ON} YML100W (REAL)
          Length = 1092

 Score = 32.0 bits (71), Expect = 1.6
 Identities = 26/113 (23%), Positives = 52/113 (46%)
 Frame = +1

Query: 226 SSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAF 405
           +SS+    +  SI+++  H A    +     L ++  NL    L DI++   +S HN + 
Sbjct: 220 ASSSTASAAPPSIKRISPHAAAXXAAAARPILAKQPSNLKYSELADISSSEASSQHNESD 279

Query: 406 PEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYS 564
           PE+     + G    + +  L+ +D     AK+++       +S +S++  YS
Sbjct: 280 PEDLSGAPDDG----EYVSDLEMDD-----AKQDYKVPKFGGYSNKSQLKKYS 323

>TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {ON}
            Anc_5.368 YHR079C
          Length = 1375

 Score = 32.0 bits (71), Expect = 1.6
 Identities = 36/155 (23%), Positives = 65/155 (41%), Gaps = 1/155 (0%)
 Frame = +1

Query: 190  EQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDIT 369
            E +R    Y    S  ++R S    +K+ T N  E ++ET  ++  +  N N  A P   
Sbjct: 703  EFYRRDSFYVKRFSQNIRRLSF--FDKIGTENKRE-SAETL-TINNKLKNSNSSASPGGK 758

Query: 370  APVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSK 549
             P T +  N    + + +ET+    ++ T       D      +    ND A    + ++
Sbjct: 759  EPTTINFKNN---DIFSVETQPMDRQISTFSVASNIDPIQEFGQDTSNNDIAYNDDSLTR 815

Query: 550  VTTYSQGSSLESDKLNMAV-EKNKKKIEQYRKHKS 651
            +   +  +S++SD   +   EK KKK  +  K K+
Sbjct: 816  IGNTTMDTSVDSDAFTLVTNEKKKKKKNKKNKKKA 850

>Kwal_26.9080 s26 (1067363..1071649) [4287 bp, 1428 aa] {ON} YMR219W
            (ESC1) - involved in silencing [contig 69] FULL
          Length = 1428

 Score = 32.0 bits (71), Expect = 1.6
 Identities = 48/198 (24%), Positives = 77/198 (38%), Gaps = 30/198 (15%)
 Frame = +1

Query: 25   TTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRH 204
            T DN Y + +S S I  + P+P        AP  P   ++T +    + NE N+      
Sbjct: 499  TQDNSYPEGTSDSEISGHDPKP--------APTSP-AASETKILSVSNTNETNV------ 543

Query: 205  SDVYSHHSSSTLKRPSSNSIEKM--------------ITHNALEGNSETAD--------- 315
                   S  +LKRPS ++ EK                T ++LE +++T           
Sbjct: 544  -----FASQESLKRPSLDNPEKPSIENENLKIPSGEDYTDHSLELDNDTKGDATFITGDT 598

Query: 316  ---SLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLK----R 474
               S++ E    + + LP  TA   N  H+    E+  L T         L +LK     
Sbjct: 599  TYFSIENESYLEDVEVLP--TAEHGNEVHDDRESEKRELSTGKPTEPSTDLPSLKYHLIY 656

Query: 475  EDSRVSSAKKEHTNDHAD 528
             DS  SS+++    D++D
Sbjct: 657  SDSYYSSSEEAEAVDNSD 674

>NDAI0G03520 Chr7 complement(844269..848915) [4647 bp, 1548 aa] {ON}
            Anc_8.126
          Length = 1548

 Score = 32.0 bits (71), Expect = 1.6
 Identities = 37/179 (20%), Positives = 73/179 (40%), Gaps = 2/179 (1%)
 Frame = +1

Query: 127  PLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMIT--HNALEGN 300
            P L+   ++G     NEE + E+  H D       + +KR + N+ +K+      ++  N
Sbjct: 799  PYLRESKLIGLM---NEETVYERKEHIDADKKRHHTRIKRSADNADKKLFNSLKKSMLRN 855

Query: 301  SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
                 ++  + +    K LP +    T    NGAF + Y  + +   ++L  +E++  +D
Sbjct: 856  YSKQKAVILDDIRAIVKVLPVVGLTRT---ENGAFVKNYASQPDYYPLQL-MVESISNKD 911

Query: 481  SRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEK 657
             R          +     S    +  Y+ G  +  D  N     N+K+++   K +S K
Sbjct: 912  ERYIEKPPLPIKEEFPEGSHAIFLGDYAYGGEVIIDGYN-----NEKRLKITVKKRSVK 965

>Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {ON}
            YER172C (REAL)
          Length = 2161

 Score = 32.0 bits (71), Expect = 1.7
 Identities = 35/142 (24%), Positives = 60/142 (42%), Gaps = 14/142 (9%)
 Frame = +1

Query: 16   VSVTTDNEYEDISSFSSI---------DSYKPEP----FTGFKDSQAPEQPLLKNDTIVG 156
            +S T  N YED+  F  +          S++P P    F G K+  + ++    ND    
Sbjct: 670  LSATLPN-YEDVGRFLRVPKEGLFYFDSSFRPCPLSQQFCGIKERNSLKKLKAMNDACYE 728

Query: 157  KA-QSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREG 333
            K  +S NE N      HS   +  +++ L+   +  IE+ I H  ++ +S +   LK E 
Sbjct: 729  KVLESINEGNQIIVFVHSRKETSRTATWLR---NKFIEENIAHKLIKSDSGSKQILKTEA 785

Query: 334  LNLNKKALPDITAPVTNSAHNG 399
             N+   +L  +      + H G
Sbjct: 786  ANILDPSLKKLIESGIGTHHAG 807

>TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277
          Length = 345

 Score = 31.6 bits (70), Expect = 1.7
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 11/94 (11%)
 Frame = +1

Query: 37  EYEDISSFSSIDSYKPEPF-----TGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHR 201
           + E I     +D + P        TG    Q P  PLL++       QSE+ ++   Q R
Sbjct: 60  DLEHIKKILVLDEFAPNNLFTLLNTGADQLQVPTTPLLEHHRPPNTPQSESSQS---QQR 116

Query: 202 HS-DVYSHH-----SSSTLKRPSSNSIEKMITHN 285
           HS   +SHH     S+  L++PS    E  ++ N
Sbjct: 117 HSIKRFSHHFHHQLSAPPLRQPSHTMSELPMSFN 150

>NDAI0C01860 Chr3 complement(411874..412503) [630 bp, 209 aa] {ON}
           Anc_5.373 YHR081W
          Length = 209

 Score = 31.2 bits (69), Expect = 1.8
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 3/92 (3%)
 Frame = +1

Query: 382 NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSA---KKEHTNDHADAHSTRSKV 552
           NS  N    +    E E    K   + +L R DS +S+    K +HT  +     T +  
Sbjct: 94  NSLKNKLMEKNNSNEREKSNAKNLIISSLNRNDSAISNQNFQKGKHTKFNEQQSVTTTTN 153

Query: 553 TTYSQGSSLESDKLNMAVEKNKKKIEQYRKHK 648
            T    +S++ + +   + +NKKK +   K+K
Sbjct: 154 MTSVDNNSIDREAIMNNIVENKKKNKNKNKNK 185

>TBLA0C04990 Chr3 (1214716..1216179) [1464 bp, 487 aa] {ON}
           Anc_3.533 YER035W
          Length = 487

 Score = 31.6 bits (70), Expect = 1.9
 Identities = 37/179 (20%), Positives = 69/179 (38%), Gaps = 15/179 (8%)
 Frame = +1

Query: 94  TGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIE-- 267
           T F +S    Q   KN T      ++ +  +D++ +      + + S +K+  SN  +  
Sbjct: 5   TMFFNSSRLIQSSSKNSTSNLSKLNKKQMKLDKKSKAKAEQEYTTESPIKQTQSNDTQQI 64

Query: 268 ---------KMITHNALEGNSETADS--LKREGLNLNKKALPDITAPVTNSAHNGAFPEE 414
                    K  + N  E   E   +  L    L  N++ LP+   P    +     P  
Sbjct: 65  EKDKQKQKKKFASKNKKETKKEKKPNKQLNPNFLLTNEQTLPNGEKPNFGHSSTNTSPTT 124

Query: 415 YRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTR--SKVTTYSQGSSLES 585
            R    +         + KRE+S   S+K +H + H  A++ +   K+    Q +SL++
Sbjct: 125 MRHNNRSNCGNTNDKYSSKRENSNSKSSKTKHKSKHNTANNGKHSKKLMAKEQIASLDT 183

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 31.6 bits (70), Expect = 1.9
 Identities = 32/154 (20%), Positives = 61/154 (39%), Gaps = 15/154 (9%)
 Frame = +1

Query: 205 SDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTN 384
           ++ ++  +S TLKR      E     N  +       SLK++    NKK +      + N
Sbjct: 343 NETFTQTNSETLKRLQVTEFESENIKNEFDKTKSELTSLKKKLSKANKKIVSK-EVDLKN 401

Query: 385 SAHNGAFPEEYRLET--ETGLVKLK-------------TLETLKREDSRVSSAKKEHTND 519
              +    ++  +E   E G++K+K              +  LKRE++ +S   +   + 
Sbjct: 402 LRQDNELTQDKLIEVNQELGVLKMKYCQLSKDIEEKIGEISYLKRENAGLSRIIENLQDR 461

Query: 520 HADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKK 621
           +  +        T  +   LE+ K+N  V K+ K
Sbjct: 462 YTKSERQNKLQRTKYEELYLENQKVNEVVSKSNK 495

>Smik_7.309 Chr7 (520619..522262) [1644 bp, 547 aa] {ON} YGR023W
           (REAL)
          Length = 547

 Score = 31.6 bits (70), Expect = 1.9
 Identities = 28/151 (18%), Positives = 62/151 (41%)
 Frame = +1

Query: 7   VPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENI 186
           V S+S ++ + +   +S S+  SY P P        +P      + + +    S +  + 
Sbjct: 183 VSSISTSSISVHSTSTSTSTSSSYLPSP--------SPSTSTSSSSSYLPSPSSSSSSSS 234

Query: 187 DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
                 S   S  SSS+   PSS+S     + ++   +++++ S     ++ +      I
Sbjct: 235 SSSSSSSSSSSSSSSSSSSSPSSSSSSYSTSSSSSFSSAQSSSSYPSSSISSSSDPTLSI 294

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTL 459
           T+   +S    A       +T T +++ +T+
Sbjct: 295 TSTSASSFVTSASQNSNLKKTITSIIEGQTI 325

>TDEL0A06110 Chr1 (1069675..1070355,1070357..1071382) [1707 bp, 568
           aa] {ON} Anc_8.665 YOR239W Ribosomal frameshifting
          Length = 568

 Score = 31.6 bits (70), Expect = 2.0
 Identities = 44/194 (22%), Positives = 72/194 (37%)
 Frame = +1

Query: 43  EDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSH 222
           ED  +   + + KP      K+     +   K     G A  + +E  +E      V + 
Sbjct: 16  EDEKAVVPVSAGKPNSVKDEKNEAGSFEEAYKPQESSGPAAQDVQETTEEPIAEVSVPAE 75

Query: 223 HSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGA 402
           H  S +K   S+  EK  T    E +SE  ++ +    N  + +  +  A     A   A
Sbjct: 76  HDKSEIKVEKSD--EKSDT-KVEETSSEVKEAKELSARNEEETSNEEAEAEANEEAEAEA 132

Query: 403 FPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLE 582
             E    E E      +  E    E++  + A ++  ++  +A  T    T   QGSS  
Sbjct: 133 NEEA---EAEAN----EEAEAEANEEAE-AEANEDSESETKEAQETPEASTENVQGSSES 184

Query: 583 SDKLNMAVEKNKKK 624
           S K     +K KKK
Sbjct: 185 SKKKKKKNKKKKKK 198

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 31.6 bits (70), Expect = 2.0
 Identities = 42/204 (20%), Positives = 76/204 (37%), Gaps = 3/204 (1%)
 Frame = +1

Query: 61  SSIDSYKPEPFTGFKDSQAPEQP---LLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSS 231
           S IDS   + F   KDS + +     ++ N          N+ENI +    S  ++  +S
Sbjct: 195 SHIDSPSLKDFPSSKDSPSSKDSPSKMISNSNKNINTNLTNQENIPDTLTGSSRHNTSTS 254

Query: 232 STLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPE 411
           +   +   NS  ++        N+ T + L    +N++    P+IT   TN+ +N +   
Sbjct: 255 NITFQSKQNSSTQL-------RNTTTKNKLANSNVNISTMT-PNITGN-TNTPNNTSLIS 305

Query: 412 EYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDK 591
              +++ T   K          DS  + A    +       ST    T  S  ++ ++ +
Sbjct: 306 TTTIKSSTSTPKTSGSNLNATNDSSNNIADSNRSTTAPTTTSTTENATGSSTLNASDNIE 365

Query: 592 LNMAVEKNKKKIEQYRKHKSEKGI 663
           L   V    +         SE GI
Sbjct: 366 LTTMVHDGSESESTSDSSSSESGI 389

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score = 31.6 bits (70), Expect = 2.1
 Identities = 50/233 (21%), Positives = 89/233 (38%), Gaps = 16/233 (6%)
 Frame = +1

Query: 13  SVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAP--EQPLLKNDTIVGKAQSENEENI 186
           S ++TT      I+   S ++   E   G K S++   E+   KND  V +A S N+E  
Sbjct: 200 STTMTTSTSTTSINEHGSDEATSIEEKQGDKASESTSIEESTSKNDNNVREAASLNDE-- 257

Query: 187 DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
                      + + S++ + +++S +  +   A     +T                   
Sbjct: 258 ----------GNVAESSISKTTADSTQMNVPEPAATSQRDT------------------- 288

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTL--ETLKRED---SRVSSAKKEHTNDHADA 531
           +A V  S+++ + P     ++E+G+ K   +  E LK E     ++SSA K    +  + 
Sbjct: 289 SAQVVTSSNDASEP---HTKSESGISKSDIIPTEELKEETVVAKKISSAVKSTEEEEGEG 345

Query: 532 HSTRSK---------VTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGI 663
             T             T  +  S  E DK+ +   K  K   Q R  K + GI
Sbjct: 346 EETEQSSVEEPGEETSTPGTSESESEEDKVPIDPSKAPKVPFQERPRKGKTGI 398

>CAGL0A02486g Chr1 (266055..268655) [2601 bp, 866 aa] {ON} some
           similarities with uniprot|P42223 Saccharomyces
           cerevisiae YDR351w SBE2 bud growth protein
          Length = 866

 Score = 31.6 bits (70), Expect = 2.1
 Identities = 32/163 (19%), Positives = 65/163 (39%), Gaps = 18/163 (11%)
 Frame = +1

Query: 232 STLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPV----------- 378
           ++ +RPS N + ++  H+  + + E       +    +  A+P    P            
Sbjct: 105 NSARRPSDNLMLQISAHSDGDSDDEAGGDTPSKAAETHANAVPKPVRPTSDNSIRSNDTA 164

Query: 379 ------TNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 540
                 T+S++  A   +Y  + +T +V  K+  T+      +S            +  T
Sbjct: 165 LFSANPTDSSNGSASDSDYDEQHDTSMVSGKSATTMMSPSLALS----------IGSGMT 214

Query: 541 RSKVTTYSQGSSLESDKLNMA-VEKNKKKIEQYRKHKSEKGIK 666
           RS V T ++ S+L+S  L +A   K +       +++S+  IK
Sbjct: 215 RSDVITPNKYSNLDSGSLGIAETPKARYIFSNVNRNRSQSSIK 257

>Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}
           similar to Ashbya gossypii ADL037W
          Length = 914

 Score = 31.6 bits (70), Expect = 2.1
 Identities = 52/227 (22%), Positives = 86/227 (37%), Gaps = 26/227 (11%)
 Frame = +1

Query: 40  YEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYS 219
           YE IS    ++  K      +    A E   L  D ++   + + E+  DE  R  D   
Sbjct: 134 YEAISRDKELEELKQLAVEQYSKVSANEDKDL--DALLETQKLKLEQKYDEIVREKDGEI 191

