Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4373.486ON23023012071e-170
YGR126W3.486ON2302309441e-130
Suva_7.4143.486ON2302309371e-129
Smik_6.2223.486ON2302309251e-127
NCAS0E008503.486ON2302285251e-66
CAGL0I10604g3.486ON2112235066e-64
KNAG0B008503.486ON2252324303e-52
NDAI0G009803.486ON2342294234e-51
TDEL0D055403.486ON2162264146e-50
KAFR0C019203.486ON2232404024e-48
KLTH0F14696g3.486ON2191643538e-41
SAKL0F02904g3.486ON2221603512e-40
Kwal_55.212153.486ON1421443191e-36
TPHA0D032503.486ON2192272352e-23
KLLA0E04709g3.486ON1661672287e-23
Kpol_1017.103.486ON2342372268e-22
KLLA0E03829g3.503ON609831519e-11
KLTH0G02266g3.503ON644771402e-09
Skud_16.4503.503ON6221451375e-09
Smik_16.4083.503ON6221131351e-08
KAFR0C020303.503ON624721341e-08
AFR322C3.503ON592631322e-08
Kwal_47.189193.503ON640641304e-08
YPR156C (TPO3)3.503ON6221211296e-08
TBLA0D029003.503ON6911401271e-07
YGR138C (TPO2)3.503ON614831271e-07
Smik_6.2333.503ON614831261e-07
Skud_7.4483.503ON611831261e-07
CAGL0I10384g3.503ON630671252e-07
Suva_7.4253.503ON613831234e-07
NCAS0F036203.503ON634641208e-07
Suva_16.4843.503ON6221211182e-06
NDAI0I027703.503ON626641182e-06
ZYRO0G19646g3.503ON594821182e-06
KNAG0B007303.503ON622841172e-06
SAKL0F02442g3.503ON610721163e-06
TDEL0D057103.503ON616671163e-06
NCAS0E007503.503ON620641163e-06
TPHA0D033103.503ON613781145e-06
Kpol_1017.33.503ON621971111e-05
Ecym_11474.335ON422139692.0
Suva_4.4706.104ON66335692.2
YBR212W (NGR1)6.104ON67236682.8
Smik_2.3556.104ON73636683.0
Skud_2.3456.104ON66436665.8
Suva_2.1723.250ON19737647.2
TBLA0B045908.543ON151851649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.437
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   469   e-170
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   368   e-130
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   365   e-129
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   360   e-127
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   206   1e-66
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   199   6e-64
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   170   3e-52
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   167   4e-51
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   164   6e-50
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   159   4e-48
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   140   8e-41
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   139   2e-40
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   127   1e-36
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    95   2e-23
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    92   7e-23
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    92   8e-22
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    63   9e-11
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    59   2e-09
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    57   5e-09
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    57   1e-08
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    56   1e-08
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    55   2e-08
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    55   4e-08
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    54   6e-08
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    54   1e-07
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    54   1e-07
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    53   1e-07
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    53   1e-07
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    53   2e-07
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    52   4e-07
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    51   8e-07
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    50   2e-06
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     50   2e-06
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    50   2e-06
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    50   2e-06
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    49   3e-06
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    49   3e-06
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               49   3e-06
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    49   5e-06
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    47   1e-05
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    31   2.0  
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    31   2.2  
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    31   2.8  
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    31   3.0  
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    30   5.8  
Suva_2.172 Chr2 complement(298817..299410) [594 bp, 197 aa] {ON}...    29   7.2  
TBLA0B04590 Chr2 (1061040..1065596) [4557 bp, 1518 aa] {ON} Anc_...    29   9.6  

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  469 bits (1207), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 230/230 (100%), Positives = 230/230 (100%)

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 60
           MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE
Sbjct: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 60

Query: 61  NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 120
           NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP
Sbjct: 61  NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 120

Query: 121 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 180
           DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST
Sbjct: 121 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 180

Query: 181 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
           RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  368 bits (944), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 202/230 (87%), Positives = 218/230 (94%)

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 60
           MPVPSV+VTTDNEYEDISSFSSIDSYKPEPFTGFKDS+APEQPLLKNDTIVGK Q E++ 
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60

Query: 61  NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 120
           N+D+QHRHSDV+SHHSSSTLKRP+SNSIEKM+THNALEGNSET DSLK +GLNLNKKALP
Sbjct: 61  NVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120

