Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4363.485ON1036103651520.0
Smik_6.2213.485ON1036103648270.0
YGR125W3.485ON1036103648020.0
Suva_7.4133.485ON1037102246860.0
NCAS0E009503.485ON1052105432700.0
NDAI0G009903.485ON1054107832300.0
KNAG0B008603.485ON1088108630800.0
TDEL0D055303.485ON1031105530790.0
CAGL0I10626g3.485ON1070104130700.0
ZYRO0C07986g3.485ON1024106430670.0
KAFR0C019103.485ON1020104730550.0
Kpol_480.183.485ON1057106229480.0
SAKL0F02926g3.485ON105089529190.0
TPHA0D042103.485ON1049105928980.0
TBLA0C044403.485ON115091828350.0
KLTH0F14674g3.485ON1010105528260.0
Kwal_55.212013.485ON1011107727920.0
KLLA0E04731g3.485ON106091125320.0
AFR304W3.485ON1015105924620.0
CAGL0L09207g8.99ON7253621327e-07
ZYRO0F04796g8.99ON7351281318e-07
Kwal_27.110398.99ON7263931301e-06
TDEL0C012808.99ON7275311273e-06
SAKL0B03124g8.99ON7445511263e-06
SAKL0H08800gna 1ON6203451228e-06
TBLA0C052708.99ON7763311238e-06
Suva_16.3228.99ON7425511221e-05
Smik_16.2418.99ON7443951211e-05
KNAG0D023908.99ON7163801156e-05
NDAI0B022108.99ON7063661148e-05
YPR003C8.99ON7543961141e-04
Ecym_7084na 1ON6891871131e-04
Skud_16.2868.99ON7455521122e-04
NCAS0B048008.99ON7243361112e-04
KLTH0G16764g8.99ON7104071103e-04
TPHA0H007208.99ON7871271076e-04
AGR213Cna 1ON6891451040.001
KLLA0E14059g8.99ON7061361030.002
Kpol_467.118.99ON74484930.023
Kwal_27.113038.347ON479106771.7
AGR077C8.271ON848154762.8
Suva_13.258.850ON50230735.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.436
         (1036 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1989   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1863   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1854   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1809   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1264   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1248   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1191   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1190   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1187   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1186   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1181   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1140   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1129   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....  1120   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  1096   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1093   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1080   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   979   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   952   0.0  
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    55   7e-07
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    55   8e-07
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    55   1e-06
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    54   3e-06
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    53   3e-06
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    52   8e-06
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    52   8e-06
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    52   1e-05
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    51   1e-05
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    49   6e-05
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    49   8e-05
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    49   1e-04
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    48   1e-04
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    48   2e-04
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    47   2e-04
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    47   3e-04
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    46   6e-04
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    45   0.001
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    44   0.002
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    40   0.023
Kwal_27.11303 s27 (739517..740956) [1440 bp, 479 aa] {ON} YLR141...    34   1.7  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...    34   2.8  
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...    33   5.7  

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1989 bits (5152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 986/1036 (95%), Positives = 986/1036 (95%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSP 60

Query: 61   MVKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXX 120
            MVKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTI          
Sbjct: 61   MVKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSD 120

Query: 121  XXXXXXXXXTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQ 180
                     TIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQ
Sbjct: 121  DRKDDQSMRTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQ 180

Query: 181  SLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDE 300
            HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDE 300

Query: 301  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH 420
            RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600
            DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY
Sbjct: 541  DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660
            LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT
Sbjct: 601  LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQNVLFFGT               NKDAKKRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISNKDAKKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNL 840
            CENEFLFQY                SSVASAIMAATQNKKIDGLGNGLSTGENRDHARNL
Sbjct: 781  CENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNL 840

Query: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEI 900
            MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEI
Sbjct: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEI 900

Query: 901  QTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960
            QTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1863 bits (4827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 921/1036 (88%), Positives = 952/1036 (91%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSS NKMHRASVSAMSPPLCRSYMSGFFTGG+SP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60

Query: 61   MVKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXX 120
            M+ +MSDSKLP SNKQHP VIHGSENLHRQTAQLSNEFCSSSVEENSPTI          
Sbjct: 61   MINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG 120

Query: 121  XXXXXXXXXTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQ 180
                     TI E+IDEEYSDEYSRLLLSPASSN++D+RNR LQ+G  SELEDDY GGYQ
Sbjct: 121  DRKDDQSMRTIEEDIDEEYSDEYSRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQ 180

Query: 181  SLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLR SHNLR RPRN  + CTSFP KF HYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDE 300
            HLGPTGISMFYISTIISQAVYSGG SSFPSGIGSEMIEITPFYHTMALAVK+AL G+DDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDE 300