Query: 220 HHSSSTLKRPSSN--SIEKMITH--NALEG-------NSETADSLKREGLNLNKKALPDI 366
               STL++      ++E ++    NAL G         E  + +++  L+L K  + + 
Sbjct: 192 EELKSTLQKVDQKIETLELLVAEKENALSGLDGQLKDQDEKLNQMEKL-LSLYKDVIKEF 250

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 546
             P +N    G+ P      T TG    +      +    V        N   D    + 
Sbjct: 251 DEPKSNVVSKGSPP------TSTGRSNKRNKNKKNKNKQSVKDIAGGGVNLEHDGVDNKD 304

Query: 547 KV--TTYSQG--SSLES-----------DKLNMAVEKNKKKIEQYRK 642
           K   T+ S+   SS+E+           +KL   +EKNKK  +QYR+
Sbjct: 305 KEPGTSLSEAIFSSIETKVKYENLCGDYEKLKEELEKNKKDGDQYRE 351

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 31.6 bits (70), Expect = 2.1
 Identities = 32/160 (20%), Positives = 58/160 (36%)
 Frame = +1

Query: 112  QAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNAL 291
            +  + PLL N T+   A ++N+                  S L     NS    I     
Sbjct: 841  ETSKSPLLPNPTLQANANTDND----------------FKSPLNIDDDNSTNNNILSYLG 884

Query: 292  EGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLK 471
            +G + +   ++ +    NK+A+P   A   N  +NG    +     +    + K+     
Sbjct: 885  KGQTSSLSEIEHKNNKHNKRAIPKGKAKPKNGYNNGRSTSDLTSLNQPATKRQKSNNNTS 944

Query: 472  REDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDK 591
            R  +  SS +K+   +   + S  S+ T    G S +  K
Sbjct: 945  RMTTLTSSQRKKGERESTISPSPSSQ-TEEQTGQSQQPPK 983

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
            (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score = 31.6 bits (70), Expect = 2.2
 Identities = 29/149 (19%), Positives = 58/149 (38%)
 Frame = +1

Query: 109  SQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNA 288
            S + +Q    +  ++G ++   +++      H   YS H  ST+K  S ++  +     A
Sbjct: 716  SSSQQQSFQTSSNVIGGSRQPGQKS------HLRAYSEHVPSTIKTTSFSNNRQFFPTPA 769

Query: 289  LEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETL 468
             E     +   KR   + ++K   ++ A  TN+ H         +E +   +KL  L   
Sbjct: 770  AEAKLNVSSPPKR---SASQKQPSELPALPTNAEHLLQQQRAKEIENDMNNLKLDQLNVG 826

Query: 469  KREDSRVSSAKKEHTNDHADAHSTRSKVT 555
            K  D+     +     D  D+     ++T
Sbjct: 827  KVRDNNEPDVEDISGEDENDSSKPLPQLT 855

>YFR016C Chr6 complement(177042..180743) [3702 bp, 1233 aa] {ON}
            Putative protein of unknown function; green fluorescent
            protein (GFP)-fusion protein localizes to the cytoplasm
            and bud; interacts with Spa2p; YFL016C is not an
            essential gene
          Length = 1233

 Score = 31.6 bits (70), Expect = 2.2
 Identities = 51/218 (23%), Positives = 82/218 (37%), Gaps = 27/218 (12%)
 Frame = +1

Query: 94   TGFKDSQAPEQPLL--KNDTIVGK----AQSENEENIDEQHRHSDVYSHHSSSTLKRPSS 255
            T FK+ + P++  +  + D I GK       E  E   E  + SDV    ++     PSS
Sbjct: 751  TSFKEEEKPKRFEITQEGDKITGKDTNHEHGEATEAASENSKASDV---GTAEKYIEPSS 807

Query: 256  NSIEKMITHNALEGNSETAD--SLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLET 429
             S++K    +A   NSE  +   +K E  NL+     ++TA +     +     E   E 
Sbjct: 808  ESVKKDTEEDAEVENSEKTEFIKVKAELENLDAPKEAEVTAELNKENEDVEVDTEEDAEV 867

Query: 430  E----TGLVKLK--------------TLETLK-REDSRVSSAKKEHTNDHADAHSTRSKV 552
            E    T  +K+K              T E  K  ED  V++  KE      +   +    
Sbjct: 868  ENSEKTEFIKVKAELGNLDAPKEAEVTAELNKENEDVEVAATSKE----DIETKCSEPAE 923

Query: 553  TTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIK 666
            T    G+  E++      E   K+ E     K  + +K
Sbjct: 924  TPIEDGTCTEAEVSKKDAEAVTKEDENMENSKIAEALK 961

>TDEL0C00460 Chr3 (67471..72429) [4959 bp, 1652 aa] {ON} 
          Length = 1652

 Score = 31.6 bits (70), Expect = 2.2
 Identities = 41/178 (23%), Positives = 72/178 (40%)
 Frame = +1

Query: 52   SSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSS 231
            SS +S  ++ P   +    S +   P + + +I   ++S +  N       S      S+
Sbjct: 823  SSLASSSNFYPSSVSSAVRSSSAAAPSVASSSIASASRSSSTVNTPS----SSALRSSSA 878

Query: 232  STLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPE 411
            S  +  S NS+    + ++L G+S T  S   +G N    ++   ++P T+S  + +   
Sbjct: 879  SATRSVSRNSV----SISSLAGSSSTVSS-PSDG-NTASSSVVRSSSPATSSIASSS--- 929

Query: 412  EYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLES 585
                        + T  T       VSS+    ++ +A A STR    T S  SSL S
Sbjct: 930  ------------VATSSTPSSAAHSVSSSAVRSSSANASASSTRDSAATASVVSSLRS 975

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 31.6 bits (70), Expect = 2.2
 Identities = 42/202 (20%), Positives = 79/202 (39%), Gaps = 4/202 (1%)
 Frame = +1

Query: 40   YEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYS 219
            Y  +  + S+     E  T  KD+             + ++++E  E I+   +  D++ 
Sbjct: 932  YSQVEQYKSMADSSEESATAIKDA-------------LEQSKAEYTEKIETLTKERDMFK 978

Query: 220  HHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKR-EGLNLNKKALPDITAPVTNSAHN 396
                  LK   SN +   + H   +  S+ +D  +  E L   +  L ++ A        
Sbjct: 979  DQVP-ILKDQISN-LNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKA-------- 1028

Query: 397  GAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTND---HADAHSTRSKVTTYSQ 567
                     E E  + K++  E L ++ S  ++A+K +  +   HAD     S +   +Q
Sbjct: 1029 ---------EYEQKISKIQ--EDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQ 1077

Query: 568  GSSLESDKLNMAVEKNKKKIEQ 633
                E++ L  A E  KK +EQ
Sbjct: 1078 KYKSETETLRNAAENAKKALEQ 1099

>Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar to
            Ashbya gossypii ADL022C
          Length = 1811

 Score = 31.6 bits (70), Expect = 2.2
 Identities = 20/83 (24%), Positives = 42/83 (50%), Gaps = 8/83 (9%)
 Frame = +1

Query: 118  PEQPLLKNDTIVGKAQSENEENI----DEQHRHSDV----YSHHSSSTLKRPSSNSIEKM 273
            PE+P+L + +IVG A    EE +    D+  +H+ +    ++  + +  K P++ +I   
Sbjct: 1389 PEKPILNSRSIVGSADKRKEEPVANAEDKDTKHTGISEEPFNEGTPNHTKSPATTNIHSP 1448

Query: 274  ITHNALEGNSETADSLKREGLNL 342
               +A    +E AD+ +   ++L
Sbjct: 1449 GAKDASTKLTEIADNREMPAVSL 1471

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 31.6 bits (70), Expect = 2.2
 Identities = 43/216 (19%), Positives = 84/216 (38%), Gaps = 28/216 (12%)
 Frame = +1

Query: 103  KDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS--DVYSHHSSSTLK--------RPS 252
            K  Q  E  LL+N   + +   + +E    +H+ S  +      SST++           
Sbjct: 1365 KKKQESEYELLENRLKMLEEDVKLKEKELSEHKKSLLEAQEQEKSSTIELAKLKSAAADE 1424

Query: 253  SNSIEKMITHNALE-GNSETADSLKREGLNLNKKALP----------DITAPVTNSAHNG 399
             N +E+ I    +E  N   A   +R+ LN    ++           +      NSAH  
Sbjct: 1425 KNKLEEEIKSCKVELKNKAQAFEKERKLLNEGSSSITKEYSEKVSELEDKLEAVNSAHQS 1484

Query: 400  AFPEEYRLETETGLVKLKTLETLKRE-------DSRVSSAKKEHTNDHADAHSTRSKVTT 558
               E   L+T    ++ K  E LK+E       +  +S  KK+  N H++   ++ K   
Sbjct: 1485 KLEELDSLKTNMIELENKNSEQLKKEKASIVILEETISKQKKDIDNLHSEVEDSQEKCKN 1544

Query: 559  YSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIK 666
             ++  + +  ++  A E     +++  +   EK ++
Sbjct: 1545 INKDLTKKLREMQSASETYDSNLKRMEETIEEKNVE 1580

>YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}
           CYR1Adenylate cyclase, required for cAMP production and
           cAMP-dependent protein kinase signaling; the cAMP
           pathway controls a variety of cellular processes,
           including metabolism, cell cycle, stress response,
           stationary phase, and sporulation
          Length = 2026

 Score = 31.6 bits (70), Expect = 2.2
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 8/101 (7%)
 Frame = +1

Query: 151 VGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNS--------E 306
           V K +  +E+N   + R +  YS++S  +L    S    + IT N ++  S         
Sbjct: 41  VPKVKKRHEQNSGHKSRRNSAYSYYSPRSLSMTKS---RESITPNGMDDVSISNVEHPRP 97

Query: 307 TADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLET 429
           T   +KR G  L KK L  ++    NS H+      Y L +
Sbjct: 98  TEPKIKR-GPYLLKKTLSSLSMTSANSTHDDNKDHGYALNS 137

>ZYRO0A09966g Chr1 (804999..806114) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q04934 Saccharomyces cerevisiae YDR229W IVY1
           Phospholipid-binding protein that interacts with both
           Ypt7p and Vps33p may partially counteract the action of
           Vps33p and vice versa localizes to the rim of the
           vacuole as cells approach stationary phase
          Length = 371

 Score = 31.2 bits (69), Expect = 2.3
 Identities = 24/98 (24%), Positives = 41/98 (41%)
 Frame = +1

Query: 121 EQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGN 300
           E P  K D+ + + QSE EE I++ +    V S   S+       N +E    H+    N
Sbjct: 274 EDPFNKEDSTINEGQSEGEETIEDDNLKKGVASPQFSTA---QPHNEMESEAEHDHSHEN 330

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEE 414
            +  D    +  N++  A    + P+  S+ +   P E
Sbjct: 331 EDRDDD--EDDGNVDPDADNSFSLPLAGSSRSREPPIE 366

>NCAS0A04100 Chr1 complement(827360..828814) [1455 bp, 484 aa] {ON}
           Anc_2.408 YLR033W
          Length = 484

 Score = 31.2 bits (69), Expect = 2.5
 Identities = 42/174 (24%), Positives = 63/174 (36%), Gaps = 32/174 (18%)
 Frame = +1

Query: 217 SHHSSSTLKRPSSN-SIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAH 393
           SH  +   + P+SN  I  +I    LE      DS K   L  N   +PD T P T    
Sbjct: 193 SHLETRPQELPNSNFEINNVIAQTNLE-----QDSPKLGFLAANTSNIPDPTLPPTEMMS 247

Query: 394 NGAFPEEYRLET-----------------ETGLV------------KLKTLETLKREDSR 486
               P  Y L T                 E G V            ++  +E L+RE  +
Sbjct: 248 RFLHPNWYALPTTMWLKYGDYKSWAPTFNENGTVLDSKIRGIMWLKRIGYMEILEREAKK 307

Query: 487 VSSAK--KEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRK 642
             +    K+  ND+ D   ++   +T      L  D ++ A  +N+KK  +  K
Sbjct: 308 NGAVNQLKDEKNDNEDKSQSKKDEST----KDLHKDTIDEASNENEKKTAEESK 357

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score = 31.2 bits (69), Expect = 2.6
 Identities = 33/155 (21%), Positives = 64/155 (41%), Gaps = 15/155 (9%)
 Frame = +1

Query: 265 EKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLV 444
           +K+   NA+   +   D L+      N+K +   ++ + N     +  E++    +TG+ 
Sbjct: 396 KKLTGTNAVLEKTVLRDKLQYARDTNNEKDIAKYSSQLKNLEKRMSSYEKHHENDQTGIR 455

Query: 445 KLKTL---------------ETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSL 579
           KL  L               E +K+EDS   + K     D      TR+K+  Y Q    
Sbjct: 456 KLDALTSKNRKVNLDKIRHVENVKKEDSATLNVK----TDPFSRLKTRTKI--YYQEIQQ 509

Query: 580 ESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRI 684
           E ++    + K K++ ++  KH  ++ +   F R+
Sbjct: 510 EENEKAQELAKQKQQQDKEEKHDRKQQLLAKFRRL 544

>TDEL0H04520 Chr8 complement(817439..819277) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 31.2 bits (69), Expect = 2.6
 Identities = 25/109 (22%), Positives = 45/109 (41%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEEN 183
           P   VS  T+N  ED +S S   S    P    K  +     +   D   G    E+  +
Sbjct: 496 PSDPVSGGTNNSEEDEASSSEESSPADAPANNMKRKRDDSGEIEDQD---GTTSQESPPS 552

Query: 184 IDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKRE 330
             ++  ++ V  +HS +  +RPS +  E +  ++  EG  +     ++E
Sbjct: 553 SKQRIHYAQVTKNHSETHAERPSLSYKEAITYNSNAEGKEKLIAGYEKE 601

>KNAG0M01630 Chr13 (289388..291340) [1953 bp, 650 aa] {ON} Anc_5.311
           YDR295C
          Length = 650

 Score = 31.2 bits (69), Expect = 2.7
 Identities = 29/118 (24%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +1

Query: 265 EKMITHNALEGNSETA-DSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGL 441
           EK++T   LE   +   D LK +G+ +N K+L  +     +S        E RLE  T  
Sbjct: 425 EKLVTRQLLETERQNKLDFLKHDGVGVNFKSLEALQKEQLDS--------EKRLERVTAE 476

Query: 442 VKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKN 615
            + K     ++   +V++ K+   + H D    + K+T + +  + +  + N  +EKN
Sbjct: 477 HE-KLGRRREKLMEQVTALKRLRADAH-DPFKLQGKITEFKEQIAKQKQERNQLLEKN 532

>TDEL0E02170 Chr5 complement(405306..407735) [2430 bp, 809 aa] {ON}
           Anc_5.407 YDR351W
          Length = 809

 Score = 31.2 bits (69), Expect = 2.7
 Identities = 35/144 (24%), Positives = 57/144 (39%), Gaps = 13/144 (9%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDEQHRHSDV-------------YSHHSSSTLKRPSSNSIEKMI 276
           +N+T++ K+    E+  DEQ ++SD+              +  S+ST    S  S+ K  
Sbjct: 288 QNETVLRKSIRRKEKFYDEQEKNSDLPNDFENLSIWNIPMASASTSTFLNSSQLSLSKTE 347

Query: 277 THNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKT 456
           TH +    S    S   E   L+   +P  T+P+        F  +Y  +T   L  +  
Sbjct: 348 THRSHGKRSNHNVSSTNELSFLDSCEMP--TSPIPGVNRTTDF--QYMQQTSKNLTSV-- 401

Query: 457 LETLKREDSRVSSAKKEHTNDHAD 528
               K   SR+S +K       AD
Sbjct: 402 ---YKHSSSRLSESKLSERTASAD 422

>TBLA0J00940 Chr10 complement(209827..212592) [2766 bp, 921 aa] {ON}
           Anc_5.655 YOR054C
          Length = 921

 Score = 31.2 bits (69), Expect = 2.8
 Identities = 33/141 (23%), Positives = 52/141 (36%), Gaps = 12/141 (8%)
 Frame = +1

Query: 130 LLKNDTIVGKAQSENEENIDEQH------RHSDVYSHHSSSTLKRPSSNSIEKMITHNAL 291
           +LKN   V    S+N E  +  H       HS +    SSST  RPS +   K+ T    
Sbjct: 339 ILKN---VSSHSSDNNEKAEHPHFLVEDSLHSPIIRSRSSSTSPRPSISLSPKIPTLLER 395