Query: 121 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 180
           DITAPVTNSAH+ AFPEEYRLETETGLVKLKTLE+LKREDSRVSS KKEH NDH D HST
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180

Query: 181 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
           RSKVTT SQGSSLE +KLNMAVEKNKK+IE+Y+KHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  365 bits (937), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 199/230 (86%), Positives = 217/230 (94%)

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 60
           M VP+VSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGK QSEN++
Sbjct: 1   MAVPTVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKGQSENDD 60

Query: 61  NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 120
           ++D+QHRHSDV+SHHSSSTLKRP+SNSIEKM+THNALEGNSET DSLK+EGLNLNKK  P
Sbjct: 61  SVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTP 120

Query: 121 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 180
           DITAPVTNSAH+ AFPEEYRLETETGLVKLKTLETLKREDSRVS AKK+H +DH DAHST
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHST 180

Query: 181 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
           RSK T YSQGSSLESDKLN+AVEKNKK+IE+Y+KHK EKGIKG FHR+FD
Sbjct: 181 RSKATAYSQGSSLESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  360 bits (925), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 199/230 (86%), Positives = 214/230 (93%)

Query: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 60
           MPVPSV+VTTDNEYEDISSFSSIDSYKPEPFTGFKDSQ P+QPL+KNDTIVGK QSEN++
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60

Query: 61  NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 120
            +D+QHRHSDV+SHHSSSTLKRP+SNSIEKM+T NALEG SET DSLK +GLNL KKALP
Sbjct: 61  ILDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120

Query: 121 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 180
           DITAPVTNSAH+  FPEEYRLETETGLVKLKTLETL+REDSRVSS KKEH NDH D HST
Sbjct: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180

Query: 181 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
           RSKVTT SQGSSLE +KLNMAVEKNKKKIEQY+KHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  206 bits (525), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 159/228 (69%), Gaps = 8/228 (3%)

Query: 7   SVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENID--- 63
           + +T++++ED+SSFSSIDSY+PEPFTG K+  A  +   + DT+ G      +E+ +   
Sbjct: 7   TTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTA-YKGTDRKDTLSGDETELKQEHTNATA 65

Query: 64  -EQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 122
              H    + S  S STL+RP SN+IE++IT NA EGN+ET  SL  +GL+LNKKA  DI
Sbjct: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDI 125

Query: 123 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 182
            AP+T++  + AFPEEY LETETGLVK KT+ETL+RE SRVSS ++    D   +H +++
Sbjct: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRR---GDDVVSHKSQA 182

Query: 183 KVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
              +     SL+++KLN+AVEKNKK++E+  KHK +KG+KGF +R+FD
Sbjct: 183 TGKSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  199 bits (506), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 151/223 (67%), Gaps = 23/223 (10%)

Query: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS 69
           TD E EDISSFSS+DSYKPEPFTG + +        KN+ +  KA      N  +     
Sbjct: 10  TDYEVEDISSFSSVDSYKPEPFTGLEHT--------KNENLSRKAT-----NASQGTYMD 56

Query: 70  DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 129
           D  S HS +TLK+  S +IEK++T NA+ GNSET +SLK +GL++ +KA+PD  AP+T +
Sbjct: 57  DATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTT 116

Query: 130 AHNGAFPEEYRLETETGLVKLKTLETLKREDSRVS--SAKKEHTNDHADAHSTRSKVTTY 187
             N  FPEEYRLET+TGLVK+KTLETLKR+ ++VS  S         + + S +S+V+  
Sbjct: 117 GTN-QFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNSDLSSKDKSISKSQSNKSEVSDI 175

Query: 188 SQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
           +Q       K+NMAVE+NKK+I +Y+KHKSEKGIKGFFHR+FD
Sbjct: 176 AQ-------KINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  170 bits (430), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 154/232 (66%), Gaps = 24/232 (10%)

Query: 8   VTTDNEYEDISSFSSIDSYKPEPFTGF-KDSQAPEQPLLKNDTIVGKAQSENEENIDEQH 66
           + TD E++++SSFSS+DSYKPEPF GF  + +  +  L KNDTI+      N E++ E  
Sbjct: 7   IVTDPEFDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTIL------NSEDLAENT 60

Query: 67  RH--SDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKA-LPDIT 123
            +  SD+ S  SS+TL +  SN+IE+++T NA+   SE+AD+L+ +GL+  K+  +PDI 
Sbjct: 61  ANTPSDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDIN 120