Query: 301  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTG VFYVLGKL+LGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH 420
            RVAKFEYSWPFF GLFTNYDTLAKWLLPV+LTVILIGTQRYFKNSLVLP+FYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLDTLR AGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600
            DSSFAGFLLIALTIC+M+IGPVIISFIPICIVGSLIFLLGYELLVEAL+DTWNKLNRFEY
Sbjct: 541  DSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660
            LTVVIIVFTMG+FDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT
Sbjct: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQN+LFFGT               NKDA KRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFT TK+IKLIISSI+ERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNL 840
            CENEFLFQY                +++ SA+MAATQNK I+ LGNGL+ G N D  RNL
Sbjct: 781  CENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNL 840

Query: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEI 900
            MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFK EYK+DEP+LPILLFALKQYRPDIISEI
Sbjct: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEI 900

Query: 901  QTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960
            Q VREKEIKFWAQLCPYFTRRRLASQSLLLHADN+FFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDS+LWVIDSSSLKKMKEENLALYVEV LMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1854 bits (4802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 923/1036 (89%), Positives = 955/1036 (92%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSS NKMHRASVSAMSPPLCRSYMSGFFTGG+SP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60

Query: 61   MVKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXX 120
            M+ N+SDSKLP SNKQHP VIHGSENLHRQTAQLSNEFCSSSVEENSPTI          
Sbjct: 61   MINNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG 120

Query: 121  XXXXXXXXXTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQ 180
                     TI ENIDEEYSDEYSRLLLSPASSNVDD+RNR LQ+  + ELED Y GGYQ
Sbjct: 121  DRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQ 180

Query: 181  SLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLRPSHNLRFRPRN+W  CTSFP KFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDE 300
            HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALA+K+AL GNDDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDE 300

Query: 301  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTGVVFY LGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH 420
            RVAKFEYSWPFFSGLFT+YDTLAKWLLPVLLTV+LIGTQRYFKNSLVLP+FYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLD LR+AGWIFPIANSDSKWYDHY+LFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600
            DS FAGFLLIALTIC+M+IGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY
Sbjct: 541  DSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660
            LTVVIIVFTMG+FDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVA+STVYRDYVQT
Sbjct: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQN+LFFGT               NKDA KRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFT TKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNL 840
            CENEFLFQY                ++V SA++AAT+NKKID +GNGL+ G N D ARNL
Sbjct: 781  CENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNL 840

Query: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEI 900
            MSLPTNTPRNYQ+LSVAQNVFVNDEQAVKNFK EYK+DEP+LPILLFALKQYRPDIISE+
Sbjct: 841  MSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEV 900

Query: 901  QTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960
            Q VREKEIKFWAQLCPYFTRRRLASQS LLHADNIFFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSL K+KE+NLALYVEV LMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1809 bits (4686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 888/1022 (86%), Positives = 931/1022 (91%), Gaps = 1/1022 (0%)

Query: 16   EAISVSLGIN-QDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSPMVKNMSDSKLPFSN 74
            EAI+VSLGIN QDSSKNK+HRAS S MSPPLCRSYMSGFFTGGSSPM  NMSD KLPFSN
Sbjct: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSN 75

Query: 75   KQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXXXXTIVEN 134
            KQHP VIHGSENLHRQTAQLSNEFCSSSVEENSPTI                   TI EN
Sbjct: 76   KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDRKDDQSMRTIEEN 135

Query: 135  IDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQSLRPSHNLRFRPRN 194
            IDEEY+DEYSRLLLSPASSNVDDERNRALQ  P S+LED +GGGYQS+ PSH+LRF PR+
Sbjct: 136  IDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRS 195

Query: 195  IWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 254
            +WQW TSFP KFA YLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
Sbjct: 196  VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 255

Query: 255  IISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDEIITTTIFCYVISSM 314
            IISQ+VYSGGWSSFPSG+GSEMIEITPFYHTMAL +K+AL G+DDEIITTTIFCYVISSM
Sbjct: 256  IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSM 315

Query: 315  LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSG 374
            LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF SG
Sbjct: 316  LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSG 375

Query: 375  LFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL 434
            LFTNYDTLAKWLLPVLLTV+LIGTQR FKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL
Sbjct: 376  LFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL 435

Query: 435  REAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAM 494
            R++GWIFPIA+SDSKWYDHYKLFN+HKVHW+LVLQQIPTMMALTFFGILHVPINVPALAM
Sbjct: 436  RDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAM 495

Query: 495  SLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTI 554
            SLQMDKYDVD+ELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLL+ALT+
Sbjct: 496  SLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTV 555

Query: 555  CVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFD 614
            C+M+IGPVIISFIPICIVGSLIFLLGYELLVEALVDTW+KLNRFEYLTVVIIVFTMG+FD
Sbjct: 556  CIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFD 615

Query: 615  FVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 674
            FVLGIIVGILIACFSFLVDSTKLQT+NGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK
Sbjct: 616  FVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 675

Query: 675  LQNVLFFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIK 734
            LQNVLFFGT               NKD+ KRRIKYLILDFKNINADNIDYSAAEGFNRIK
Sbjct: 676  LQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIK 735