Query: 292 EGN------SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLK 453
           EG+               E +  +KK   +I+ P T+S  N        + T        
Sbjct: 396 EGSILKSHQESVPLEYVLEEIEKDKKKPQNISPPSTSSTTNNGAANNITINTTINGTNTS 455

Query: 454 TLETLKREDSRVSSAKKEHTN 516
              ++    + + +A   +TN
Sbjct: 456 NNSSVSTPANNIINAISSNTN 476

>TBLA0B00150 Chr2 (20203..23442) [3240 bp, 1079 aa] {ON} Anc_2.8
            YNL236W
          Length = 1079

 Score = 31.2 bits (69), Expect = 2.8
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +1

Query: 67   IDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSE--NEENIDEQHRHSDVYSHHSSS 234
            +D+Y P   TG   S A   PLL N      ++ +  + +N +  H HS  + HH+ S
Sbjct: 1005 LDTYTP---TGMTPSNAIATPLLNNTNQNSNSELDLNSGDNSNNTHLHSSTHHHHNQS 1059

>TBLA0G03070 Chr7 complement(812624..816067) [3444 bp, 1147 aa] {ON}
            Anc_3.258 YBR050C
          Length = 1147

 Score = 31.2 bits (69), Expect = 2.8
 Identities = 37/210 (17%), Positives = 81/210 (38%), Gaps = 17/210 (8%)
 Frame = +1

Query: 10   PSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENID 189
            P  S T  N+ +  ++ ++  +      T   D  A     ++ND+ +  + S +  N++
Sbjct: 473  PKRSTTPTNDNDINAAATTTTTTTTIQTTNDNDKSAITPSSIRNDSNIANSNSNSNNNLN 532

Query: 190  EQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDIT 369
                ++   ++++++    P+SN             N+ T D          +  LP I 
Sbjct: 533  SNLNNTTNTNNNNNNNYNNPNSND----------NDNTNTPD----------EPILPSIL 572

Query: 370  APVTNSAHNGAFPEEYRLETETGL-----------VKLKTLETLKREDSRVSSAKKEHTN 516
               +N+ +N    E   L  +  +           VK  + +TL + +S  S     + +
Sbjct: 573  TTSSNNNNNNVHNESIALSKDRHIHFNDRVEQCEAVKYSSSDTLSQLNSSSSIDSLNNYS 632

Query: 517  DHADAHSTRSK------VTTYSQGSSLESD 588
            ++ D++ T  K      + T+   SS + D
Sbjct: 633  NNNDSYFTLPKKHNNNSMQTHQSSSSSDDD 662

>ZYRO0E08514g Chr5 (678434..682189) [3756 bp, 1251 aa] {ON} some
            similarities with uniprot|P40020 Saccharomyces cerevisiae
            YER032W FIR1 Protein involved in 3' mRNA processing
            interacts with Ref2p potential Cdc28p substrate
          Length = 1251

 Score = 31.2 bits (69), Expect = 2.9
 Identities = 56/210 (26%), Positives = 82/210 (39%), Gaps = 3/210 (1%)
 Frame = +1

Query: 49   ISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHS 228
            I SF + D Y P+ +  F+D Q   Q           AQ       D+  R +DV S+  
Sbjct: 1015 IQSFMADDLYGPDDYRMFEDYQNVNQ----------HAQE------DDSERPADVVSYPH 1058

Query: 229  SSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFP 408
                  PS++  + + T + +  +  T  S +      +   LP+   PV  S  N A  
Sbjct: 1059 RLA---PSADFRDVLETLDNM--SPSTQRSKEFSSREPDHYTLPE--TPV-RSKRNAATD 1110

Query: 409  EEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESD 588
            E YR E E    KL  +E L  +D    S +  H     D+  + SKV+ YS  +    +
Sbjct: 1111 EGYRTEYEVRDGKL--VEVLVLDD---DSDESIHNQSEKDSPLSPSKVSQYSSPNRNHEE 1165

Query: 589  KLNMAVE---KNKKKIEQYRKHKSEKGIKG 669
             L M  +     KK I Q    K  K   G
Sbjct: 1166 LLKMCEDTATHAKKVILQLVDDKKTKKAGG 1195

>SAKL0H05104g Chr8 complement(454375..459372) [4998 bp, 1665 aa] {ON}
            weakly similar to uniprot|Q03661 Saccharomyces cerevisiae
            YMR219W ESC1 Protein localized to the nuclear periphery
            involved in telomeric silencing interacts with
            PAD4-domain of Sir4p
          Length = 1665

 Score = 31.2 bits (69), Expect = 2.9
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 13/118 (11%)
 Frame = +1

Query: 1    MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAP----EQPLLKND-------- 144
            +P PS SV+  NE  +   F + ++          DSQ       +  LKN         
Sbjct: 813  IPEPSTSVSNFNEDTNHEKFKATNA----------DSQTEISTNNEEKLKNGISDNFGVY 862

Query: 145  TIVGKAQSENEENIDE-QHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETAD 315
            T    A    E +I E ++  S V+S H+S +  + S  S    +TH++   N E  D
Sbjct: 863  TQNTPAPGSREASITEFENTASKVFSRHASVSTNKESEESFSAQLTHSSNNSNIEPGD 920

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
           YNL271C (REAL)
          Length = 1952

 Score = 31.2 bits (69), Expect = 2.9
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 10/136 (7%)
 Frame = +1

Query: 217 SHHSSSTLKRPSSNS-----IEKMITHNALEGN--SETADSLKREGLNLNKKALPDITAP 375
           S HS+S     +SNS     ++++   NA   N  S T  S +++   +  +A    T+P
Sbjct: 7   SKHSNSKESHSNSNSGLFQNLKRLANSNAANNNTGSPTNVSPQQQHSPVEHEAA---TSP 63

Query: 376 VTNSAHNGAFPEEYRLETETG-LVKLKTLET--LKREDSRVSSAKKEHTNDHADAHSTRS 546
            ++S+          + TE   L K  TL T  L +  +   SA    ++ HA +HS +S
Sbjct: 64  ASSSSFRKLNGPSRSISTEARPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQS 123

Query: 547 KVTTYSQGSSLESDKL 594
           K +   + SS  S+KL
Sbjct: 124 KYSYSKRNSSQASNKL 139

>Skud_5.12 Chr5 complement(11107..12141) [1035 bp, 344 aa] {ON}
           YDR541C (REAL)
          Length = 344

 Score = 30.8 bits (68), Expect = 3.0
 Identities = 23/82 (28%), Positives = 36/82 (43%)
 Frame = +1

Query: 112 QAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNAL 291
           Q    P L  + +   +QS   EN+ E+H H   Y  H+SS      +   E  +   AL
Sbjct: 45  QFQHNPNLFLEIVPDISQSNAFENVFERHGHEIRYVLHTSSPFYY-DTTEYENDLLIPAL 103

Query: 292 EGNSETADSLKREGLNLNKKAL 357
           EG     +S+KR   +  K+ +
Sbjct: 104 EGTKNILNSIKRYAADTVKRVV 125

>KLTH0G08822g Chr7 (723401..725035) [1635 bp, 544 aa] {ON} weakly
           similar to uniprot|P16547 Saccharomyces cerevisiae
           YIL136W OM45 Protein of unknown function major
           constituent of the mitochondrial outer membrane located
           on the outer (cytosolic) face of the outer membrane
          Length = 544

 Score = 30.8 bits (68), Expect = 3.4
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 2/121 (1%)
 Frame = +1

Query: 286 ALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVK--LKTL 459
           A +G  +TADSLKR+          D+ + + N A N     +  +E +  +        
Sbjct: 177 AKKGTQDTADSLKRQA--------SDVESDIKNKAGNA---RDTAVEAKESIFNWGFSKA 225

Query: 460 ETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYR 639
           E  K    +      +H N+  D ++  S+   +S G      +L   V++  KK+E+Y+
Sbjct: 226 EKAKAVAIQEYDQANKHFNELRDKYN--SEKGLFSSG----DQELKKQVDEASKKLEEYK 279

Query: 640 K 642
           K
Sbjct: 280 K 280

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 30.8 bits (68), Expect = 3.5
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 6/126 (4%)
 Frame = +1

Query: 220 HHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAP---VTNSA 390
           HH +  +K  +SNS+    THN+   NS  ++ ++ +    + KAL D+T     V N  
Sbjct: 270 HHGTGRIKLKNSNSVS---THNS-SANSNPSNVIRPKS---SHKAL-DLTKNDRYVQNIK 321

Query: 391 HNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS---KVTTY 561
                 +  RL +   L   K L T K + + V+S + +  ND++  HS  +    VT  
Sbjct: 322 RLSTQLKNTRLNSINALSVDKGLPTPKTDAALVNSIESKVLNDNSAPHSVENYLEVVTKP 381

Query: 562 SQGSSL 579
             G++L
Sbjct: 382 GHGATL 387

>ZYRO0G14608g Chr7 complement(1166287..1168134) [1848 bp, 615 aa]
           {ON} some similarities with uniprot|P32583 Saccharomyces
           cerevisiae YKR092C SRP40 Suppressor of mutant AC40
           subunit of RNA polymerase I and III nucleolar protein
           that is immunologically and structurally related to rat
           Nopp140 a nonribosomal protein of the nucleolus and
           coiled bodies
          Length = 615

 Score = 30.8 bits (68), Expect = 3.5
 Identities = 33/198 (16%), Positives = 81/198 (40%), Gaps = 10/198 (5%)
 Frame = +1

Query: 25  TTDNEYEDISSFSSIDSY----------KPEPFTGFKDSQAPEQPLLKNDTIVGKAQSEN 174
           ++D+  +D SS  S D+           K E  +    S++  +      +    +  E+
Sbjct: 197 SSDSSSDDSSSDESSDNEEEKKTKSKEKKAESSSSESSSESSSESSSDESSSDESSDDED 256

Query: 175 EENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKA 354
           E+  + + + ++  S  SSS+     S+S       ++ E +S+ +   + E     K+ 
Sbjct: 257 EKKTESKEKKTESSSSESSSSDSSSDSSSESSSDESSSDESSSDESSDNEEEKKTDPKEK 316

Query: 355 LPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAH 534
               ++  ++S+ + +        +++   +    E  K+ DS+   +  +  +  +D+ 
Sbjct: 317 KAGSSSSDSSSSDSSSEESSDSESSDSDSSESSDNEEEKKSDSKEKKSNSDSGSSDSDSD 376

Query: 535 STRSKVTTYSQGSSLESD 588
           S+ S  +  S   S +SD
Sbjct: 377 SSSSSSSVSSDSDSSDSD 394

>CAGL0A04257g Chr1 complement(422355..424289) [1935 bp, 644 aa] {ON}
           some similarities with uniprot|P40059 Saccharomyces
           cerevisiae YER088c DOT6 or uniprot|P34219 Saccharomyces
           cerevisiae YBL054w
          Length = 644

 Score = 30.8 bits (68), Expect = 3.5
 Identities = 32/178 (17%), Positives = 74/178 (41%), Gaps = 7/178 (3%)
 Frame = +1

Query: 139 NDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADS 318
           N T++     +N  +++ +    ++    S+S  +RPS  S    IT+N +  +S +A +
Sbjct: 442 NTTLITSKSRKNSFSVNSRRSSFNI---SSTSNSRRPSIISAPNSITNNFVINHSNSASN 498

Query: 319 L------KREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
           L      +R+  N+ ++A    +    +S +     E    E      K++ ++      
Sbjct: 499 LHAAPKMQRKNSNVKREATSSQSLNTISSPNGKTSTENGTYENSYNTFKVQYMDNPVGHS 558

Query: 481 SRVSSAKKEHTNDHADAHSTRSK-VTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKS 651
           S       ++ +   D    + + VT+ S  S   S  +  ++E+++   E   ++ S
Sbjct: 559 SAFQKKAMDYASHSLDGMEPKDEGVTSCSNNSGNNSRFMPWSLEEDQLLTENKLRNLS 616

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 30.8 bits (68), Expect = 3.5
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +1

Query: 334 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETG 438
           L+LN   LP+  +P TNS  N  F   +RL   +G
Sbjct: 144 LSLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASG 178

>Kwal_23.2861 s23 complement(45793..47802) [2010 bp, 669 aa] {ON}
           YJL010C - Protein required for cell viability [contig
           246] FULL
          Length = 669

 Score = 30.8 bits (68), Expect = 3.5
 Identities = 23/100 (23%), Positives = 43/100 (43%)
 Frame = +1

Query: 7   VPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENI 186
           VPS S+  D++  D+ +  ++++ +P  F G  D+Q  E       T+        EE  
Sbjct: 21  VPSGSIYNDDQNNDLKANDTVNNGEPNTFYGVLDTQELEYFKQAESTLAIDTFETPEE-- 78

Query: 187 DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSE 306
            ++   S V     +  LK  +S    K++    L G ++
Sbjct: 79  -KEQFISSVIEESKNKELKLATSQICSKLMERIILAGTNQ 117

>TBLA0B01790 Chr2 complement(405022..407181) [2160 bp, 719 aa] {ON} 
          Length = 719

 Score = 30.8 bits (68), Expect = 3.6
 Identities = 27/114 (23%), Positives = 49/114 (42%), Gaps = 4/114 (3%)
 Frame = +1

Query: 40  YEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGK----AQSENEENIDEQHRHS 207
           +E +  +S ++ Y      G + +    QPLL  D+        + SE++ N+D   RH+
Sbjct: 394 HELVQIYSHVNQY------GEEITPLYSQPLLPTDSTSDSDSCSSGSESDSNLDFHSRHT 447

Query: 208 DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDIT 369
              + H+S  L R S+N+  K +    +  +  T+   K     L +    D T
Sbjct: 448 TSTTSHNS--LSRHSTNATSKRVDSGIVSTHGTTSPVQKYRRNELTRIITSDAT 499

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 30.8 bits (68), Expect = 3.6
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 10/72 (13%)
 Frame = +1

Query: 154 GKAQSENEENIDEQHRHSDVYSHH----------SSSTLKRPSSNSIEKMITHNALEGNS 303
           G + S ++ N++E     DVY+HH          SSST ++ +SN  ++    N  +  S
Sbjct: 192 GNSNSGSQNNVNE-----DVYNHHHIQHSDQDNSSSSTQEKQNSNEKKRNSFMNFGKNKS 246

Query: 304 ETADSLKREGLN 339
              DS K++  N
Sbjct: 247 NAKDSTKKDDNN 258

>TBLA0G02280 Chr7 (588554..590863) [2310 bp, 769 aa] {ON} Anc_2.538
           YMR075W
          Length = 769

 Score = 30.8 bits (68), Expect = 3.6
 Identities = 28/138 (20%), Positives = 60/138 (43%)
 Frame = +1

Query: 106 DSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHN 285
           DS +    L+ NDT   + Q    ++  +Q   S   S  +S++  +PSS+S     + +
Sbjct: 71  DSISNVTNLISNDTNSNQVQKNQTDSQKKQKSSSKTNSDRNSNSSPKPSSSS-----SSS 125

Query: 286 ALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLET 465
           +   NS T  ++   G + N         P   S+ N  +  + R   ++ +   K L+ 
Sbjct: 126 SSATNSSTTINITNNGSSTNLSESDRERRPKRASSQNVDYNLKKRRIFKSPIDDEKLLKK 185

Query: 466 LKREDSRVSSAKKEHTND 519
             +++  +++ +K   N+
Sbjct: 186 TPKQEDHINTDEKLTDNN 203

>CAGL0L12914g Chr12 complement(1379249..1381906) [2658 bp, 885 aa]
            {ON} similar to uniprot|Q05050 Saccharomyces cerevisiae
            YMR031c
          Length = 885

 Score = 30.8 bits (68), Expect = 3.7
 Identities = 42/212 (19%), Positives = 83/212 (39%), Gaps = 25/212 (11%)
 Frame = +1

Query: 112  QAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNAL 291
            Q  ++ L   +++  KAQ+  +E IDE+ +   ++   S   L + +    E       L
Sbjct: 654  QLKKEKLQLLESMRNKAQARGDEKIDEE-KVKGLFGMTSEEYLAKHAPKKEEP--AEEKL 710