Query: 124 APVT-NSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 182
           AP+T   +H   FPEEY++ETETGLVK+KT+E+LK   SR S     H +  +   STRS
Sbjct: 121 APLTLTQSH---FPEEYQVETETGLVKMKTIESLK---SRHSGGT--HNSKKSKGASTRS 172

Query: 183 KVTTYSQG-----SSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 229
           K +  S       + L ++KLN AVE+N+K++E+Y K++ +KGIKGF  ++F
Sbjct: 173 KNSLTSSMEEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  167 bits (423), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 154/229 (67%), Gaps = 15/229 (6%)

Query: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPE-QPLLKNDTIVGKAQSENEENIDEQH-- 66
           TDNE++DISSFSSIDSY+PEPFTG K ++ P  QP     T     + ++++ +   H  
Sbjct: 13  TDNEFDDISSFSSIDSYQPEPFTGLKGNELPNAQP----STTATTTEQDHDDTVISSHSH 68

Query: 67  --RHSDVYSHHSSSTLKRPSSN--SIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 122
             +H +  S  S++TLK+  SN   IEK +T N +   +ET DSL ++GLN  KK++ DI
Sbjct: 69  DTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADI 128

Query: 123 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 182
             P+  +A    FPEEYR+ETETGLVK KT+E+L+R++S ++SA    + D     S R+
Sbjct: 129 NTPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQES-IASANSRRSQDQGSFKSART 185

Query: 183 KVTTYSQG-SSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
             T  S+  SSL+ +KLNMAVEKNKK++E+Y KHK +KGIKGFF+R+FD
Sbjct: 186 NNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  164 bits (414), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 133/226 (58%), Gaps = 30/226 (13%)

Query: 12  NEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDV 71
           N+++++SSFSSIDSY+P+PFTG    + P+                 E+N D   R    
Sbjct: 14  NQFDEVSSFSSIDSYQPQPFTG--QEELPQ-----------------EKNPDSSSR---- 50

Query: 72  YSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAH 131
            S  S +TL    SN+IEK +THNA+ G SETA SL++ GL+  KKA+PDI  P+T +A 
Sbjct: 51  RSSKSGTTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNAD 110

Query: 132 NGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST-------RSKV 184
              FPEEYR+ET+TGLVKLKTL  L R D+RVS       +  +    T       +   
Sbjct: 111 TSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDT 170

Query: 185 TTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
               Q ++  ++ L  A+EKNK +IE++ KH+ EKG+KGF HR+FD
Sbjct: 171 AKAEQEAAQNAENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  159 bits (402), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 143/240 (59%), Gaps = 34/240 (14%)

Query: 8   VTTDNEYEDISSFSSIDSYKPEPFTG----------------FKDSQAPEQPLLKNDTIV 51
           ++ + + EDISSFSSI+SYKPEPF G                 KD+Q+      + + + 
Sbjct: 1   MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVD 60

Query: 52  GKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREG 111
              Q +  ++     R     S  SS  LK+  S  IE+++T NA+ G +ET DSL+  G
Sbjct: 61  PLKQVQTNDSF-WSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATG 119

Query: 112 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT 171
           L+L K+A+PDI +P+   +H     +E + ET+TGL+K KTLETL R ++R SS+K++  
Sbjct: 120 LDLTKRAVPDINSPI---SHESKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKIL 176

Query: 172 -NDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
            ND+++              S L+ +++NM VE+N+KK+E+Y++HK EKG+KGFF++IFD
Sbjct: 177 GNDNSNT-------------SGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  140 bits (353), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 110/164 (67%), Gaps = 4/164 (2%)

Query: 70  DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 129
           D +   S+ TL++  SN+IE+++THNA EG SET +SLK+ GLNL KKA+PDI  P  N 
Sbjct: 57  DFHRVKSNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN- 115

Query: 130 AHNGAFPEEYRLETETGLVKLKTLETLKREDSRV---SSAKKEHTNDHADAHSTRSKVTT 186
             N AFPEEY++ET+TGLVK +TL  L R +SR    S A ++ +   A++ +     + 
Sbjct: 116 YKNCAFPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASA 175

Query: 187 YSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230
            +  + L+ +KL  AVEKN+KKI++Y+KHKS  G++ F  +IFD
Sbjct: 176 NNTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  139 bits (351), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/160 (51%), Positives = 114/160 (71%), Gaps = 5/160 (3%)