Query: 735  RFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYXXXXX 794
            RFT TKRIKLIISSIKERD IYNAFNNVGLLNDVELFADLN ALEWCENEFLFQY     
Sbjct: 736  RFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYKQLRE 795

Query: 795  XXXXXXXXXXXSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQML 854
                       ++V SAIMAATQNKKID  G  L+ G NRD AR+LMSLPTNTPRN+QML
Sbjct: 796  KAKKRLEERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQML 855

Query: 855  SVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQL 914
            SVAQNVF NDEQAVKN K EYK DEP+LPILLFALKQYRPDI+SE+Q VREKEIKFWAQL
Sbjct: 856  SVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQL 915

Query: 915  CPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNA 974
            CPYF+RRRLASQSLLLHADN+FFL+ETGMLKA YELPQG+LYEI SNGTCFGKIIAPGN 
Sbjct: 916  CPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT 975

Query: 975  MPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLV 1034
            MPREQKLTIETETDS+LWVIDSSSLKKMKEENLALYVEVTLM+MCIKDTRFKELLGYTLV
Sbjct: 976  MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLV 1035

Query: 1035 SA 1036
            SA
Sbjct: 1036 SA 1037

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1264 bits (3270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1054 (63%), Positives = 780/1054 (74%), Gaps = 34/1054 (3%)

Query: 6    RRRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPP-LCRSYMSGFFTGGSSPMVKN 64
            +++    S+S +ISVSLG+ Q+      +    +  +   + RSY+SGF +   + M   
Sbjct: 10   KKKNKQQSISGSISVSLGLQQEEEPRDDYFDDENVNNNNYMGRSYVSGFLSVSPALMGSM 69

Query: 65   MSDSK-LPFS----NKQHPTVIHGSENLHRQTAQLS------------NEFCSSSVEENS 107
              D + LP +     +     IH SE LH+QTA +S             ++ +    E++
Sbjct: 70   KQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTRIKDYITLFQGEDN 129

Query: 108  PTIXXXXXXXXXX--XXXXXXXXXTIVENIDEEYS-DEYSRLLLSPASSNVDDERNRALQ 164
              +                       +E + E    DE SRLL+SP SSN++   +  L 
Sbjct: 130  GLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSSNINPNIDDLL- 188

Query: 165  SGPISELED--DYGGGYQSLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNIL 222
              P    ED   Y   Y++  PS  L      IWQ    FP++F HYLPAAVLGLLLNIL
Sbjct: 189  --PTVTGEDVSSYQSIYRTATPS--LSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNIL 244

Query: 223  DALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPF 282
            DALSYGMIIFPITEP+FSHLGPTG+SMFYISTIISQ +YS GWSSFPSGIGSEMIE+TPF
Sbjct: 245  DALSYGMIIFPITEPIFSHLGPTGLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVTPF 304

Query: 283  YHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIG 342
            +HTMALA+K+ L G DDEIITTTIFCYVISSMLTG+ FY LGKL LGKIVGFFPRHILIG
Sbjct: 305  FHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIG 364

Query: 343  CIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYF 402
            CIGGVGYFL++TGIEVTTRVAKFEYS PF + LF+++ TL KWLLPVLLTVILI TQR F
Sbjct: 365  CIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQRCF 424

Query: 403  KNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKV 462
            KNSLVLP+FYILTL+LFHFIVAIIP+L+L+ LR++GWIFPIA S+SKWYDHYKLF+  KV
Sbjct: 425  KNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKV 484

Query: 463  HWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGS 522
            HW+LV +QIPTM+ALTFFGILHVPINVPALAMSL +DKYDVD+ELIAHG SNF SG +GS
Sbjct: 485  HWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGS 544

Query: 523  VQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYE 582
            +QNYLVYTNSVLFIRAGADS+ AG++LI LT  VM IGPVIISFIPICIVGSLIFLLGYE
Sbjct: 545  IQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYE 604

Query: 583  LLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTING 642
            LLVEAL D W K++ FEY+T+VIIV TMG+FDFVLGIIVGILIACFSFL+DSTKLQTING
Sbjct: 605  LLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTING 664

Query: 643  EYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKDA 702
            EY+G VAKSTVYRD +QTKFL+GIGEQIYVLKLQN+LFFGT               +KD+
Sbjct: 665  EYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDS 724

Query: 703  KKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNV 762
             + RIKYLILDFKNINADNIDYSAAEGFNRIKRFT TK+I+L+ISSIKERD IY AF+NV
Sbjct: 725  SRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNV 784

Query: 763  GLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKID 822
            GLL  VELF DLNSALEWCENEFLF+Y                  + ++I   +Q  +  
Sbjct: 785  GLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASI--GSQKYQFT 842