Query: 292  EGNSETADSLKRE-------------GLNLNKK------ALPDITAPVTNSAHNGAFPEE 414
            E  +E A ++K+E                  KK      A P   +P +     G+  ++
Sbjct: 711  ETVAEEASAMKKEKPTAAAATTAAAAAATTPKKPASAPRAAPAAASPKSEKKRKGSVFDK 770

Query: 415  YRLETETG--LVKLKTLETLKREDSRVSSAKKEH----TNDHADAHSTRSKVTTYSQGSS 576
            + L       + + +T + +  E +++ S  K H    TN+HA  H+        ++ + 
Sbjct: 771  FFLGPRKAHMIEETRTNQKVAEEKAKMDSVSKPHLVSTTNEHAKPHAAA------TEEAP 824

Query: 577  LESDKLNMAVEKNKKKIEQYRKHKSEKGIKGF 672
             + D    A E    +  +  ++K E    GF
Sbjct: 825  KKVDAPKPATEVKSSEAAEDEENKLEHTFSGF 856

>NDAI0C05440 Chr3 complement(1260473..1263298) [2826 bp, 941 aa]
           {ON} Anc_8.526 YBR203W
          Length = 941

 Score = 30.8 bits (68), Expect = 3.7
 Identities = 26/165 (15%), Positives = 62/165 (37%), Gaps = 10/165 (6%)
 Frame = +1

Query: 187 DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
           D +HR+  +YS    ++      NS    I   +  GN+ T  S      + +  ++   
Sbjct: 327 DWRHRNDPLYSAPLLNSYNLKRVNSRSSSIHSTSSNGNTSTVSSKNSRSRHRSNSSVSSF 386

Query: 367 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKR-EDSRVSSAKKEHT---NDHADAH 534
           T+ + +S  N    +       + L  ++ + +     D+ +   + + T   N   D +
Sbjct: 387 TSSIMSSLQNSTITQPNPTNNNSPLTSIQRMRSASNVNDNSIDPIRVQRTISNNSAKDPN 446

Query: 535 STRSKVTTY------SQGSSLESDKLNMAVEKNKKKIEQYRKHKS 651
           S  + ++ +       Q   L   + N  +     +++  ++ KS
Sbjct: 447 SVSNNISWFRMRLGSRQKKELVRSRKNSVISSTINEMDDKKQTKS 491

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score = 30.8 bits (68), Expect = 3.7
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +1

Query: 541 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRI 684
           +SK T  SQ S +ES KL +    N+ K +  ++HK+E  I GF +++
Sbjct: 559 KSKDTIQSQNSQMESLKLTI----NQLKAQLDKQHKTELEISGFNNKL 602

>Smik_4.394 Chr4 (718158..721880) [3723 bp, 1240 aa] {ON} YDR150W
           (REAL)
          Length = 1240

 Score = 30.8 bits (68), Expect = 3.8
 Identities = 37/134 (27%), Positives = 55/134 (41%), Gaps = 2/134 (1%)
 Frame = +1

Query: 217 SHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHN 396
           +H S   LK     ++   I H +L   +E     K  G+N   K L D      ++  N
Sbjct: 461 THRSMVLLKNEEMKNLCNKIEHPSLTYLTE-----KAAGMN---KILIDQVTNTESTYSN 512

Query: 397 GAFPEEYRLETETGLVKLKTLETLKR--EDSRVSSAKKEHTNDHADAHSTRSKVTTYSQG 570
               EEY       LV       LK   E+  V  +K   +ND    ++TRS  TT    
Sbjct: 513 RKDLEEYCHRLNLVLVDEDEYTVLKDLLEELNVDDSKNPSSNDDQSLNTTRSNSTT---T 569

Query: 571 SSLESDKLNMAVEK 612
           SS+ +D L+  +E+
Sbjct: 570 SSMFTDALDDNIEE 583

>NDAI0G06160 Chr7 (1522574..1526320) [3747 bp, 1248 aa] {ON}
           Anc_1.224 YJL129C
          Length = 1248

 Score = 30.8 bits (68), Expect = 3.8
 Identities = 38/151 (25%), Positives = 55/151 (36%), Gaps = 3/151 (1%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSE--T 309
           + D    K  S    N DEQ   +D  + HS     RP +NS      HN+   +S   T
Sbjct: 185 RRDDFQEKLFSGKMVNRDEQESINDTITGHSRYAAIRPQANS------HNSDSNSSSVPT 238

Query: 310 ADSLKREGLNLNKKALPDITAPVTNSAHN-GAFPEEYRLETETGLVKLKTLETLKREDSR 486
           + S K E           +        HN G+F  +Y  ETE    + +  E +  ED  
Sbjct: 239 SSSTKDEASVTKPYINHTLGVSEPQIRHNDGSFDRDYEDETE-NFARRRMSEDILPEDMY 297

Query: 487 VSSAKKEHTNDHADAHSTRSKVTTYSQGSSL 579
            S     + +D A      + +     G SL
Sbjct: 298 RSIMLLRNQHDDAKEDDGPALIVKAPTGRSL 328

>CAGL0M01738g Chr13 (197743..201900) [4158 bp, 1385 aa] {ON} similar
            to uniprot|P35177 Saccharomyces cerevisiae YBR081c SPT7
            Transcriptional activator
          Length = 1385

 Score = 30.8 bits (68), Expect = 3.8
 Identities = 35/171 (20%), Positives = 63/171 (36%), Gaps = 8/171 (4%)
 Frame = +1

Query: 127  PLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMIT---HNALEG 297
            PL+ N TI  +A  E E  ++E  +  D   +      +   + S  K +T   H   + 
Sbjct: 521  PLIPNITIRNRADVERE--LEELEKDKDYKDNDDKEDAEEEVAGSGRKGLTMGAHKLAKD 578

Query: 298  NSETADSLKREGLNLNKKALPDITAPVTNSA----HNGAFPE-EYRLETETGLVKLKTLE 462
            +S T ++   +      K +  +   V             PE +  L  + G  K+   E
Sbjct: 579  SSATNNATNTDTNEETTKVINKMDIEVQKGEGEEKEGEVMPESDQSLSQDKGNDKIIETE 638

Query: 463  TLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKN 615
            T   +D       + H N   +      K+ + S+    E  K+N + E+N
Sbjct: 639  TNFSKDDDKHLTPQSHNNTEEETKDQSEKMASESKTEIEEDSKINESSEEN 689

>TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1504

 Score = 30.8 bits (68), Expect = 3.8
 Identities = 39/198 (19%), Positives = 76/198 (38%), Gaps = 33/198 (16%)
 Frame = +1

Query: 163  QSENEENIDEQHRHSDVY---SHHSSSTLKRPSSNSIEKMITHNALEGNSETADSL---- 321
            ++ +++NI+E+  + + +    HH S   +   S+S E +   +  + + E AD +    
Sbjct: 654  KNNSKDNINEEVENDEDFHSMQHHHSHDHEHEHSDSFEDIADEDDDDDDLEDADEIDDDE 713

Query: 322  -------KREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 480
                   + E L   +K    I   +T           +  E E    +LK LE L+ ED
Sbjct: 714  DYDSGIDETERLEEGRKL---IQIAITKLLQARIIESYHEKEAENN--RLKLLEELEAED 768

Query: 481  SR--VSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMA----------------- 603
             +  V   KK+   +         +V    +    E +++                    
Sbjct: 769  KKKKVKEEKKQKKREKEKERKRLQQVAKEEEKRKKEEERIRSELEAQEREMKRREAQRKK 828

Query: 604  VEKNKKKIEQYRKHKSEK 657
            VE+NKKK ++ ++ K E+
Sbjct: 829  VEENKKKKDEEKRRKLEE 846

>TPHA0J00100 Chr10 complement(3..4550) [4548 bp, 1516 aa] {ON} 
          Length = 1516

 Score = 30.8 bits (68), Expect = 3.8
 Identities = 49/222 (22%), Positives = 82/222 (36%), Gaps = 1/222 (0%)
 Frame = +1

Query: 7    VPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENI 186
            + S S  T  E     S  +      E  +G    + P   L+     +    +  E + 
Sbjct: 755  IESTSAETSEESSIEPSDVTSADLSIETTSGETSEECPLSLLMSPPPDLSIETTSGETSE 814

Query: 187  DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 366
            +     SDV S   S         S E  I  + +     + +S   E    +     D+
Sbjct: 815  ESSIEPSDVTSADLSIETTS-GETSEESSIASSDVTSADSSIESTSAERSEESSIESSDV 873

Query: 367  T-APVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTR 543
            T A ++    +G   EE  +E+        ++ET   E S VSS +   T+    +  T 
Sbjct: 874  TSADLSIETTSGETSEESSIESSDVTSADLSIETTSGETSEVSSIESSETSSAESSIETT 933

Query: 544  SKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKG 669
            S  T  S+ SS+ES + + A    +  IE+    +SE+   G
Sbjct: 934  SGET--SEESSIESSETSSA----ESSIERTSAERSEESSIG 969

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 30.8 bits (68), Expect = 3.9
 Identities = 34/163 (20%), Positives = 67/163 (41%)
 Frame = +1

Query: 169  ENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNK 348
            E  E I  ++             L+   S+  +++I +N      ET  + K + + + K
Sbjct: 1471 EKVETIKSEYDKEINILEDKKEVLESELSDKKQEIIDYNQKIKEQETKATEKEKEIQVAK 1530

Query: 349  KALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHAD 528
             AL         +A       E  L T    V+ K   TLKRE+   S +  +H N   +
Sbjct: 1531 NAL--------KNAEKKKKDIENDLRTTIATVE-KENTTLKRENQLKSESIDKHQN---N 1578

Query: 529  AHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEK 657
             H  + +++   + +  + D++    ++N K I++  K + +K
Sbjct: 1579 IHLLQEELSKQKELADKKHDEIRKLEKENSKMIDRIDKLEKQK 1621

>NDAI0H00400 Chr8 (83321..84421) [1101 bp, 366 aa] {ON} 
          Length = 366

 Score = 30.4 bits (67), Expect = 4.1
 Identities = 19/69 (27%), Positives = 32/69 (46%)
 Frame = +1

Query: 181 NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 360
           N  +  R+S  YSH + +T     +NSI+ +  HN    N+ + D       N N +   
Sbjct: 274 NKSKSRRNSSNYSHMNHTTSTLEDTNSIKSL--HNHHHNNNNSHDHNNNNNNNNNDQINQ 331

Query: 361 DITAPVTNS 387
           +I+ P+  S
Sbjct: 332 NISDPLNKS 340

>TBLA0F01890 Chr6 complement(473942..475297) [1356 bp, 451 aa] {ON}
           Anc_7.281 YDL175C
          Length = 451

 Score = 30.4 bits (67), Expect = 4.4
 Identities = 33/154 (21%), Positives = 64/154 (41%)
 Frame = +1

Query: 82  PEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNS 261
           P  +  +   ++PE    KNDT     + +++ +ID    ++  +S H     +   S+ 
Sbjct: 171 PNVWRSYLLKESPENSNNKNDT---NTKKQSKLSIDFISCYNCGFSGHFGDDCRERRSSK 227

Query: 262 IEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGL 441
           +   I   +       A SLK+E  +L  K +       TN+ H   F +++  +     
Sbjct: 228 VP--IEDGSAFSGDNLAPSLKKEYYSLLNKVMSK-----TNNRHK-RFDDDHDKKGNNQ- 278

Query: 442 VKLKTLETLKREDSRVSSAKKEHTNDHADAHSTR 543
              K L+  KR+D +  SAK+ + +   +    R
Sbjct: 279 ---KNLKKEKRQDKKSQSAKRNYNDSRTNNKKRR 309

>Kpol_541.25 s541 (76077..77561) [1485 bp, 494 aa] {ON}
           (76077..77561) [1485 nt, 495 aa]
          Length = 494

 Score = 30.4 bits (67), Expect = 4.4
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 6/70 (8%)
 Frame = -2

Query: 563 EYVVTLDRVECASA*SLVCSFLAEETRESS--LFK----VSSVFNLTNPVSVSKRYSSGN 402
           E++V + R       + +  ++ E+ +ESS  L K    V+S+FNLTN      + S+G+
Sbjct: 264 EHLVKIARKHIGQLKADIEWYIEEKKKESSPILLKPMEYVTSLFNLTNT-----KVSNGS 318

Query: 401 APLWAEFVTG 372
           AP W E + G
Sbjct: 319 APGWIESICG 328

>NCAS0G02010 Chr7 complement(362692..364245) [1554 bp, 517 aa] {ON}
           Anc_2.88 YNL166C
          Length = 517

 Score = 30.4 bits (67), Expect = 4.5
 Identities = 32/167 (19%), Positives = 62/167 (37%), Gaps = 3/167 (1%)
 Frame = +1

Query: 67  IDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKR 246
           ID+   EP T  ++ Q PE+P  + + +  + +  ++  +DE     +  SH    + ++
Sbjct: 43  IDAVHNEPSTSEEEVQHPEEPKWEREEVNDEEKELDQVELDEDTNDGE-KSHQEDDSAEK 101

Query: 247 PSSNSI---EKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEY 417
              N     E  +T N  EG  E +   + + L++++    D   P           +E 
Sbjct: 102 LIDNDTPVSEVPLTENE-EGKHEVSKENEEKPLDVSETLAQDDNKPAEPIIEQKVVEKEE 160

Query: 418 RLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTT 558
               +            K E+  V   K E   D  +   T  + +T
Sbjct: 161 EQPPQ------------KIEEQTVEKEKPEKPTDSEEWEETEGEAST 195

>Kpol_1049.1 s1049 (504..2117) [1614 bp, 537 aa] {ON} (504..2117)
           [1614 nt, 538 aa]
          Length = 537

 Score = 30.4 bits (67), Expect = 4.5
 Identities = 13/58 (22%), Positives = 28/58 (48%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSET 309
           +N  ++    + N  N + QH H     HHS+++    ++N+    I++N    N+ +
Sbjct: 65  QNSLLLDNNSTNNNNNNNHQHHHHHHPHHHSNTSNGNSNNNNSHNSISNNNNSNNNNS 122

>KAFR0I01370 Chr9 complement(282658..284283) [1626 bp, 541 aa] {ON}
           Anc_4.38 YLR314C
          Length = 541

 Score = 30.4 bits (67), Expect = 4.6
 Identities = 32/144 (22%), Positives = 58/144 (40%)
 Frame = +1

Query: 202 HSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVT 381
           H+ V    ++ST+  P S    + + ++A   + ET                     P +
Sbjct: 7   HTSVKKEEATSTIPFPPSGFAPQQVVNDAAPEHHETN--------------------PFS 46

Query: 382 NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTY 561
           N+  N         ETE G V +    T+KREDS      ++     +D  ST+ +  T 
Sbjct: 47  NATEND--------ETEVGDVAIPVPATVKREDS------EKKLPQESDQSSTQKEQQTN 92

Query: 562 SQGSSLESDKLNMAVEKNKKKIEQ 633
              S+L+    N+++++ +   EQ
Sbjct: 93  DLASNLD----NLSIQQGQLLPEQ 112

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score = 30.4 bits (67), Expect = 4.6
 Identities = 51/202 (25%), Positives = 80/202 (39%), Gaps = 21/202 (10%)
 Frame = +1

Query: 133 LKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSET- 309
           LKN      A     +++ E    S+VY+HH    +K    N +  ++  N    NS+T 
Sbjct: 106 LKNSAPATYASLSTVQSLLEHLNESNVYTHHDLRPIKE-RLNEVSAIVEQNKYVSNSDTQ 164

Query: 310 -----ADSL------KREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKL-- 450
                AD +      K E LN NK     I   +   A      +EY    E+ L ++  
Sbjct: 165 SVNADADDIGEFALQKDEELNKNK-----IEEDLLLRAKLKHCIDEYN-AIESKLEEIHP 218

Query: 451 ---KTLETL----KREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVE 609
               T+E L    +   S  SS K+ H        +  S  +  S+  ++  D+  +  E
Sbjct: 219 DLQSTMEALFQIRRGLLSLASSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQ--VIDE 276

Query: 610 KNKKKIEQYRKHKSEKGIKGFF 675
           K K+  EQ  K +S + I G F
Sbjct: 277 KLKQLQEQLEKLESHRDINGKF 298

>TPHA0H02470 Chr8 (581837..583696) [1860 bp, 619 aa] {ON} Anc_7.116
           YOL027C
          Length = 619