Query: 70  DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 129
           ++ S  SS+TLK+  SN+IEK++THNA+EGN+ET +SLK  GL+L KKA+PD   P  ++
Sbjct: 67  EILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHT 126

Query: 130 AHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQ 189
             +  FPEEY++ETETGLVK+KTL++L R D+RVS   K  TN + +A S   +     +
Sbjct: 127 DRS-QFPEEYQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDE----QR 181

Query: 190 GSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 229
               + +KL  AV+KNKKKIE+Y+KHK EKGIKGF  R+F
Sbjct: 182 PVGYDEEKLKKAVDKNKKKIEKYQKHKHEKGIKGFMSRLF 221

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  127 bits (319), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (66%), Gaps = 7/144 (4%)

Query: 92  ITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLK 151
           +THNA EG SET DSL+R GLN+N+KA+PD   P  N   N  FPEEY+LET+TGLVK++
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFT-NCEFPEEYQLETDTGLVKVQ 59

Query: 152 TLETLKREDSRVS-----SAKKEHTNDHADAHSTRSKVTTYSQGSSLESDKLNMAVEKNK 206
           TL+ L R +SR S     S +K   +  +  HS  S     S  S L+++KL  AVEKNK
Sbjct: 60  TLQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSI-SPSAGRSSNSGLDAEKLRKAVEKNK 118

Query: 207 KKIEQYRKHKSEKGIKGFFHRIFD 230
           ++I++Y+KHK+  G+K F  +IFD
Sbjct: 119 RQIDKYQKHKASGGLKKFLGKIFD 142

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 95.1 bits (235), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 127/227 (55%), Gaps = 24/227 (10%)

Query: 9   TTDNE-YEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHR 67
           TTD+E ++D+SSF+S +SY P+ F G              DT+ GK  S   ++      
Sbjct: 10  TTDSENFDDVSSFNSDNSYTPQEFIG--------------DTL-GKESSTKMDDRASHLS 54

Query: 68  HSDVYSHHSSS---TLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITA 124
           H+   +   +S   T+K  +SN + ++++ N ++ N E+ ++LK +  N+  +   DI  
Sbjct: 55  HAIKETRSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIIL 113

Query: 125 PVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVS-SAKKEHTNDHADAHSTRSK 183
           P +    N  FPEEY +ET TGLV +KTLE +K++ +  S +++K   +    A  + + 
Sbjct: 114 PASMEG-NSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNT 172

Query: 184 VTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKG-IKGFFHRIF 229
           V + ++G  L   KLN AVEKNK+++E+Y+ HK+EK  IK    ++F
Sbjct: 173 VKSRNEG-GLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 92.4 bits (228), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 91/167 (54%), Gaps = 27/167 (16%)

Query: 72  YSHHSSSTL---------KRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 122
           +SHHS S+L         K  ++  +E  +  N  +G +++ DSLK   L+L+KKA+P  
Sbjct: 17  HSHHSMSSLVQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGF 76

Query: 123 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 182
             P+   A    FPEEY +ET TGLVK+ TL  L R D+RV++        H+   ST+ 
Sbjct: 77  NQPI---AEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRVTT--------HSSKKSTKE 125

Query: 183 KVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 229
           K T+       ++DKL   +E+N+K+I+ Y K   + G K F  ++F
Sbjct: 126 KNTS----CGYDNDKLQKCIERNQKEIDSYHK---KSGFKKFIGKLF 165

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 91.7 bits (226), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 110/237 (46%), Gaps = 43/237 (18%)

Query: 14  YEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYS 73
           +EDISSF S +S+ P+ F G  DS       + N T  G +++                 
Sbjct: 18  FEDISSFDSQNSFAPQEFKGNLDSNNDNDTGVFNKTKSGTSET----------------- 60

Query: 74  HHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNG 133
               +TLK  SSN IEK++T NALE N+ET  +L+     L+K    ++  P T   +N 
Sbjct: 61  ----NTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENV-LPAT-MENNA 114

Query: 134 AFPEEYRLETETGLVKLKTLETLKREDSR-------------------VSSAKKEHTNDH 174
           AFPEEYR+ET+TGLV +KTLE +    S                          E  ++ 
Sbjct: 115 AFPEEYRIETKTGLVPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDED 174