Query: 823  GLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPIL 882
                G     N D  RNLMSLP NTPRN+Q+LSVAQNVF N+EQ VKN K E K+  P L
Sbjct: 843  A---GNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFL 899

Query: 883  PILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETG 942
            P+LLF LKQYRP IIS  +TV+E EIKFW+QLCPYF +  LASQS L+H +NIFF+VETG
Sbjct: 900  PLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETG 959

Query: 943  MLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKM 1002
            +LKAT+ LPQG +YE  SN TC+GKI    N     + LTI  E DS+LWVIDS SL KM
Sbjct: 960  ILKATFNLPQGNIYETMSNRTCYGKITGQHNESTL-KTLTIRAEIDSILWVIDSGSLIKM 1018

Query: 1003 KEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
            + EN  L+ E+TL++M +KD RFKELLGYTLVSA
Sbjct: 1019 RAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1248 bits (3230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1078 (61%), Positives = 801/1078 (74%), Gaps = 70/1078 (6%)

Query: 5    IRRRRSNS-SLSEAISVSLGI-NQD-------SSKNKMHRASVSAMSPPLCRSYMSGFFT 55
            +RR+++N  S+S+ ISVSLG+ NQD       +    +   ++S  S  L RSY+SGF +
Sbjct: 1    MRRQKNNRHSISDTISVSLGLQNQDPQILQQPNGGPTVTLGNMSDTSNYLGRSYVSGFLS 60

Query: 56   GGSSPMVK-NMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXX 114
              +SP +  + +++ LP +N+     IH S+NLHRQTA +S +F +    E+   +    
Sbjct: 61   --ASPAINHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDFNNDPTFEDDINMKEYI 118

Query: 115  XXXXXXXXXXXXXXXTI--------VENIDEEYS---------DEYSRLLLSPASSNVDD 157
                           T         ++NI  E +         DE SRLLLSP  S+   
Sbjct: 119  SNLEDDATGNNGKRYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPIPSDSLL 178

Query: 158  ERNRALQSGPISELEDDYG-----GGYQSLRP--SHNLRFRPRNIWQWCTSFPFKFAHYL 210
                 L S  ISE E +         YQS+R   S +  +     W+   + P +   YL
Sbjct: 179  AGENLLPS--ISEQEQETAQRRRTSAYQSIRHRNSESTEYSSIPTWRKYIATPSEIIQYL 236

Query: 211  PAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPS 270
            PA++LGLLL ILDALSYGMIIFPITEP+FSHLGPTGISMFYISTIISQ+++SGGWSSFP 
Sbjct: 237  PASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYISTIISQSIFSGGWSSFPC 296

Query: 271  GIGSEMIEITPFYHTMALAVKDAL-EGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLG 329
            GIGSEMIE+TPF+HTMA A+KDAL EG++D+IITTT+FCYVISSMLTG+ FY LGKL LG
Sbjct: 297  GIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGKLHLG 356

Query: 330  KIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPV 389
            KIVGFFPRHILIGCIGGVGYFLIITGIEV+TRVAKF+Y+ PF + LFT+  TL +WLLP 
Sbjct: 357  KIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQWLLPT 416

Query: 390  LLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSK 449
            LLTVILI  Q+  +NSLVLP+FYILTL+LFHF+VAIIP+LSL+ LR++GWIFP A +DSK
Sbjct: 417  LLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAATDSK 476

Query: 450  WYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIA 509
            WYDHYKLFN+HKVHW+L+L+QIPTM+ALTFFGILHVPINVPALAMSLQMD+YDVD+ELIA
Sbjct: 477  WYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALAMSLQMDRYDVDKELIA 536

Query: 510  HGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPI 569
            HG SNF SG+ GS+QNYLVYTNSVLFIRAGADS+ AG +LI LTI +M+IGPVIISFIPI
Sbjct: 537  HGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLTIIIMIIGPVIISFIPI 596

Query: 570  CIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFS 629
            CIVGSLIFLLGYELLVEALVD   K+++FEY+T+VIIVFTMG+FDFVLG+IVGILIACFS
Sbjct: 597  CIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIFDFVLGVIVGILIACFS 656

Query: 630  FLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXX 689
            FL+DSTKLQTINGE++G VAKSTVYRD +QTKFL+GIGEQIYVLKLQN+LFFGT      
Sbjct: 657  FLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEE 716

Query: 690  XXXXXXXXXNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSI 749
                     + D+ K RIKYLILDFKNINADNIDYSAAEGFNRIKRFT TKRI+LIISSI
Sbjct: 717  KIDKLLEISDMDSSKHRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLIISSI 776

Query: 750  KERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVA 809
            +ERD IYNAFNNVGLL  VELF DLNSALEWCENEFLF+Y                    
Sbjct: 777  RERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKY-------------------- 816