 Score = 30.4 bits (67), Expect = 4.7
 Identities = 40/177 (22%), Positives = 66/177 (37%), Gaps = 12/177 (6%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETAD 315
           K++    KA  ++++N+      +       +ST  +PS  + E   T +  +    T  
Sbjct: 449 KSEAAEQKAAEKSQKNVQPSPTETAAPQTAKTSTPSKPSPAAAETTATPSGAKDTVSTKS 508

Query: 316 SLKREGL----------NLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLET 465
             K EG+           L    L +    V  SA  G+  EE     ++   KL+    
Sbjct: 509 GKKPEGVETVPELKTEAKLVTPKLANKDVKVVASAPTGSKTEEDPESADSSAFKLR---V 565

Query: 466 LKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVE--KNKKKIE 630
           LK +D  +   KKE   D   A   R ++        +E + +    E  KN KK E
Sbjct: 566 LKEQDELI---KKE--EDELRARKVREQIADDINLDDVEKEAVPPKTEQPKNNKKNE 617

>KLTH0G04246g Chr7 (338413..340404) [1992 bp, 663 aa] {ON} similar
           to uniprot|P26570 Saccharomyces cerevisiae YML016C PPZ1
           Serine/threonine protein phosphatase Z isoform of Ppz2p
           involved in regulation of potassium transport
          Length = 663

 Score = 30.4 bits (67), Expect = 4.7
 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 16/76 (21%)
 Frame = +1

Query: 115 APEQPLLKNDTIVGK------------AQSENEENIDEQHRH----SDVYSHHSSSTLKR 246
           AP+ P+LKN T +G                EN+EN    HR     S  YS  S     R
Sbjct: 155 APKSPILKNSTSIGNLGPNTTYHENAVTDDENDENESHHHRRRSNDSRRYSQKSPVAGSR 214

Query: 247 PSSNSIEKMITHNALE 294
            +S+S  +  + + LE
Sbjct: 215 SNSSSSNRRKSGSHLE 230

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 30.4 bits (67), Expect = 4.7
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = -3

Query: 241 SKYWNCDESTHLND 200
           SKYWNC +STH ND
Sbjct: 429 SKYWNCFKSTHSND 442

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score = 30.4 bits (67), Expect = 4.7
 Identities = 31/158 (19%), Positives = 62/158 (39%), Gaps = 9/158 (5%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDEQHRHS-----DVYSHHSSSTLKRPSSNSIEKMITHNALEGN 300
           +ND +     S +++    +H+++     + +S   S    + ++N+  + I  + LE N
Sbjct: 514 ENDGLFADLGSSDDDESSTRHQNTSDKTQETHSPKLSQNEDQHANNNETQEIVKHVLEHN 573

Query: 301 --SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLET--ETGLVKLKTLETL 468
             +ET + +  E    +K    DI    T   HN +  E    ET     +    TL   
Sbjct: 574 HNNETQEIVNHEIKENHKNGTQDIAINETEQDHNNSAQEIENSETGINAAITSTSTLPGS 633

Query: 469 KREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLE 582
                 +S  +  HT+     +   ++ T+    S +E
Sbjct: 634 IASPPTISEQRAPHTSAVLTTNDDVTEGTSKDDSSQVE 671

>KLLA0F01122g Chr6 complement(102765..104903) [2139 bp, 712 aa] {ON}
           similar to uniprot|P39744 Saccharomyces cerevisiae
           YOR206W NOC2 Protein that forms a nucleolar complex with
           Mak21p that binds to 90S and 66S pre-ribosomes as well
           as a nuclear complex with Noc3p that binds to 66S pre-
           ribosomes both complexes mediate intranuclear transport
           of ribosomal precursors
          Length = 712

 Score = 30.4 bits (67), Expect = 4.8
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +1

Query: 505 EHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHK--SEKGIKGFFH 678
           +HT DH       SK T   +G+  E +K   A+ K  +K+++  K +  ++  ++ FF 
Sbjct: 17  KHTLDHRKKLKDHSKRTAGRRGNKTEEEKNAAALTKEDQKLKKSAKEEVFNDMKVEEFFD 76

Query: 679 RIFD 690
             FD
Sbjct: 77  NGFD 80

>YOR014W Chr15 (357674..359947) [2274 bp, 757 aa] {ON}  RTS1B-type
           regulatory subunit of protein phosphatase 2A (PP2A);
           Rts1p and Cdc55p are alternative regulatory subunits for
           PP2A; PP2A-Rts1p protects cohesin when recruited by
           Sgo1p to the pericentromere; highly enriched at
           centromeres in absence of Cdc55p; homolog of the
           mammalian B' subunit of PP2A
          Length = 757

 Score = 30.4 bits (67), Expect = 4.8
 Identities = 34/157 (21%), Positives = 59/157 (37%), Gaps = 9/157 (5%)
 Frame = +1

Query: 220 HHSSSTLKR-----PSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTN 384
           HHSSST K      PSS+S     +  +  G+S T  +  R+G   +K++     +    
Sbjct: 83  HHSSSTSKTKTATTPSSSSSSSRSSSVSRSGSSSTKKTSSRKGQEQSKQSQQPSQSQKQG 142

Query: 385 SAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYS 564
           S+ + A            ++    + T+ ++D   S     H        +  S   + +
Sbjct: 143 SSSSSA-----------AIMNPTPVLTVTKDDKSTSGEDHAHPTLLGAVSAVPSSPISNA 191

Query: 565 QGSSLESDKLNMAVEKNKKKIE----QYRKHKSEKGI 663
            G+++ SD  N     N   I     Q   H S + I
Sbjct: 192 SGTAVSSDVENGNSNNNNMNINTSNTQDANHASSQSI 228

>NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241
          Length = 764

 Score = 30.4 bits (67), Expect = 4.8
 Identities = 24/110 (21%), Positives = 48/110 (43%)
 Frame = +1

Query: 121 EQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGN 300
           E  ++K+ T   KA     + + E+   + +  H+ + T  + +++  E  +T       
Sbjct: 519 EGEIVKDKT---KAVRTKYDKMFERKNQTILSEHYLNITQSQAAADEDEDFMT------- 568

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKL 450
                 +KR+   LN++ LP +T P +N     A  ++  L T+    KL
Sbjct: 569 ------VKRQDHQLNEEELPALTVPTSNRGQKKALSKKASLSTKGNATKL 612

>NCAS0A01160 Chr1 (226660..229038) [2379 bp, 792 aa] {ON} Anc_6.201
            YPL195W
          Length = 792

 Score = 30.4 bits (67), Expect = 4.8
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 11/145 (7%)
 Frame = +1

Query: 244  RPSSNSIEKMITHNA---LEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEE 414
            +P S   +K++T N    LE    T + L  E +  + +    +T  +++   + A P E
Sbjct: 639  KPISEGQQKLLTGNINIDLETPFLTQEEL--EDILRSSEDSHTLTRSLSSLLRDSATPTE 696

Query: 415  YRLETE----TGLVKLKTLETLKREDSRVSSA----KKEHTNDHADAHSTRSKVTTYSQG 570
               E E    T       L T +R+  R+S+      +E  N +AD   T ++       
Sbjct: 697  SEREDEYKQETSPDSQNALSTGQRKKDRLSNPFYLDHEESLNTNADDEITNAENAQEHDD 756

Query: 571  SSLESDKLNMAVEKNKKKIEQYRKH 645
            +  +S       +K KKKI+  R H
Sbjct: 757  AKHKSKSKKKGEKKKKKKIDSCRSH 781

>ZYRO0D06072g Chr4 complement(516283..518754) [2472 bp, 823 aa] {ON}
            similar to uniprot|P17629 Saccharomyces cerevisiae
            YDR138W
          Length = 823

 Score = 30.4 bits (67), Expect = 4.8
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 6/134 (4%)
 Frame = +1

Query: 241  KRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKA---LPDITAPVTNSAHNGAFPE 411
            K+P  + +E+   + A +   + A   + E  N  KKA   + ++  PVTNS       E
Sbjct: 626  KQPHISKLEEARNYIAEKQRRKRAHEEELEE-NSRKKAKVNIENVEKPVTNSEQVDESIE 684

Query: 412  EYRLETETGLVKLKTLETLKREDSRVS---SAKKEHTNDHADAHSTRSKVTTYSQGSSLE 582
               ++TET    ++T E    E    S      KE   +H D    +++     Q     
Sbjct: 685  SKSIDTETKTAPVETSEEKSTESVAASGNADKTKEPEGEHKDQEQGQAQTQDQDQEEFRR 744

Query: 583  SDKLNMAVEKNKKK 624
             + L    E+N ++
Sbjct: 745  PEPLKDNSERNAEE 758

>ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weakly
           similar to uniprot|P53739 Saccharomyces cerevisiae
           YNR047W Putative protein kinase that when overexpressed
           interferes with pheromone-induced growth arrest
           localizes to the cytoplasm potential Cdc28p substrate
           and some similarities with YCR091W uniprot|P25341
           Saccharomyces cerevisiae YCR091W KIN82 Putative
           serine/threonine protein kinase, most similar to cyclic
           nucleotide-dependent protein kinase subfamily and the
           protein kinase C subfamily
          Length = 860

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 31/124 (25%), Positives = 54/124 (43%)
 Frame = +1

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 180
           +P P++ V  DNEYED SS     S         + S +P  PL ++   +   Q E  E
Sbjct: 319 LPFPAIVVGVDNEYEDESSSRITRSPDRSTHRAHRGS-SPPIPLQQDK--LSSQQKEQRE 375

Query: 181 NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 360
             D   +   +    SS     P+    +++++ N  +GN+ T  +    G +   KA P
Sbjct: 376 QSDNILQTKPILRRASSV----PNVLKSKRLVSENG-DGNNATVQA--SIGSSSPSKASP 428

Query: 361 DITA 372
            +++
Sbjct: 429 QVSS 432

>YLR045C Chr12 complement(235037..237703) [2667 bp, 888 aa] {ON}
           STU2Microtubule-associated protein (MAP) of the
           XMAP215/Dis1 family; regulates microtubule dynamics
           during spindle orientation and metaphase chromosome
           alignment; interacts with spindle pole body component
           Spc72p
          Length = 888

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 29/139 (20%), Positives = 59/139 (42%), Gaps = 15/139 (10%)
 Frame = +1

Query: 268 KMITHNALEGNSETADSLKREGLNLNKKALPDIT-------APVTNSAHNGAFPEEYRLE 426
           K+   N      E  D+LKR+ +    K LP+ +       + +  +   G    ++ L+
Sbjct: 531 KIFGMNTFVKTLEHLDNLKRKKIEETVKTLPNFSIASGSTHSTIETNKQTGPMENKFLLK 590

Query: 427 TETGLVKLKTLETLKREDSR--------VSSAKKEHTNDHADAHSTRSKVTTYSQGSSLE 582
             + L   +   +  R D++        V+SA K        A + +S+V   S+  +  
Sbjct: 591 KSSVLPSKRVASSPLRNDNKSKVNPIGSVASASKPSMV----AANNKSRVLLTSKSLATP 646

Query: 583 SDKLNMAVEKNKKKIEQYR 639
            + +  + +KN+K IE+Y+
Sbjct: 647 KNVVANSTDKNEKLIEEYK 665

>Kwal_5.492 s5 complement(6364..9048) [2685 bp, 894 aa] {ON} YAL063C
           (FLO9) - putative Flo1p homolog [contig 303] FULL
          Length = 894

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 30/116 (25%), Positives = 45/116 (38%), Gaps = 1/116 (0%)
 Frame = +1

Query: 205 SDVYSHHSSSTLKRPSSNS-IEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVT 381
           S V+S   SS L R SS S      TH+ +    +   S + E   ++      I++   
Sbjct: 542 SSVFSSKVSSVLSRSSSVSPTSASSTHSVVTTQVQPGSSSENE---ISTPVSAKISSYTP 598

Query: 382 NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSK 549
           + A + A   +   ETETG+V   T  TL      +     E    H    S  S+
Sbjct: 599 SMAKSSAGFSQDVTETETGIVTATTAVTLSNGSGTLPGTVSEPARSHPATGSQTSE 654

>YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON}
           IMH1Protein involved in vesicular transport, mediates
           transport between an endosomal compartment and the
           Golgi, contains a Golgi-localization (GRIP) domain that
           interacts with activated Arl1p-GTP to localize Imh1p to
           the Golgi
          Length = 911

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 33/163 (20%), Positives = 67/163 (41%), Gaps = 4/163 (2%)
 Frame = +1

Query: 136 KNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETAD 315
           KN T++   +++N E   +    S    H  +   ++      E+  + N +   +E   
Sbjct: 437 KNATMIEAYEAKNTELRSKIELLSKKVEHLKNLCTEKEK----EQTTSQNKVAKLNEEIS 492

Query: 316 SLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSS 495
            L  E  N+ K+     T+            E+ +  +E   V  K+ E L+++ +++S+
Sbjct: 493 QLTYEKSNITKELTSLRTSYKQKEKTVSYLEEQVKQFSEQKDVAEKSTEQLRKDHAKISN 552

Query: 496 A----KKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEK 612
                KKE+   H D     +    Y + +   S++LN+  EK
Sbjct: 553 RLDLLKKENETLHNDIAKNSNSYEEYLKENGKLSERLNILQEK 595

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 36/161 (22%), Positives = 63/161 (39%), Gaps = 4/161 (2%)
 Frame = +1

Query: 106 DSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHN 285
           DS   EQ    ND       ++N+ ++ ++ R  D   +HSS  L+    N        N
Sbjct: 342 DSNESEQRESIND-------NDNDNDLFQKVRSFDELLNHSSQELQNLEDNKNPLFSNIN 394

Query: 286 ALEGNSETADSLKREG----LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLK 453
                S +  S    G    LN+N+  +  I++P+ +   + +   E  L+  T   K K
Sbjct: 395 MTRPQSSSLRSTTPTGVNQFLNMNQTTISRISSPLLSRMMDLSNIVEPTLDVPTSKFKRK 454

Query: 454 TLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSS 576
            L     + +  S++    T    + +S  S +T  S   S
Sbjct: 455 VLTPQLPQMNIPSNSSNFGTPSLTNTNSLLSNITATSTNPS 495

>SAKL0H25344g Chr8 (2209672..2212455) [2784 bp, 927 aa] {ON} similar
           to gnl|GLV|KLLA0F18238g Kluyveromyces lactis
           KLLA0F18238g and weakly similar to YHL023C
           uniprot|P38742 Saccharomyces cerevisiae YHL023C RMD11
           Protein required for sporulation
          Length = 927

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 41/200 (20%), Positives = 76/200 (38%), Gaps = 16/200 (8%)
 Frame = +1

Query: 100 FKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMIT 279
           + DS+A      ++D       ++   +    H HS    HHS +    P     ++   
Sbjct: 62  YSDSKALNSSSARSDINNSVVSNDTHHHRHHYHHHSQHLYHHSDNDSDIPKKTDSDQA-- 119

Query: 280 HNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTL 459
             A E +S ++D     GL+ ++ +        T+S+       E   E E  +    TL
Sbjct: 120 --AYEPDSSSSDGDSTSGLSDSEMSTDYADCSTTSSSSTDENLSEQESEEEP-IRNSTTL 176

Query: 460 ET--------------LKREDSRVSSAK--KEHTNDHADAHSTRSKVTTYSQGSSLESDK 591
            T              L+   S++S+ K  +   N+ +   S  S+ TT   G   + + 
Sbjct: 177 NTVPNSLQSINSSSRGLRNRQSQISANKLFQLLNNEESRRDSVFSRHTTNKDGYLSDENY 236

Query: 592 LNMAVEKNKKKIEQYRKHKS 651
            + ++E+N   +    KHKS
Sbjct: 237 SSSSLEEN-DDLTGTDKHKS 255

>Kpol_1020.35 s1020 complement(75767..78640) [2874 bp, 957 aa] {ON}
           complement(75767..78640) [2874 nt, 958 aa]
          Length = 957

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 42/200 (21%), Positives = 78/200 (39%), Gaps = 3/200 (1%)
 Frame = +1