Query: 175 ADAHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSE-KGIKGFFHRIFD 230
            D          +     LE   +++ VE+NKK++E++ +HK E   +K F ++  D
Sbjct: 175 KDVEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 62.8 bits (151), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ETA SL+  GL  ++  +PD  AP T+ A N  FPEEY LET TGLV + TL +L R  
Sbjct: 48  TETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSLGRTP 106

Query: 161 SRVSSAKKEHTNDHADAHSTRSK 183
           + +S  +     D  DA S+  K
Sbjct: 107 TAISRTRTRQM-DRQDASSSEEK 128

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+   +  LPD+ AP T       FPEEY LET TGLV + TL++L R  
Sbjct: 57  TETVKSLQDMGVT-PEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRTQ 115

Query: 161 SRVSSAKKEHTNDHADA 177
           S VS  +     + A A
Sbjct: 116 SAVSRTRTRVMREGAAA 132

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 72/145 (49%), Gaps = 15/145 (10%)

Query: 53  KAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKREG 111
           + +S N  N DE    SDV S      +  PS N  +  +  N L+   +ET  SL+  G
Sbjct: 3   RQESINSFNSDETSSLSDVESQQPQQYI--PSENGSKSNMAPNQLKLTRTETVKSLQDMG 60

Query: 112 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT 171
           ++ +K  +PD+ AP   S+ N  FPEEY LET TGLV + TL ++ R  + +S  +    
Sbjct: 61  VS-SKAPIPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAISRTRTRQI 117

Query: 172 NDHADAHSTRSKVTTYSQGSSLESD 196
               D  ST S     S   +LESD
Sbjct: 118 ----DGASTPS-----SNEDALESD 133

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 6/113 (5%)

Query: 53  KAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKREG 111
           + +S N  N DE    SDV S      +  PS N  +  +  N L+   +ET  SL+  G
Sbjct: 3   RQESINSFNSDETSSLSDVESQQPQQYI--PSENGSKSNMAPNQLKLTRTETVKSLQDMG 60

Query: 112 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVS 164
           ++ +K  +PD+ AP   S  N  FPEEY LET TGLV + TL ++ R  + +S
Sbjct: 61  VS-SKAPVPDVNAP--QSGKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAIS 110

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+N    A+PD+ AP +N   N  FPEEY +ET TGLV + TL++L R  
Sbjct: 52  TETVKSLQDMGMN-ATPAVPDVNAPQSN--RNAIFPEEYTIETTTGLVPVATLQSLGRTS 108

Query: 161 SRVSSAKKEHTN 172
           + +S  +    +
Sbjct: 109 TAISRTRTRQMD 120

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 3/63 (4%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  GL+ ++K +PD+ AP T++     FPEEY LET TGLVK+ TL +L R  
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTSAGV--IFPEEYTLETPTGLVKIATLVSLGRTG 101

Query: 161 SRV 163
           S V
Sbjct: 102 SAV 104

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+   +  LPD+ AP   ++    FPEEY LET TGLV + TL++L R  
Sbjct: 51  TETVKSLQEMGVT-PEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRTT 109

Query: 161 SRVS 164
           S V+
Sbjct: 110 SGVT 113

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 63/121 (52%), Gaps = 6/121 (4%)

Query: 53  KAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKREG 111
           + +S N  N DE    SDV S      +  PS +  +  +  N L+   +ET  SL+  G
Sbjct: 3   RQESINSFNSDETSSLSDVESQQPQQYI--PSESGSKSNMAPNQLKLTRTETVKSLQDMG 60

Query: 112 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT 171
           ++ +K  +PD+ AP   S+ N  FPEEY LET TGLV + TL ++ R  + +S  +    
Sbjct: 61  VS-SKAPVPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAISRTRTRQI 117

Query: 172 N 172
           +
Sbjct: 118 D 118

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 44/140 (31%), Positives = 71/140 (50%), Gaps = 19/140 (13%)

Query: 32  TGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKM 91
           TG +D+Q P+Q +          QS + ++ D+    S + S+ +++   R S+ S  + 
Sbjct: 18  TGLEDTQ-PQQYIY---------QSVSRQSRDDLQ--SSINSYLTTTPTNRSSNASTNQR 65

Query: 92  ITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLK 151
           +        +ET  SL   G++ +    P I AP T+      FPEEY LETETGLV + 
Sbjct: 66  LKLV----KTETVKSLIDMGVS-SYIPNPAINAPKTSK--KAIFPEEYTLETETGLVPVS 118