Query: 810  SAIMAATQNK---KID---GLGNGLSTGENRDH---ARNLMSLPTNTPRNYQMLSVAQNV 860
              +   T+ K   KID    + NG  T E   H    RN+MSLP NTPRN QMLSVAQNV
Sbjct: 817  KTLREKTRQKRKNKIDINLAITNGNPTEERNMHLEIPRNIMSLPMNTPRNNQMLSVAQNV 876

Query: 861  FVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTR 920
            F N+EQA K  K ++KN+  +LP+LLF LKQYRP I+S  +++ EKEIKFW+QLCPY + 
Sbjct: 877  FRNEEQAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLSE 936

Query: 921  RRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGN--AMPRE 978
            R L +QS L H +N FF+VE+G+LKAT+ LP GTLYE  SN TC+GKI+   N   +  E
Sbjct: 937  RFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTVLNE 996

Query: 979  QKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
            Q LTI+TETD  LWVID  +L +M+ ENL LY+E+ L++M I+DTRFKELLGYTLVSA
Sbjct: 997  QDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVSA 1054

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1191 bits (3080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/1086 (57%), Positives = 763/1086 (70%), Gaps = 63/1086 (5%)

Query: 7    RRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAM---SPPLCRSYMSGFFTGGSSPMVK 63
            +R +  S+SE+ISVSLG+  + ++   +   +  +   S  L RSY+SG +    SP  +
Sbjct: 10   KRPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLW----SPTQR 65

Query: 64   NMSDSK--LPFSNKQ-HPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXX 120
            N       LP SN+Q +   IH S+ LHRQT  +   F  S+ +E S             
Sbjct: 66   NNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVE 125

Query: 121  XXXXXXXXXTIVENI-----------------------DEEYS--DEYSRLLLSPASS-- 153
                       V+ I                        +EY   DE SRLLL+P SS  
Sbjct: 126  HNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPVSSLS 185

Query: 154  ---------NVDDERNRALQSGPISELEDDYGGGYQSLRP--SHNLRFRP--RNIWQWCT 200
                       +D   RA    P++ +   YG    +L    S  ++  P   + W + +
Sbjct: 186  VAISDASSLTPEDYNGRA--RSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWDYIS 243

Query: 201  SFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAV 260
            +      HYLPA++LGLLLNILDALSYGMIIFPITEP+FS LGP+G+SMFYIST+ISQ  
Sbjct: 244  ALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFT 303

Query: 261  YSGGWSSFPSGIGSEMIEITPFYHTMALAVKDAL-EGNDDEIITTTIFCYVISSMLTGVV 319
            YS GWSSFP GIGSEMIE+TPF+HTMAL +   L E   +EIITTTIFCYVISSM TG+ 
Sbjct: 304  YSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMFTGLT 363

Query: 320  FYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNY 379
            F+ LGKL+LGK+VGFFPRHILIGCIGGVGYFL+ITGIEV TR+AKFEYS PF   LFT+ 
Sbjct: 364  FFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDE 423

Query: 380  DTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGW 439
             TL +WLLP +LT+ILI TQ  F+NSLVLP+FYILTL+LFHFIVAI+P LSL  LR +GW
Sbjct: 424  KTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGW 483

Query: 440  IFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD 499
            IFP+A S+  WYDHYK FN   VHW+LV++QIPTMMALTFFGILHVPINVPALAMSLQMD
Sbjct: 484  IFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMD 543

Query: 500  KYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLI 559
            KYDVDRELIAHGYSNFFSGL GS++NYLVYTNSVLFIRAGADS+ AG++LI LTI VMLI
Sbjct: 544  KYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIVLTIIVMLI 603

Query: 560  GPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGI 619
            GPVIISFIPICIVGSLIFLLGYELL+EALVDTW KLN FEY+TV II+ TMG+FDFVLGI
Sbjct: 604  GPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGI 663

Query: 620  IVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVL 679
            IVGILIACF FL+DST LQT+NGE++G VAKSTVYRD +QT FLDG+GEQIYVLKLQN+L
Sbjct: 664  IVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLL 723

Query: 680  FFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGT 739
            FFGT               N D+ KRRIKYLILDFKNIN DNIDYSAAEGFNRI+RFT T
Sbjct: 724  FFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQT 783

Query: 740  KRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXX 799
            K I+LIISSI+E+D IY AFNNVGLL DVELF DLNS+LEWCENE L  Y          
Sbjct: 784  KGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKAR 843

Query: 800  XXXX--XXSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVA 857
                    +SV S  +  + +K++D      +    R    NLMSLPTNTPRN+QML+VA
Sbjct: 844  LRKLNNTANSVVSR-LPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTVA 902

Query: 858  QNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPY 917
            Q+VF NDEQ V + + + K  +P+LP+LL  LKQYRPDI S  +  R+KEI  W++LCPY
Sbjct: 903  QDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIWSRLCPY 962

Query: 918  FTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAM-- 975
            F ++ + +Q+ L H + IFFLV+TG+LKA ++LPQG +YE  +N TC+GKII  G  +  
Sbjct: 963  FAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDD 1022