Query: 19  SVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQH 198
           S+  D  ++D +  S+ DS          D Q+    L  ++ I   +  +N+E+  +  
Sbjct: 406 SLEIDMPFDDDTKLSTQDS--------LNDGQSETNKLDNDEFISQSSLVQNKEDESDSS 457

Query: 199 RHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPV 378
                Y+  SSS  KR  S+  E++ T       S+ ++S  R   N  +    D    +
Sbjct: 458 EKILEYTQKSSSGRKRRLSDDYEELET-----SRSDKSESTGRLHENSGEVKNIDSAVEL 512

Query: 379 TNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTT 558
            NS ++ +  E   +  E G V         R   R + A     +   + H   S +  
Sbjct: 513 INSDNDFSNDEVSDVTIEKGSVVTNKRTDSYRPSKRTNIASNLALDSFINPHFEESTLLN 572

Query: 559 YS---QGSSLESDKLNMAVE 609
            S   Q + +ES+ + + +E
Sbjct: 573 NSQTFQRNDVESEDVLVEIE 592

>CAGL0J03564g Chr10 (340647..343736) [3090 bp, 1029 aa] {ON} similar
            to uniprot|P25365 Saccharomyces cerevisiae YCR067c SED4
            or uniprot|P11655 Saccharomyces cerevisiae YNR026c SEC12
          Length = 1029

 Score = 30.4 bits (67), Expect = 5.0
 Identities = 33/163 (20%), Positives = 70/163 (42%), Gaps = 3/163 (1%)
 Frame = +1

Query: 13   SVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDE 192
            S+  + DNE  D +  ++++            SQ  E+ +  N+ +  ++ S     +  
Sbjct: 727  SIVGSIDNENIDSTELNNLEEAVKTSSNESSLSQVTEELVKNNERVSNQSLS----TVST 782

Query: 193  QHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGN--SETADSLKR-EGLNLNKKALPD 363
            +H         S+ T K+P SNS E  ++ ++L+ +  S+ +D+ +     +     LP 
Sbjct: 783  EHTEM---KESSNLTEKKPESNSPESNLSESSLQTHDFSQISDTERNIVSSSAFVTDLPS 839

Query: 364  ITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVS 492
              A V      G       +++++    +KT+ET   +D + S
Sbjct: 840  EEASVNPGNTEGTIVNASLVDSQSSNSSVKTVETNVSQDEQTS 882

>TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa] {ON}
            Anc_5.162 YJL013C
          Length = 1097

 Score = 30.4 bits (67), Expect = 5.0
 Identities = 46/238 (19%), Positives = 90/238 (37%), Gaps = 36/238 (15%)
 Frame = +1

Query: 28   TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQP---------LLKNDTIVGKAQSENEE 180
            +DN+ +D   +S  +S    PFT   + +  +QP          L++  I+ + +   + 
Sbjct: 663  SDNQAKDSLDYSKSESVFSSPFTTQPEEKVSQQPGRYDQVISESLQDKQILQEIRDLEDN 722

Query: 181  NIDEQHRHSDVYSHHSSSTLKR-------PSSNSIEKMITHNALEGNSETADSLKREGLN 339
            N++      ++ S      L++       PS  S +    ++     S T   +     N
Sbjct: 723  NVNNISDGYNIISDPLDINLRKSLLANINPSLESYQTFFHYDNPLKKSSTLKKIHEASKN 782

Query: 340  LNKKALPDITAP-----VTNSAHNGAFPEEYRLETETGLVK---------------LKTL 459
             NK  + +         +      G F   Y  E+ +G +K               LK L
Sbjct: 783  NNKSPIVEFKKENDWYCIRGELGEGGFATVYLAESSSGCLKALKVEKPHTFWEFYILKQL 842

Query: 460  ETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQ 633
            E    E++ ++S  K  ++ H     +   +   +QG+ L  D LN+  E +K  +E+
Sbjct: 843  EHRLHEENILNSIIKT-SSLHYFQDESYLVLNYVTQGTLL--DLLNLYRENSKASLEE 897

>KLLA0E05787g Chr5 (515081..518767) [3687 bp, 1228 aa] {ON} weakly
            similar to uniprot|P34216 Saccharomyces cerevisiae
            YBL047C EDE1 Key endocytic protein involved in a network
            of interactions with other endocytic proteins binds
            membranes in a ubiquitin-dependent manner may also bind
            ubiquitinated membrane-associated proteins
          Length = 1228

 Score = 30.4 bits (67), Expect = 5.0
 Identities = 33/178 (18%), Positives = 77/178 (43%), Gaps = 7/178 (3%)
 Frame = +1

Query: 157  KAQSENEEN----IDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLK 324
            + +SE +EN    ID+Q   ++      ++ + +  S +++   T   L G   T  +L+
Sbjct: 965  EVESEPKENAVLDIDQQLEDAE------NNDITKQGSETVQPASTDEPLPGGWSTGSTLE 1018

Query: 325  REGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKK 504
            ++ ++ +  A      P+  +       ++   + +   + +  ++ LK ED++VSS  +
Sbjct: 1019 KDQIS-DSDADSIKKTPILET-------QDKVSDAQGAEIDIPAIQDLKLEDTQVSSEDE 1070

Query: 505  EHTNDHADAHSTRSKVTT---YSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKG 669
            +H    + A +  SK  T    +Q   +    L+  V  +   ++ +   +S K   G
Sbjct: 1071 KHEQVESSAKNVSSKPDTPEFVNQFEHITHQDLDENVFHDASSVQPFDSEESAKAPVG 1128

>Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} similar to
            Ashbya gossypii ACR218W
          Length = 1694

 Score = 30.4 bits (67), Expect = 5.1
 Identities = 36/150 (24%), Positives = 57/150 (38%), Gaps = 8/150 (5%)
 Frame = +1

Query: 178  ENIDEQHRHSDVYSH---HSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGL---- 336
            +N  E   H+D   +    S  T K+ +SN      T       +   DSL +E +    
Sbjct: 1266 DNYGEDDLHNDCILNTPTQSFRTDKKQASNHSSGNSTPIPKMSIASVFDSLSQENVSGSS 1325

Query: 337  NLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETL-KREDSRVSSAKKEHT 513
            N + + L  I   +          +   ++TE G    + +  L K     ++  K EH 
Sbjct: 1326 NTSSQTLKHIPLAIPPHLRERRPSKLNDMQTEFGSFSYRNISALDKANKDTINRLKSEHY 1385

Query: 514  NDHADAHSTRSKVTTYSQGSSLESDKLNMA 603
            +DH     TR   ++ S  SS  S KL  A
Sbjct: 1386 SDHI---HTRGSPSSLSSSSSETSTKLKPA 1412

>Kwal_56.23707 s56 complement(670523..671485) [963 bp, 320 aa] {ON}
           YDR124W - Hypothetical ORF [contig 174] FULL
          Length = 320

 Score = 30.0 bits (66), Expect = 5.3
 Identities = 31/135 (22%), Positives = 59/135 (43%), Gaps = 11/135 (8%)
 Frame = +1

Query: 220 HHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNG 399
           H     LK+P    +   I    L  +++T   +K   L  + K+LP ++ P+ + A + 
Sbjct: 138 HREVDHLKKPERIELLAAILGKHLPSSNDTKLLMK---LKQSTKSLPVLSDPIQHHALDD 194

Query: 400 AFPEEYRL----ETETGL-------VKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 546
           A+   + L    E  T L        KL++  T + ++   ++  ++ T   A   S+R 
Sbjct: 195 AYKVCWALCSGKEAVTALDLSYALPPKLESKATFRNKEVWDTNPSEKFTITQAFESSSRP 254

Query: 547 KVTTYSQGSSLESDK 591
              T+S+  S  SD+
Sbjct: 255 SSATFSRSQSYYSDR 269

>NCAS0I02530 Chr9 complement(474132..475124) [993 bp, 330 aa] {ON}
           Anc_3.83 YDR498C
          Length = 330

 Score = 30.0 bits (66), Expect = 5.3
 Identities = 18/76 (23%), Positives = 37/76 (48%)
 Frame = +1

Query: 121 EQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGN 300
           ++ L +++ I    Q E E+  ++  R+  V   H +++ K     +  + +THN + GN
Sbjct: 124 QRELQRDEAIESHVQQEQEQ--EQPDRYERVQFDHGTTSTKDKLLKTTRR-VTHNLVRGN 180

Query: 301 SETADSLKREGLNLNK 348
                 L +  LNL++
Sbjct: 181 QILQSGLLQSDLNLDE 196

>Suva_2.172 Chr2 complement(298817..299410) [594 bp, 197 aa] {ON}
           YDR022C (REAL)
          Length = 197

 Score = 29.6 bits (65), Expect = 5.5
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +1

Query: 529 AHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYR 639
           +HS+  K+    +G S++SDKL M ++   + I Q+R
Sbjct: 129 SHSSDDKLNDDGEGVSIDSDKLGMDLDLELEVISQFR 165

>TPHA0E03370 Chr5 (716679..717857) [1179 bp, 392 aa] {ON} Anc_1.168
           YJL171C
          Length = 392

 Score = 30.0 bits (66), Expect = 5.6
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 512 VCSFLAEETRESSLFKVSSVFNLTNPVSVSKRYSSGNAPLWAEFVTGA 369
           V SFL+  T   S +  S V  L N +S ++ YSS  A + A   T +
Sbjct: 312 VVSFLSSSTTFESTYSASDVIALVNGISTNETYSSQLASISAASTTSS 359

>Suva_11.328 Chr11 complement(597257..598465) [1209 bp, 402 aa] {ON}
           YKR092C (REAL)
          Length = 402

 Score = 30.0 bits (66), Expect = 5.7
 Identities = 35/211 (16%), Positives = 86/211 (40%), Gaps = 9/211 (4%)
 Frame = +1

Query: 28  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS 207
           + ++ +  SS SS  S      +    S++  +   ++DT   +++  + EN+ E  +  
Sbjct: 85  SSSDSDSSSSGSSSSSSSSSSSSSSSSSESSSESEAEDDT-KKRSRESDIENVKETKKAK 143

Query: 208 DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 387
                 SSS+    SS+      + ++ + +S+++ S      + +  +  D  +  ++S
Sbjct: 144 TEPESSSSSSSSSSSSSDSSSSESSSSSDSDSDSSSS-SSSSSSSSSSSSSDSESDSSSS 202

Query: 388 AHNGAFPEEYRLETETGLVKLKTLETLKRE---------DSRVSSAKKEHTNDHADAHST 540
           + + +   E    + +G     +      +         DS  SS+    ++  + + S+
Sbjct: 203 SSDSSSDSESGSSSSSGSSSSSSSSDSSSDSDSDSDSDSDSSSSSSSSSSSSSSSSSSSS 262

Query: 541 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQ 633
            S  ++ S  S  +SD       K++ K E+
Sbjct: 263 SSSESSSSDSSDSDSDSETEKTSKDEAKAEE 293

>SAKL0G07568g Chr7 (630838..631109,631353..632649) [1569 bp, 522 aa]
           {ON} similar to uniprot|Q66RD5 Saccharomyces cerevisiae
           YDR348C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cell
           periphery and bud neck potential Cdc28p substrate
          Length = 522

 Score = 30.0 bits (66), Expect = 6.0
 Identities = 28/103 (27%), Positives = 37/103 (35%), Gaps = 20/103 (19%)
 Frame = +1

Query: 154 GKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREG 333
           G++ S N    D    H+    HHSSS   R S +      T   +  N +T D L   G
Sbjct: 222 GRSSSHNRRERDGAESHA----HHSSSRRHRSSKDKKSSSPTKKVVPKNVDTIDKLDVTG 277

Query: 334 L------------------NLNKKALPDITAPV--TNSAHNGA 402
           L                  N N K  P +  P    NS+ +GA
Sbjct: 278 LFGGAFHHDGPFDACTPHRNKNNKVAPVLAFPADGPNSSISGA 320

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score = 30.0 bits (66), Expect = 6.1
 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 6/92 (6%)
 Frame = +1

Query: 139 NDTIVGKAQSENE---ENIDEQHRHSDVYSHHSSSTLKRPSSNSI---EKMITHNALEGN 300
           N+ +  K  +ENE     ++E+++  ++    S    K+ +       EK     +L GN
Sbjct: 418 NEAVNNKLANENEWYENTLEEKNKLLELQKEKSREAAKKKAREEFKNKEKANAERSLNGN 477

Query: 301 SETADSLKREGLNLNKKALPDITAPVTNSAHN 396
            E  DSL + G   NKK   +     TN   N
Sbjct: 478 KEMKDSLNK-GKTENKKESTEKKQDNTNKNMN 508

>TPHA0F01930 Chr6 complement(435235..437037) [1803 bp, 600 aa] {ON}
           Anc_2.130 YNL136W
          Length = 600

 Score = 30.0 bits (66), Expect = 6.2
 Identities = 43/212 (20%), Positives = 86/212 (40%), Gaps = 5/212 (2%)
 Frame = +1

Query: 37  EYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVY 216
           +Y DI+    I++ K    T   ++    +P++ ND+     +SE E  + +  + S + 
Sbjct: 70  QYYDITEMDKIENNK-WGITYDNENDNIVKPVIANDS--ASTKSEREVILKQDQKESQLP 126

Query: 217 SHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAP-VTNSAH 393
                  L   +  S E  I   + +  ++   +   +  N N+    +IT+  V N   
Sbjct: 127 WDEYGDLLVDNAQESNEVGINKESKDSVNDIEPARSTDVSN-NQNEQSNITSEKVCNDKK 185

Query: 394 NGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHAD----AHSTRSKVTTY 561
                ++  +  ++  ++  T E L  +D  V   KKE+TN  A+         S +   
Sbjct: 186 EDKRIKDKTVSNDSVKLQDDTSEPLGSDDIEVPVVKKENTNKQAEEEKQIEKDESNINKD 245

Query: 562 SQGSSLESDKLNMAVEKNKKKIEQYRKHKSEK 657
            +G+ +E  +   AVE+   + +   K   EK
Sbjct: 246 FEGADIEKIETE-AVEEEVVEEQSEEKEAGEK 276

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 30.0 bits (66), Expect = 6.2
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 6/60 (10%)
 Frame = +2

Query: 530 HIPR------DPRLLRTPKALPWSQTN*IWQ*RKTRKKLNSTENTSQKKESRASFTEFLI 691
           H+P+      +  L++ PK+LPW   +  WQ       L+ ++N  +K E  A    FL+
Sbjct: 87  HLPKLTNVEFEGELIKAPKSLPWYPESLAWQ-------LDVSKNVIRKNEQFAKTQRFLV 139

>Suva_4.522 Chr4 complement(904325..906316) [1992 bp, 663 aa] {ON}
           YBR260C (REAL)
          Length = 663

 Score = 30.0 bits (66), Expect = 6.3
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 10/82 (12%)
 Frame = +1

Query: 247 PSSNSIEKMI--THNA---LEGNSETA-----DSLKREGLNLNKKALPDITAPVTNSAHN 396
           PS NSI K +  THN    L GN+  A      +      N NK+  P +T   T +A  
Sbjct: 344 PSRNSIPKRMISTHNESPFLSGNNNNAATNTNPNATTPSFNTNKQLPPTVTPSSTITAAG 403

Query: 397 GAFPEEYRLETETGLVKLKTLE 462
              P    + +ET     KTL+
Sbjct: 404 AMSPSSSIVTSETTSSMTKTLD 425

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 30.0 bits (66), Expect = 6.3
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +1

Query: 334 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETG 438
           L+LN   LP+  +P TNS  N  F   +RL   +G
Sbjct: 145 LSLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASG 179

>TBLA0B05910 Chr2 complement(1387647..1389725) [2079 bp, 692 aa]
           {ON} Anc_2.282 YNL039W
          Length = 692

 Score = 30.0 bits (66), Expect = 6.3
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 12/113 (10%)
 Frame = +1

Query: 121 EQPLLKNDTIVGKAQSEN-------EENIDEQHRHSDVYSHHSSSTLKRPSSNSI----- 264
           ++PL  ND I G  Q E+       +  ID  ++ ++    H  + L+  + + +     
Sbjct: 64  KEPLNNNDRIDGPTQIEHGNDSGNLKNQIDSNNKSNN---KHFETQLESQAPDDVSFINT 120