Query: 152 TLETLKREDSRVSSAKKEHT 171
           TL +L R ++ +S  +  HT
Sbjct: 119 TLHSLGRTNTNLSRQRTRHT 138

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+  +   +PDI AP   +A N  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSAKKEHTNDHADAHSTRSK 183
           S +S  + +  N  A   S+  K
Sbjct: 102 SALSRTRTKQLNRTATNSSSTGK 124

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+  N   +PDI AP   +A N  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVTSNAP-VPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSAKKEHTNDHADAHSTRSK 183
           + +S  + +  N  A   S+  K
Sbjct: 102 TALSRTRTKQMNRTATNSSSTGK 124

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+  +   +PDI AP   +A N  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--KTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSAKKEHTNDHADAHSTRSK 183
           S +S  + +  N  A   S+  K
Sbjct: 102 SALSRTRTKQLNRSATNSSSTGK 124

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+      +PD+ AP T +  N  FPEEY +ET TGLV + TL++L R  
Sbjct: 51  TETVKSLQEMGMT-QDAPIPDVNAPQTTT-KNAIFPEEYTMETPTGLVPVATLQSLGRTS 108

Query: 161 SRVSSAK 167
           + +S ++
Sbjct: 109 TAISKSR 115

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+  +   +PDI AP   +A N  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSAKKEHTNDHADAHSTRSK 183
           S +S  +    N      S+ +K
Sbjct: 102 SALSRTRTRQLNRTGTNSSSTAK 124

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ETA +L+  G+  ++  LPDI AP   S     FPEEY +ET TGLV + TL+++ R  
Sbjct: 50  TETAKTLQDMGMT-SEAPLPDINAP-QGSKKPAIFPEEYTMETPTGLVPVVTLQSIGRNS 107

Query: 161 SRVS 164
           S +S
Sbjct: 108 SAIS 111

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 63/121 (52%), Gaps = 6/121 (4%)

Query: 53  KAQSENEENIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALE-GNSETADSLKREG 111
           + +S N  N DE    S+V S      +  PS    +  ++ N L+   +ET  SL+  G
Sbjct: 3   RQESINSFNSDETSSLSNVESQQPQQYI--PSERGSKSNMSPNQLKLTRTETVKSLQDMG 60

Query: 112 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHT 171
           ++ ++  +PD+ AP   S+ N  FPEEY +ET TGLV + TL ++ R  + +S  +    
Sbjct: 61  VS-SRAPVPDVNAP--QSSKNKIFPEEYTIETPTGLVPVATLHSIGRTSTAISRTRTRQI 117

Query: 172 N 172
           +
Sbjct: 118 D 118

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  +L+  G+      +PD+ AP T SA N  FPEEY +ET TGLV + TL++L R  
Sbjct: 52  TETVKTLQDLGVT-RDAPVPDVNAPQT-SARNTIFPEEYTMETTTGLVPVSTLQSLGRTA 109

Query: 161 SRVS 164
           + ++
Sbjct: 110 TSIT 113

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 4/82 (4%)

Query: 88  IEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGL 147
           +E+ +T  AL    ETA++L+  G+      LPD+ AP   +A    FPEEY +ET +G+
Sbjct: 28  LEQDVTSRALS-RHETAETLQTMGMA-RGTPLPDVVAPTYAAAP--VFPEEYTMETPSGI 83

Query: 148 VKLKTLETLKREDSRVSSAKKE 169
           V L  LE+L R  + VS   +E
Sbjct: 84  VPLAQLESLGRTVTTVSKKGEE 105

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 13/84 (15%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+  N   +PD+ AP T +     FPEEY +ET TGLV + TL+++ R  
Sbjct: 51  TETVKSLQDMGMTKNAP-IPDVNAPQT-AKKTAIFPEEYTMETPTGLVPVATLQSIGRTA 108

Query: 161 SRVS-----------SAKKEHTND 173
           + +S           S +  H+ND
Sbjct: 109 TSISRTRTRQMDRSISMRSSHSND 132

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ETA SL+  G++ ++  +PDI AP   +  +  FPEEY +ET TGLV + TL ++ R  
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAP--QNVKSPIFPEEYTMETPTGLVPVATLHSIGRTT 100

Query: 161 SRVSSAKKEHTN 172
           S VS  +    +
Sbjct: 101 SAVSRTRTRQLD 112

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+      +PD+ AP T +A    FPEEY +ET TGLV + TL+++ R  
Sbjct: 45  TETVKSLQEMGMTATAP-VPDVNAPQT-TARPQIFPEEYTMETPTGLVPVATLQSIGRTS 102