Query: 976  -----PREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLG 1030
                 P   KL I TETDS LWVID++++ +++ E+  L++++ L+VM IKD RFK+LLG
Sbjct: 1023 ADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLG 1082

Query: 1031 YTLVSA 1036
            + L+SA
Sbjct: 1083 HALISA 1088

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1190 bits (3079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1055 (59%), Positives = 769/1055 (72%), Gaps = 59/1055 (5%)

Query: 7    RRRSNSSLSEAISVSLGINQDSSKNKMHRASVSA---------MSPP---LCRSYMSGFF 54
            R R   S+SEAISVSLG+   ++    H  + S          MSP    L RSY+SGF 
Sbjct: 11   RNRGRHSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFL 70

Query: 55   TGGSSPMVKN-MSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXX 113
            +   SP   N +   +LP + +     IH ++NLHRQTA+L  +F   +VE+N+      
Sbjct: 71   S--CSPYGSNSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNN------ 121

Query: 114  XXXXXXXXXXXXXXXXTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELED 173
                              +E  D E   +    L +P   N +D  +         ++ED
Sbjct: 122  -----IQDYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGD---------DIED 167

Query: 174  DY-------GGGYQSL--RPSHNLRFRPRN-IWQWCTSFPFKFAHYLPAAVLGLLLNILD 223
             Y        GGY+++   P   LR   R+ +W+   S   K  HYLPA +LGLLLN+LD
Sbjct: 168  VYESLVTGAHGGYRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATILGLLLNVLD 227

Query: 224  ALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFY 283
             LSYGMIIFPITEP+FSHLGP+G+SMFY+STIISQ +YS G+S+FP+G+GSEMIE+TPF+
Sbjct: 228  GLSYGMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFF 287

Query: 284  HTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGC 343
            H+MALA+KDAL G DDEI+TTTIFCYVISS++TG+ FYVLGK++LGKIVGFFPRHILIGC
Sbjct: 288  HSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGC 347

Query: 344  IGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFK 403
            IGGVGYFL++TG+EVTTRVAK EY+WPF S +FT+  TL KW+LPVLLTV+LI TQR+F+
Sbjct: 348  IGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQ 407

Query: 404  NSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVH 463
            NSLVLPTFYI TLV FHF+VAIIP +SL  LR  GWIFP+A S  +WYDHYKLF  H+VH
Sbjct: 408  NSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVH 467

Query: 464  WSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSV 523
            W L+ +Q PTM+AL+FFGILHVPINVPALA+SLQMDKYDVD+ELIAHGYSN  SG LGS+
Sbjct: 468  WGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSI 527

Query: 524  QNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYEL 583
            QNYLVYTNS+LFIRAGADS+ AG+LL  LT  +M+IGPVIIS+IPICIVGSLIFLLGYEL
Sbjct: 528  QNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYEL 587

Query: 584  LVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGE 643
            L EAL++T  K+  FEY+T+ IIV TMG+FDFVLG+IVGILIACFSFLVDSTKLQTINGE
Sbjct: 588  LYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGE 647

Query: 644  YNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXX-NKDA 702
            Y+G +AKSTVYRDYVQ++FLDGIGEQIYVLKLQ++LFFGT                ++  
Sbjct: 648  YDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKN 707

Query: 703  KKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNV 762
             KRRIK LILD KNINADNIDYSAAEGFNRIKRFT +K I+LIISSI E D IY AF+ V
Sbjct: 708  SKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKV 767

Query: 763  GLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQN-KKI 821
             LL+DVELF DLN ALEWCENE LF+Y                + +  A +AA  + K I
Sbjct: 768  KLLDDVELFGDLNGALEWCENELLFKY----KELRAKARDRLQNKMQMANLAANNDTKAI 823

Query: 822  DGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPI 881
            DG+           H +NLMSLP NTPRN QMLSVAQ VF N+++ V + K+ YK   P+
Sbjct: 824  DGV-------PKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPV 876

Query: 882  LPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVET 941
            LP+LLFALK YRP I+SE   V+  E++ W++LCPYFTRRRLASQS+LLH  +IFF++ET
Sbjct: 877  LPLLLFALKPYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMET 936

Query: 942  GMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKK 1001
            G+LK  Y+LPQG +YE  SN TC+G ++ PG     E K+TI+TET+ VLWVIDSS L +
Sbjct: 937  GILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILAR 996

Query: 1002 MKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
            +K+ENL+LY E+ L++  +K+ R++++LGYTLVSA
Sbjct: 997  LKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1187 bits (3070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1041 (58%), Positives = 740/1041 (71%), Gaps = 37/1041 (3%)

Query: 24   INQDSSKNKMHRASVSAMSPP-------LCRSYMSGFFTGGSSPMVKNMSDSKLPFSNKQ 76
            +N+ +S N   R +   +  P       L RSY+SG   G S P  +    + LP SNK 
Sbjct: 39   LNESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGIL-GSSLP--QGGERNTLPVSNKF 95