Query: 265 EKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRL 423
           + ++ HN L+G ++  D+ K   LN + K +           H G F   ++L
Sbjct: 121 QPVMNHNELDGPTQVNDTSKSASLNNSSKRV---------EVHLGPFQAHHKL 164

>KLTH0D09856g Chr4 complement(815253..817409) [2157 bp, 718 aa] {ON}
           similar to uniprot|P39744 Saccharomyces cerevisiae
           YOR206W NOC2 Protein that forms a nucleolar complex with
           Mak21p that binds to 90S and 66S pre- ribosomes as well
           as a nuclear complex with Noc3p that binds to 66S pre-
           ribosomes both complexes mediate intranuclear transport
           of ribosomal precursors
          Length = 718

 Score = 30.0 bits (66), Expect = 6.3
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +1

Query: 505 EHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHK--SEKGIKGFFH 678
           +HT DH       +K     +G+  E +K N A+ K ++K+    K +   +  ++ FF 
Sbjct: 17  KHTLDHRRKQKHHNKKIQGRRGNKSEEEKRNAALTKEEQKLRDSSKEEVFKDMSVEDFFA 76

Query: 679 RIFD 690
             FD
Sbjct: 77  GGFD 80

>Kpol_1053.30 s1053 (46793..49177) [2385 bp, 794 aa] {ON}
           (46793..49177) [2385 nt, 795 aa]
          Length = 794

 Score = 30.0 bits (66), Expect = 6.4
 Identities = 38/201 (18%), Positives = 83/201 (41%), Gaps = 21/201 (10%)
 Frame = +1

Query: 28  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIV--GKAQS------ENEEN 183
           T++   +I    + D  KP+PFT   D  + EQ   KN  ++  GKA+S      +  E 
Sbjct: 353 TESSVPEIKDDLNTDE-KPQPFTDENDIDSQEQ---KNQEVISLGKAESLPSSPKQEGET 408

Query: 184 IDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPD 363
           + E    +   S +  +++        E +   +  E N +  +  + +  NLN  ++  
Sbjct: 409 MAETVNINVNESDNEKNSMNNQKETKKEDINATDEREENKKEDEKSEEDSSNLNMHSIEV 468

Query: 364 ITAPVTNSAHN--GAFPE-----------EYRLETETGLVKLKTLETLKREDSRVSSAKK 504
               ++ S+++  G++ +           E   +  T +   +  ET+ +E S  S   K
Sbjct: 469 KNEAISKSSNDQFGSYSKDISNDSNNEINERVCDENTNIALTEEKETVVKEVSISSEKIK 528

Query: 505 EHTNDHADAHSTRSKVTTYSQ 567
           E   +     ++ +K  ++++
Sbjct: 529 EEEAEEIGTPTSMTKQVSFAE 549

>Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [2667
           bp, 888 aa] {ON}
           complement(2204..4177,4180..4206,4209..4874) [2667 nt,
           889 aa]
          Length = 888

 Score = 30.0 bits (66), Expect = 6.5
 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 7/96 (7%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDI-----SSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQS 168
           PVPS+ +TTD + + I     S  + +D  K EP       +A   P  + +    KA S
Sbjct: 385 PVPSMLLTTDTDTKPILITGESMATKMDDEKTEPVKSELTERAKSVPKFRFNKRSHKADS 444

Query: 169 ENEENIDEQHR--HSDVYSHHSSSTLKRPSSNSIEK 270
             + N +  +R  + +   H ++  ++    N+I K
Sbjct: 445 STQNNQNGLNRQFYDNKGKHTNAIKIQNKKKNTIIK 480

>Smik_12.107 Chr12 complement(216043..218709) [2667 bp, 888 aa] {ON}
           YLR045C (REAL)
          Length = 888

 Score = 30.0 bits (66), Expect = 6.5
 Identities = 27/135 (20%), Positives = 59/135 (43%), Gaps = 11/135 (8%)
 Frame = +1

Query: 268 KMITHNALEGNSETADSLKREGLNLNKKALPDIT-------APVTNSAHNGAFPEEYRLE 426
           K+   N+     E  DSLKR+ +    K LP+ +       + +  +   G    ++ L+
Sbjct: 531 KIFGMNSFLKTLEHLDSLKRKKIEETVKTLPNFSTVNSGSRSTIEANKQTGPMENKFLLK 590

Query: 427 TETGLVKLKTLETLKREDSRV----SSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKL 594
             + L   +   +  R D++     + +    T     A++ +S+V   S+  +   + +
Sbjct: 591 KGSVLPSKRMASSPLRNDNKSKLSPTGSVASATKPSIVANTNKSRVLLTSKSLTTPKNLV 650

Query: 595 NMAVEKNKKKIEQYR 639
             + +KN+K IE+Y+
Sbjct: 651 ANSGDKNEKLIEEYK 665

>TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4.46
            YLR309C
          Length = 906

 Score = 30.0 bits (66), Expect = 6.5
 Identities = 40/181 (22%), Positives = 79/181 (43%), Gaps = 8/181 (4%)
 Frame = +1

Query: 136  KNDTIVGKAQS---ENEENIDEQHRHSDVYSHHSSSTLKRPSSNSI--EKMITHNALEGN 300
            +N+ ++ + +S   ENEE   +  ++S  + ++     K     +I  EK  T   L+ N
Sbjct: 546  ENEQLLERLESLRKENEELRSDVKKNSSSFENYLRENGKLSERIAILQEKYETLQNLKSN 605

Query: 301  S-ETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRE 477
            S E  DS+KR+   LN K            ++      E  +   + L++ KT     RE
Sbjct: 606  SSEQVDSIKRQCEELNVK---------LKESNKKIISLEEEINDYSNLLQEKT-----RE 651

Query: 478  DSRVSSAKKEHTNDHADAHSTRSKVTTY--SQGSSLESDKLNMAVEKNKKKIEQYRKHKS 651
             + +     E++ND     S   +   Y   + ++LES+ L +   +  ++I+ ++   +
Sbjct: 652  ANTMRRLLTENSNDETTKESALQQKLEYLVDEKANLESE-LTVQASRKAREIQDWKLANN 710

Query: 652  E 654
            E
Sbjct: 711  E 711

>KNAG0H01300 Chr8 (230236..233178) [2943 bp, 980 aa] {ON} Anc_3.258
            YBR050C
          Length = 980

 Score = 30.0 bits (66), Expect = 6.5
 Identities = 34/148 (22%), Positives = 55/148 (37%), Gaps = 11/148 (7%)
 Frame = +1

Query: 103  KDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHS--SSTLKRP--------- 249
            K S    + L  N      ++ E+EE  +E +   +++   S  S TLK P         
Sbjct: 835  KRSSGSRRGLTSNFIFNSDSEEEDEEAAEELNEDENLHGDLSLESLTLKTPKRKLGPPQR 894

Query: 250  SSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLET 429
            SS+S+   + H+   G    + S   + L L   +         + A NG FP   R ++
Sbjct: 895  SSSSLLSTLAHSKSAGEDRRSSSDLNKSLGLPNSSSSAAAIAPNDIAINGVFPP--RNDS 952

Query: 430  ETGLVKLKTLETLKREDSRVSSAKKEHT 513
               +   + L     E S    A K  T
Sbjct: 953  LKSIASKEKLINANSEGSHSDRAFKNKT 980

>NDAI0I01810 Chr9 (430179..431006) [828 bp, 275 aa] {ON} Anc_6.94
          Length = 275

 Score = 29.6 bits (65), Expect = 6.6
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = +1

Query: 136 KNDTIVGK-AQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETA 312
           +N+  +   AQS +  +I E  R   ++SHH+S T   P ++   +    + L  NS  +
Sbjct: 176 RNEVFINNYAQSNSSSSIIEPPRMLSIWSHHNSGTF--PKTSIYHEDSKTSIL--NSTIS 231

Query: 313 DSLKREGLNLNKKALPDITA--PVTNSAHNG 399
            S KR  + ++  + P I A    T+  HNG
Sbjct: 232 SSRKR--IMMHSHSRPSIPAANASTSGGHNG 260

>TPHA0C01560 Chr3 complement(356865..360320) [3456 bp, 1151 aa] {ON}
           Anc_7.163 YER013W
          Length = 1151

 Score = 30.0 bits (66), Expect = 6.6
 Identities = 36/150 (24%), Positives = 56/150 (37%), Gaps = 9/150 (6%)
 Frame = +1

Query: 238 LKRPSSNSIEKMITH---NALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFP 408
           LK P SN+IE  ITH     L  N  T   +K       K+   DI         NG   
Sbjct: 147 LKEPKSNTIENNITHIKWGDLSKNKNTVSEVKFNPFLSKKQQPQDIKV-------NGILK 199

Query: 409 EEYRLETETG-LVKLKTLETLKRED----SRVSSAKKEHTNDHA-DAHSTRSKVTTYSQG 570
              R  T  G  + +KT ++  ++     S +S+ K    ND          K+ T  + 
Sbjct: 200 GRVRKITSFGCFINIKTSQSENKDGLLHISEMSNEKIGTPNDLVKTGDMVWVKIITIHEN 259

Query: 571 SSLESDKLNMAVEKNKKKIEQYRKHKSEKG 660
             +     N+  +  K+ I +    + E+G
Sbjct: 260 GKISLSMKNIDQQSGKEIINEANIGQDERG 289

>TDEL0E01540 Chr5 complement(301613..305551) [3939 bp, 1312 aa] {ON}
           Anc_4.219 YLR371W
          Length = 1312

 Score = 30.0 bits (66), Expect = 6.7
 Identities = 33/145 (22%), Positives = 57/145 (39%), Gaps = 16/145 (11%)
 Frame = +1

Query: 4   PVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVG----KAQSE 171
           P+P    +TD E    SS SS  + +  P     D      P L   +I G     + S 
Sbjct: 133 PIPLTQPSTDEESPPTSSDSSQSTIRDAPHRSQSDFIPRRTPSLPQLSIPGLRKQSSFST 192

Query: 172 NEENIDEQHRHSDV-----YSHHSSSTL--KRPSSNSIEKMITHNALEGNSETAD----- 315
           + +N   Q + S +     +S H+S  +    PS +   + I       +S T D     
Sbjct: 193 SNDNTPTQSKRSPLQGFGFFSRHNSKEIHEHHPSIHPQHQHIQQQQHYHSSHTPDQPSGP 252

Query: 316 SLKREGLNLNKKALPDITAPVTNSA 390
            L    ++LN  AL ++ + + + +
Sbjct: 253 GLTSRSMSLNSSALKNLASSMQSKS 277

>Smik_4.743 Chr4 (1310183..1314508) [4326 bp, 1441 aa] {ON} YDR464W
           (REAL)
          Length = 1441

 Score = 30.0 bits (66), Expect = 6.7
 Identities = 35/155 (22%), Positives = 59/155 (38%), Gaps = 4/155 (2%)
 Frame = +1

Query: 229 SSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFP 408
           S  L   + + IEK   H +L  + + A +  R+    +KKA  D+++            
Sbjct: 523 SDLLPHDNLSGIEKKSVHKSLSKSEKKASASSRKA---SKKASKDVSS------------ 567

Query: 409 EEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESD 588
                  E   V  K  +  K E S     +K++ +   +A S   K          E +
Sbjct: 568 ------MEKAKVTPKLKKPSKSEISLEKKLRKKYISVANEAASVARKKRWAKNKELKERE 621

Query: 589 KLNMAV----EKNKKKIEQYRKHKSEKGIKGFFHR 681
           KL         KN+KKIE+ R  + ++ +K    R
Sbjct: 622 KLERQAAREERKNRKKIEKQRLAEEQEELKRIVER 656

>Kwal_23.4326 s23 complement(669535..670419) [885 bp, 294 aa] {ON}
           YHR187W (IKI1) - involved in sensitivity to pGKL killer
           toxin [contig 1] FULL
          Length = 294

 Score = 29.6 bits (65), Expect = 6.8
 Identities = 29/110 (26%), Positives = 46/110 (41%)
 Frame = +1

Query: 247 PSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLE 426
           PSS  + + +  + LE    TAD+   E L+   +AL   T P   ++H   F   +   
Sbjct: 144 PSSLQLLQFMATSILECQPLTADAAAEEELDSQIRAL---TIPRGLNSH--IFKLIFTNR 198

Query: 427 TETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSS 576
            ++G       +   R  S      K  T D ADA  T   +TT++  +S
Sbjct: 199 RKSGRALTHAFQFDSRTHSYTVLPDKNETGDDADASDTFEGLTTFNLSTS 248

>TPHA0H01410 Chr8 complement(316871..317854) [984 bp, 327 aa] {ON}
           Anc_5.694 YKR092C
          Length = 327

 Score = 29.6 bits (65), Expect = 7.1
 Identities = 38/213 (17%), Positives = 79/213 (37%)
 Frame = +1

Query: 19  SVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQH 198
           S ++ +     SS SS  S      +    S +       + +    + S +  + D   
Sbjct: 23  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSDSDS 82

Query: 199 RHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPV 378
             S   S  SSS+    SSNS +   + ++   +S ++DS      + +  +  D ++  
Sbjct: 83  SSSSSSSSSSSSSSSSSSSNSSDSSSSDSS---SSSSSDSTSDSSSSSSSDSDSDSSSSS 139

Query: 379 TNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTT 558
           ++S+ + +   +                     DS  SS+    ++  + + S+ S  + 
Sbjct: 140 SSSSGSSSSSSD--------------------SDSDSSSSSSSSSSSSSSSSSSDSSGSD 179

Query: 559 YSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEK 657
               SS  S+  N   +  K+ IE     +S+K
Sbjct: 180 SDSSSSSSSESENEDKDSKKRAIEDETTKESDK 212

>Kpol_1039.6 s1039 complement(13298..14509) [1212 bp, 403 aa] {ON}
           complement(13298..14509) [1212 nt, 404 aa]
          Length = 403

 Score = 29.6 bits (65), Expect = 7.5
 Identities = 14/58 (24%), Positives = 28/58 (48%)
 Frame = +1

Query: 121 EQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE 294
           E PL    T      S +  ++  Q  ++ +YS+ +++     S+N++    TH+ LE
Sbjct: 16  EDPLSPTTTNTNNYTSSSPLSLSRQQSNTSIYSNMNNNNANAASNNNLVNSTTHHNLE 73

>YNL136W Chr14 (370368..371645) [1278 bp, 425 aa] {ON}  EAF7Subunit
           of the NuA4 histone acetyltransferase complex, which
           acetylates the N-terminal tails of histones H4 and H2A
          Length = 425

 Score = 29.6 bits (65), Expect = 7.6
 Identities = 26/107 (24%), Positives = 49/107 (45%)
 Frame = +1

Query: 31  DNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSD 210
           D E E+I   ++ D  + E        +  ++P + ++  V K ++ENEE  DE+ + S 
Sbjct: 257 DEEKEEIEEDNTKDEEQKEK------KEEIQEPKITHNEEVDKEKNENEEGDDEREK-ST 309

Query: 211 VYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKK 351
            Y + + S  +       E++   +  E   +    ++ EG NL KK
Sbjct: 310 SYENTNGSESEGVDEGVDEELGYESEREAEGK-GKQIESEGGNLKKK 355

>Skud_13.292 Chr13 complement(508550..509176) [627 bp, 208 aa] {ON}
           YMR132C (REAL)
          Length = 208

 Score = 29.3 bits (64), Expect = 7.7
 Identities = 41/195 (21%), Positives = 85/195 (43%), Gaps = 9/195 (4%)
 Frame = +1

Query: 118 PEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHS---SSTLKRPSSNSIEKMITHNA 288
           P +  + +  + GK + EN+  I   ++  +    H+   SS       +S EK I    
Sbjct: 9   PTEYSISHQIVTGKDKFENDLLIKWSYKELNYVWFHADKFSSGHIYLKLHSNEKTIDDVP 68

Query: 289 LEGNSETADSLKREGLNLNKKALPDITAPVT--NSAHNGAFPEEYRLETETGLVKLKTLE 462
            E  ++     K E +  NK  +P  T  +T  ++     + E   +  ++ L + + +E
Sbjct: 69  QEVINDCLQLCKSESIQGNK--MPQCTILITPWHNLRKNKYMEPGEVSFKS-LRQCRKME 125