Query: 161 SRVSSAK 167
           + +S ++
Sbjct: 103 TAISRSR 109

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  +L+  G+  +   +PDI AP  +S  N  FPEEY +ET TGLV + TL+++ R  
Sbjct: 46  TETVKTLQDLGVT-SHVPVPDINAP-QSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTA 103

Query: 161 SRVS 164
           S +S
Sbjct: 104 SAIS 107

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  GL  +   +PD+ AP +N   +  FPEEY +ET TGLV + TL +L R  
Sbjct: 45  TETVKSLQDMGLT-SDAPIPDVNAPTSN--KHSIFPEEYTMETPTGLVPVATLHSLGRNS 101

Query: 161 SRVSSAKKEHTNDHADAH 178
           + ++  + +   D +  H
Sbjct: 102 TTITRTRTKQM-DRSQTH 118

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 52/97 (53%), Gaps = 10/97 (10%)

Query: 101 SETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKRED 160
           +ET  SL+  G+  ++  +P + AP T+      FPEEY +ET TGLV + TL++L R  
Sbjct: 48  TETVKSLQDMGMT-SEAPIPGVNAPQTSRVQ--IFPEEYTMETPTGLVPVATLQSLGRSS 104

Query: 161 SRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDK 197
             V+  +    +  +  +++ S       GS+ ESD+
Sbjct: 105 LAVTRTRTRQMDRQSQTNASIS-------GSNSESDE 134

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 58/139 (41%), Gaps = 25/139 (17%)

Query: 93  THNALEGNSETADSLKREGLNLNKKALP--DITAPVTNSAHNGAFPE---------EYRL 141
           THN  +G  E      RE + L     P   I +P+ N  +  A P+         +Y  
Sbjct: 83  THNLNKGFHEVITKGMRENMQLTSPLTPTSGIVSPIINKDYPSALPDVSTRKFNFTKYVD 142

Query: 142 ETETGLVKLKT------------LETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQ 189
             +  ++K+K+            L+ +K    R+    +E  N   D +S  SKV  Y+Q
Sbjct: 143 RFKKAIIKIKSDQKQFQTRVIQPLQQIKEMGLRIQKPLEERKNLILDINSYSSKVERYNQ 202

Query: 190 GSSLESDKLNMAVEKNKKK 208
              +++++L +  E+ + K
Sbjct: 203 --RVQTNELTLKGEQKRMK 219

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 112 LNLNKKALPDITAPVTNSAHNGAFPEEYRLETETG 146
           L+LN   LP+  +P TNS  N  F   +RL   +G
Sbjct: 144 LSLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASG 178

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 111 GLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETG 146
            L+LN   LP+  +P TNS  N  F   +RL   +G
Sbjct: 144 ALSLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASG 179

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 111 GLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETG 146
            L+LN   LP+  +P TNS  N  F   +RL   +G
Sbjct: 143 ALSLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASG 178

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 111 GLNLNKKALPDITAPVTNSAHNGAFPEEYRLETETG 146
            L+LN   LP+  +P TN+  N  F   +RL   +G
Sbjct: 143 ALSLNATPLPNFYSPTTNAQTNPTFKRTFRLNWASG 178

>Suva_2.172 Chr2 complement(298817..299410) [594 bp, 197 aa] {ON}
           YDR022C (REAL)
          Length = 197

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 177 AHSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYR 213
           +HS+  K+    +G S++SDKL M ++   + I Q+R
Sbjct: 129 SHSSDDKLNDDGEGVSIDSDKLGMDLDLELEVISQFR 165

>TBLA0B04590 Chr2 (1061040..1065596) [4557 bp, 1518 aa] {ON} Anc_8.543
            YPL075W
          Length = 1518

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 75   HSSSTLKRPSSNSIEKMITHN--ALEGNSETADSLKREGLNLNKKALPDIT 123
            HSS  L  P  NS+E++ T+N  A   N+E   +L     NLN K   DIT
Sbjct: 1136 HSSDELNNPQINSLERIDTNNTEASVANNEIDSTLLPANSNLNTKGNQDIT 1186

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.122    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,667,416
Number of extensions: 1230284
Number of successful extensions: 5852
Number of sequences better than 10.0: 387
Number of HSP's gapped: 5764
Number of HSP's successfully gapped: 400
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 64 (29.3 bits)