Query: 77   HPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXXXXT------ 130
                IH    LHRQTA ++ EF   ++ E+  ++                          
Sbjct: 96   GSRAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDND 155

Query: 131  -IVEN-----------IDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELED-DYGG 177
             I +N            D E  ++ +  LL+P+SSN D+  + + +   +S   + +   
Sbjct: 156  LITDNKTPVSINLKRATDPEL-EQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQES 214

Query: 178  GYQSLR--PSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPIT 235
             YQS+   PS   R  P +          +  +Y+PAA+LGLLLNILDALSYGMIIFPIT
Sbjct: 215  TYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPAAILGLLLNILDALSYGMIIFPIT 274

Query: 236  EPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALE 295
            EP+F+ LGPTGISMFYISTIISQ +YS GWSSFPSGIGSEMIEITPFYHTMALA+  AL 
Sbjct: 275  EPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP 334

Query: 296  GNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 355
            G DDEIITTTIFCYVISS++TG+ FY+LGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG
Sbjct: 335  GRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 394

Query: 356  IEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILT 415
            +EVTTR+AKFEYS PF + LF +   L KWLLP +LT+ILI TQ+ FKNSLVLP+FYI+T
Sbjct: 395  LEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIIT 454

Query: 416  LVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMM 475
            L+LFHF+VAI P LSL  LR+ GWIFP     SKWYDHY+ F++ K HWSLV++QIPTM+
Sbjct: 455  LILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTML 514

Query: 476  ALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLF 535
            ALTFFGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGL GSVQNYLVYTNSVLF
Sbjct: 515  ALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLF 574

Query: 536  IRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKL 595
            IRAGADS+ AG++LI LTI VM+IGPVIISFIPICIVGSLIFLLGYELLVEA++D + K+
Sbjct: 575  IRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKV 634

Query: 596  NRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYR 655
              FEY T+ IIV TMG+FDFVLGI+VGILIACFSFLVDSTKLQT+NGE++G VAKSTVYR
Sbjct: 635  TTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYR 694

Query: 656  DYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFK 715
            D+ QT+FL  IGEQIYVLKLQN+LFFGT               + D  K RIK+LILDFK
Sbjct: 695  DFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFK 754

Query: 716  NINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLN 775
            NINADNIDYSAAEGFNRIKR+T  KRIKLIIS+I+E DRIY+ FN VGLL D+ELF DLN
Sbjct: 755  NINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLN 814

Query: 776  SALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKIDGLGNGLSTGENRD 835
            SALEWCENEFL+QY                 ++ +AI    Q ++ D      + G    
Sbjct: 815  SALEWCENEFLYQY-KELREKARNKLQRRSKNINAAI--GNQLRRYDQTNK--NQGPTSS 869

Query: 836  HARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPD 895
              +NLMSL  NTPRNYQ++S AQ  F N++Q       + K  +P+L +LLFALK YRP+
Sbjct: 870  LMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYRPN 929

Query: 896  IISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTL 955
            I+S     R  E++FW QLCPYFTR+   + +  LH +N FFLV+ G+LK  Y LP G++
Sbjct: 930  IVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSV 989

Query: 956  YEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTL 1015
            YE  SNGTC+GKI++  +     Q L ++ ETD++LW+ID  S++ MK +N+ LY E+ L
Sbjct: 990  YETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVL 1049

Query: 1016 MVMCIKDTRFKELLGYTLVSA 1036
            +++ I+DTRFKELLGYTLVSA
Sbjct: 1050 LILAIRDTRFKELLGYTLVSA 1070

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1064 (58%), Positives = 747/1064 (70%), Gaps = 79/1064 (7%)

Query: 6    RRRRSNSSLSEAISVSLGINQDSSKN-------------------KMHRASVSAMSPPL- 45
            R  R+  S+S AISVSLG+N+   +N                   +   +S+  +SPP  
Sbjct: 7    RPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPPFY 66

Query: 46   ------CRSYMSGFFTGGSSPM---VKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSN 96
                   RSY+ G F   S  M    +N   S LP  ++     IHGS+ +HRQTA+LSN
Sbjct: 67   NSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELSN 125

Query: 97   EFCSSSVEENSPTIXXXXXXXXXXXXXXXXXXXTIVENIDEEYSDEYSRLLLSPASSNVD 156
             F   +                                  EE  + Y  +          
Sbjct: 126  NFSDDTTGM-------------------------------EEVRNRYDAM---------- 144

Query: 157  DERNRALQSGPISELEDDYGGGYQSLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLG 216
            ++ N +L      +      GG      ++N     R        F     HY P+AVLG
Sbjct: 145  EDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSAVLG 204