Query: 463 TLKREDSRVSSAKKEHTN--DHADAHSTRSKVTTYSQG--SSLESDKLNMAVEKNKKKIE 630
              R++  ++   K      D+ +A    +K T   +   + +ES++LN+  E+N++K+ 
Sbjct: 126 CGGRDNKILNRLAKTRVELFDNVEATLNEAKKTKNGEFFVNHIESNRLNLIDEENQRKLA 185

Query: 631 QYRKHKSEKGIKGFF 675
           +  + K  K  K  F
Sbjct: 186 KKNQKKKNKQQKDEF 200

>KLLA0F16280g Chr6 complement(1508963..1510381) [1419 bp, 472 aa]
           {ON} similar to uniprot|O00021 Saccharomyces cerevisiae
           YOR056C NOB1 Nin1 (One) Binding protein essential
           nuclear protein involved in proteasome maturation and
           synthesis of 40S ribosome subunits required for cleavage
           of the 20S pre- rRNA to generate the mature 18S rRNA.
          Length = 472

 Score = 29.6 bits (65), Expect = 7.8
 Identities = 27/82 (32%), Positives = 34/82 (41%), Gaps = 1/82 (1%)
 Frame = +1

Query: 415 YRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTT-YSQGSSLESDK 591
           Y LETE           L + D R+     E    H     TR K T   +Q  + ESD 
Sbjct: 99  YELETE-----------LNKGDWRLRKRPGEALK-HETKEETRPKETIEQTQDPTAESDT 146

Query: 592 LNMAVEKNKKKIEQYRKHKSEK 657
               V+KNKKK  +  K + EK
Sbjct: 147 AETPVKKNKKKTRRGGKKQREK 168

>Kpol_1076.9 s1076 complement(18964..20514) [1551 bp, 516 aa] {ON}
           complement(18964..20514) [1551 nt, 517 aa]
          Length = 516

 Score = 29.6 bits (65), Expect = 8.0
 Identities = 36/163 (22%), Positives = 68/163 (41%), Gaps = 7/163 (4%)
 Frame = +1

Query: 109 SQAPEQPLLKNDTIVGKAQSENEEN-------IDEQHRHSDVYSHHSSSTLKRPSSNSIE 267
           S A +Q   K D ++   Q +  +        +++Q RH+++     SSTL   S+ SI 
Sbjct: 29  SGALDQHFKKYDLVISTQQQQIVDLNAVISTLLNDQFRHTEITREKLSSTLHGISATSIS 88

Query: 268 KMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVK 447
              T N  E    +  S+K    N++ +    I+ P  N + N + P++    T   +++
Sbjct: 89  VANTINT-EHRVPSYSSMK----NVSNQNSISISKP-NNESINNSNPDQ---RTNLHILQ 139

Query: 448 LKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSS 576
                T     + +SS+    T      ++T     T S G++
Sbjct: 140 SLPTRTTTARTTTISSSSSSSTVPTTGLNTTAPTTITSSNGTA 182

>Kpol_331.2 s331 complement(3808..4614,5119..5967) [1656 bp, 551 aa]
           {ON} complement(3808..4614,5119..5967) [1656 nt, 552 aa]
          Length = 551

 Score = 29.6 bits (65), Expect = 8.1
 Identities = 38/163 (23%), Positives = 67/163 (41%), Gaps = 16/163 (9%)
 Frame = +1

Query: 148 IVGKAQSENEENI----DEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETAD 315
           IV  +  ++EE+I      +  H      +    LKR     +E+    +     +E  +
Sbjct: 383 IVPPSSKDSEEDILFRGVVRVEHVTCPEQYIPGVLKRCQVKHLERTYEISGWNDATEFLE 442

Query: 316 SLKREGLNLNKKALPD---ITAPVTNSAHNGAFP------EEYRLETETGLVKLKTLETL 468
            L R+   L K   PD   I   + N  + G  P      E+   E E+   +    E+ 
Sbjct: 443 ILARKQGRLLKGGEPDESGIAKQILNDFNRGKIPWFTQPPEKESSEKESTEKESSKKESS 502

Query: 469 KREDSRVSSAKKEHT-NDHADAHSTR--SKVTTYSQGSSLESD 588
           K+E S+  S++KE +  + ++  ST   SK+    + S +E D
Sbjct: 503 KKESSKKESSEKESSEKESSEKESTEKDSKIGDKRKSSHIEED 545

>TBLA0E02640 Chr5 (668887..670974) [2088 bp, 695 aa] {ON} Anc_3.148
           YOL070C
          Length = 695

 Score = 29.6 bits (65), Expect = 8.4
 Identities = 33/161 (20%), Positives = 66/161 (40%), Gaps = 4/161 (2%)
 Frame = +1

Query: 160 AQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLN 339
           A S+    ++E+   S ++  H + +     ++S    I     E  + ++   K +   
Sbjct: 66  AVSKYSGEVEERANVSYIFKQHQNDSGSNDQNSSNRNSIETRVFEARASSSTINKTDCAP 125

Query: 340 L--NKKALPDITAPVTNSAHNGAFPEEYR-LETETGLVKLKTLETLKREDSRVSSAKKEH 510
              +    P  T+  T++ +  +F  E    E       +K LET    +S  + A  EH
Sbjct: 126 ALPSLPKFPTRTSLATDAGNRNSFRREVEESERLDNTNTIKELETASENES-FTVANAEH 184

Query: 511 TNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNK-KKIE 630
            + H  A  +R    +  + S ++ +K+N   +  K +KIE
Sbjct: 185 GSHHQYAILSRPSNESLVETSEIKKEKVNTYKDTGKEQKIE 225

>CAGL0G04125g Chr7 (393879..396170) [2292 bp, 763 aa] {ON} weakly
           similar to uniprot|P20840 Saccharomyces cerevisiae
           YJR004c SAG1 alpha-agglutinin
          Length = 763

 Score = 29.6 bits (65), Expect = 8.5
 Identities = 25/123 (20%), Positives = 51/123 (41%)
 Frame = +1

Query: 217 SHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHN 396
           S  SSS+   PSS+S     T ++   +S ++ S     +++   +    ++  ++S+ +
Sbjct: 395 SSSSSSSSSSPSSSSSSSSSTSSSSSSSSSSSTSSSTSSISITSSS----SSSSSSSSSS 450

Query: 397 GAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSS 576
            +        T T  +   +  T     S  SS+    T+  +   S+ S  ++ S  SS
Sbjct: 451 SSSSSSSSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSSSS 510

Query: 577 LES 585
             S
Sbjct: 511 SSS 513

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
            YPL141C
          Length = 788

 Score = 29.6 bits (65), Expect = 8.5
 Identities = 39/149 (26%), Positives = 58/149 (38%), Gaps = 3/149 (2%)
 Frame = +1

Query: 49   ISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHS 228
            +S +SS  S K   F G  +S       +KN + +  +Q    EN   Q RHS       
Sbjct: 654  LSFYSSYSSSKSSLFVGNNNSSTNATSKIKNTSRITSSQ----ENKSTQSRHS------- 702

Query: 229  SSTLKRPSSNSIE-KMITHNALEGNSETADSLKREGL--NLNKKALPDITAPVTNSAHNG 399
            SS +  PSS     +M T N    N     +++   +  +L++K   D T+       NG
Sbjct: 703  SSYVTAPSSRQPSFQMATENVNINNENRRPTVRSSMMVGSLSQKNTSD-TSEHEVQQENG 761

Query: 400  AFPEEYRLETETGLVKLKTLETLKREDSR 486
              P     E  T     K ++  KR   R
Sbjct: 762  QLPPIREREPSTA---RKVIDFFKRRSLR 787

>TBLA0B05200 Chr2 complement(1221706..1224144) [2439 bp, 812 aa]
           {ON} Anc_6.184 YPL186C
          Length = 812

 Score = 29.6 bits (65), Expect = 8.5
 Identities = 39/188 (20%), Positives = 71/188 (37%), Gaps = 6/188 (3%)
 Frame = +1

Query: 109 SQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNA 288
           SQ  +  +  N +++     ++++ I +    +++ +  +++    P    IE+    N 
Sbjct: 141 SQRDDSNVEWNSSLLSSKDGQSDDKILDVANTNNINNKATTTKEIEPKKGDIEESTNENE 200

Query: 289 LEG--NSETADSLKREGLNLNKKALP---DITAPVTNSAHNGAFPE-EYRLETETGLVKL 450
            +    SE   + K+E   LNKK L    D        A      E E +LE E  L   
Sbjct: 201 KKDALGSEQKGNQKKE---LNKKELKKKKDTEEQKRKEAEQKRILELEQKLEEEAEL--- 254

Query: 451 KTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIE 630
                  R    V   KK+   +     + + ++    Q    ES+       + KKK E
Sbjct: 255 -------RRQQEVELKKKQEEEEKKRQEAEQKRLMEIEQKVKEESELKKKKELELKKKQE 307

Query: 631 QYRKHKSE 654
           +  KH+ E
Sbjct: 308 EEEKHRQE 315

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 29.6 bits (65), Expect = 8.6
 Identities = 53/249 (21%), Positives = 89/249 (35%), Gaps = 27/249 (10%)
 Frame = +1

Query: 19  SVTTDNEYEDISSFSSIDSY--------KPEPFTGFKDSQAPEQPLLKN--DTIVGKAQ- 165
           ++  +  Y+D ++ +S ++         K   F GF   Q P +    N  DT V   Q 
Sbjct: 264 NINNNETYQDYNNLNSKNTTNNNNNNNNKRNSFMGF---QVPSKQQYNNNKDTTVNNKQD 320

Query: 166 ---SENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETAD------S 318
              + N  N    +  S  Y+   SS L   +SNS   M       GN  T D      +
Sbjct: 321 GNNNNNNNNNSTNNAKSQSYTAKMSSLLGAATSNSNPNMENGKDKNGNVNTQDDGIIHAT 380

Query: 319 LKREGLNLNK--KALPDI-TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRV 489
           L    +   K      DI    + N+ +N  F ++ +      L   K  E+     S+ 
Sbjct: 381 LMSSDVTTEKLHSGCQDILVGRINNNNNNNRFTKQQKPNIIDELSNSK--ESYTPIFSKT 438

Query: 490 SSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDK----LNMAVEKNKKKIEQYRKHKSEK 657
           ++    + N++   +   + + T  Q  + E  K    +N  V      + QY K     
Sbjct: 439 NNNNNNNNNNNIPHNIPSNNIVTPVQKPTSEQRKKAALINGPVLNVDHLLNQYEKANLYN 498

Query: 658 GIKGFFHRI 684
            +K  F  I
Sbjct: 499 SLKDIFESI 507

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score = 29.6 bits (65), Expect = 8.6
 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 3/81 (3%)
 Frame = +1

Query: 28  TDNEYEDISSFSSIDSYKPEPFTGFKDSQA---PEQPLLKNDTIVGKAQSENEENIDEQH 198
           T +  ED++   ++DS +    +  + + A   P  PLL    +     S+  +++    
Sbjct: 101 TTSSQEDLNKLQAVDSSRKNTLSSIESNSASSKPAPPLLNPTNVSADDSSQLRDHLAGLT 160

Query: 199 RHSDVYSHHSSSTLKRPSSNS 261
            HS+  S + S+ + R S +S
Sbjct: 161 IHSEGLSRNVSNAVSRSSYDS 181

>Kpol_1071.13 s1071 (30311..31132) [822 bp, 273 aa] {ON}
           (30311..31132) [822 nt, 274 aa]
          Length = 273

 Score = 29.3 bits (64), Expect = 8.8
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +1

Query: 454 TLETLKREDSRVSSAKKEHTNDHADAHS-TRSKVTTYSQGSSLESDKLNMAVEKNK 618
           T  +    +S  +S    H+N H+++HS  + K +++ +GSSL S   ++A ++ K
Sbjct: 16  TSSSNSNSNSHSNSHSNSHSNSHSNSHSDLKKKRSSFHRGSSLRS-STDLASQRRK 70

>KNAG0C00700 Chr3 complement(119584..123222) [3639 bp, 1212 aa] {ON}
           Anc_1.69 YLR189C
          Length = 1212

 Score = 29.6 bits (65), Expect = 8.8
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 6/46 (13%)
 Frame = +1

Query: 223 HSSSTLKRPSSNSIEKMITHNALEGNSETA------DSLKREGLNL 342
           H S TL    +++ ++M+T+N +E N+E+A      D    +GLN+
Sbjct: 671 HGSPTLNSNGADNNQQMLTNNFIESNAESAKLKFFEDKFVGKGLNI 716

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 29.6 bits (65), Expect = 8.9
 Identities = 14/44 (31%), Positives = 26/44 (59%)
 Frame = -3

Query: 424 LNDILLEMHRCGLSLSLEQ*CREELSCSGSTLPSLENLPSLNFP 293
           L ++L      GL+L+L+    + LS + +T+PS +N+  + FP
Sbjct: 175 LENLLTTARENGLNLNLDLLLPQSLSVATTTIPSTDNIDPIPFP 218

>Skud_14.198 Chr14 complement(364246..364770) [525 bp, 174 aa] {ON}
           YNL133C (REAL)
          Length = 174

 Score = 28.9 bits (63), Expect = 9.0
 Identities = 37/163 (22%), Positives = 63/163 (38%), Gaps = 4/163 (2%)
 Frame = +1

Query: 157 KAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGL 336
           K  SE   NI+ Q     V      S  KR +  S+   +  NA+    +        GL
Sbjct: 19  KFVSEGVSNIETQKIREQVEQKKYESEYKRKTRKSLRDQLRSNAISKQKQ------YNGL 72

Query: 337 NLNKKALPDITAPVTNSAHNGAFPEEYRLETETG---LVKLKTLETLKREDSRVSSAKKE 507
             ++++   ++       HN    E  + E E       K  + E  K+   R +SA   
Sbjct: 73  VRDRESFTRLSKDELEFYHNSK-SESMKKEEELNNYLNAKATSFERKKKVLFRDNSAVAT 131

Query: 508 HTNDHADAHSTRS-KVTTYSQGSSLESDKLNMAVEKNKKKIEQ 633
            T  + +A +  S K+       S    KL ++++K  KK+E+
Sbjct: 132 STQGNPEARTGLSDKMQIRGIKPSTTKPKLKISLKKLNKKLEK 174

>Kpol_1024.29 s1024 (83563..89553) [5991 bp, 1996 aa] {ON}
           (83563..89553) [5991 nt, 1997 aa]
          Length = 1996

 Score = 29.6 bits (65), Expect = 9.1
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 217 SHHSSSTLKRPSSNSIEKMITHNALEG-NSETADSLKREGLNLNKKALPDITAPVTNSAH 393
           SH++ S L+     SI  + T   L+G +SE + +++   L LN++   + T  VT S  
Sbjct: 169 SHNTESILENDKQTSINDLETVETLDGGDSEESKAIRSTTLILNEEDTNETTG-VTESVE 227

Query: 394 NGAFPEEYRLETE 432
            G     Y+   E
Sbjct: 228 KGTVDVSYQTINE 240

>TBLA0A09870 Chr1 (2426725..2427906) [1182 bp, 393 aa] {ON} 
          Length = 393

 Score = 29.3 bits (64), Expect = 10.0
 Identities = 25/132 (18%), Positives = 56/132 (42%), Gaps = 6/132 (4%)
 Frame = +1

Query: 133 LKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEK------MITHNALE 294
           L +D+ +  +   N E+  +Q   S  +    S+  +R   N  E+      +   N + 
Sbjct: 261 LDDDSQISSSSILNNESKKQQDNTSITFPTSKSNGKRRLDENITEQREKKQMLNETNLIS 320

Query: 295 GNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKR 474
           GN    DS+  E +NL+     ++     +            L ++    + +++E L++
Sbjct: 321 GNHSNYDSIPHEVINLSDDDYEEVN--FNDKKLKSESTNNQSLLSDLDQDQTQSIEDLEK 378

Query: 475 EDSRVSSAKKEH 510
           E ++++S  +EH
Sbjct: 379 EYNKLASEVEEH 390

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.124    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,015,981
Number of extensions: 1471244
Number of successful extensions: 6630
Number of sequences better than 10.0: 247
Number of HSP's gapped: 6563
Number of HSP's successfully gapped: 250
Length of query: 231
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 125
Effective length of database: 41,326,803
Effective search space: 5165850375
Effective search space used: 5165850375
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.2 bits)
S2: 32 (16.9 bits)