Query: 217  LLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEM 276
            LLLNILD LSYGMIIFPITEP+FSHLG TG+SMFYISTIISQ +YSGG SSF SGIGSEM
Sbjct: 205  LLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEM 264

Query: 277  IEITPFYHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFP 336
            IE+TPF+HTMA A++DA+ G DD+IITTTIFCY ISS++TG+ FY+LGKLRLGKIVGFFP
Sbjct: 265  IEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFP 324

Query: 337  RHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILI 396
            RHILIGCIGGVGYFL+ITG+ VTTR+AK EY+W F   LF + D L KWLLPV+LT++L+
Sbjct: 325  RHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLV 384

Query: 397  GTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKL 456
             TQ+ F+NSLVLP+FYI+TL+LFHF+VAI+P++SLD LR+ GWIFP A S  +W+DHYKL
Sbjct: 385  NTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKL 444

Query: 457  FNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFF 516
            F+ HKVHW+LVL QIPTM+ALTFFGILHVPINVPALA+SL MDK+DVD+ELIAHGYSNF 
Sbjct: 445  FDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFI 504

Query: 517  SGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLI 576
            SG++GS+QNYLVYTNSVLFIRAGADS FAG++L  LT  VM+IGPVI+SFIPICIVGSLI
Sbjct: 505  SGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLI 564

Query: 577  FLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTK 636
            FLLGYELLVEAL+DT  K+  FEY+T+VIIV TMG++DFVLG+IVGILIACFSFLVDSTK
Sbjct: 565  FLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTK 624

Query: 637  LQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXX 696
            LQTINGE++G VA+STV RDYVQ+ FL+G+GEQIYVLKLQNVLFFGT             
Sbjct: 625  LQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLE 684

Query: 697  XXN-KDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRI 755
              + K + KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT TKRIKLIISSIKERD I
Sbjct: 685  ITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHI 744

Query: 756  YNAFNNVGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAA 815
            YN F+NVGLL+DVELF DLN ALEWCENEFL +Y                 +V SAI AA
Sbjct: 745  YNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY--NVTSAIEAA 802

Query: 816  TQNKKIDGLGNGLSTGE-NRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKME 874
               KK+    N +S    +  + RNL SLP NTPRN+QMLSVAQN+F NDE+ V   + E
Sbjct: 803  AA-KKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMF-NDEEDVDALEDE 860

Query: 875  YKND--EPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHA 932
              ND  +P+LP+LLFALK YR +I S    +RE+E + W+QL PYF +RRL +QS+LLH 
Sbjct: 861  SCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHN 920

Query: 933  DNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLW 992
             + FF+VE+G+LK   +LPQG +YE  SN TC G I+        E K+TI TETD+ LW
Sbjct: 921  QDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLW 980

Query: 993  VIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
            +ID   L+K++ ENL LY E+ L+ + IK  RF++LLGYTLVSA
Sbjct: 981  LIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1181 bits (3055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1047 (59%), Positives = 747/1047 (71%), Gaps = 54/1047 (5%)

Query: 7    RRRSNSSLSEAISVSLGI-NQDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSPMVKNM 65
            R     SLS++IS SLG+ +Q+S+         ++ S  L RSYM G     S+  V+ +
Sbjct: 11   RASKRLSLSDSISRSLGLQDQESNIAGTDNELSNSKSNYLSRSYMYGLLP--SATPVEEL 68

Query: 66   SDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSS---SVEENSPTIXXXXXXXXXXXX 122
              + LP SN      IH S  LH+QTA +  +F  S   S+++    I            
Sbjct: 69   ETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTDRDNINEHK 128

Query: 123  XXXXXXXTIVENIDE-EYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQS 181
                    +    DE E  DE SRLLL+P+SSN +           +S + +     Y S
Sbjct: 129  ESLPVTVVLSTPADEVEEQDESSRLLLTPSSSNAE-----------VSSIAEGLRHHYSS 177

Query: 182  LRPSHNLRF-----RPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITE 236
            +  + +        +   I +  ++F +    Y PA+VLGLLLNILDALSYGMIIFPI+E
Sbjct: 178  IESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISE 237

Query: 237  PVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEG 296
            P+FSHLGPTG+SMFYISTII Q +YS GWSSFPS IGSEMIEITPF+HTMA A+  +L G
Sbjct: 238  PIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPG 297

Query: 297  --NDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT 354
              N D IITTTIFCYVISSM TG+ F  LGKLRLGKIVGFFPRHILIGCIGGVGYFL+IT
Sbjct: 298  EENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLIT 357

Query: 355  GIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYIL 414
            GIEVTTR+AKFEYS P    LFT+   L KWL P LLTV+LI TQ+ FK SLVLP+FYI 
Sbjct: 358  GIEVTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIA 417

Query: 415  TLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTM 474
            TL+LFHFIVAIIP LSL  LREAGWIF     +S WYDHYKLF+ HKVHW LV +QIPTM
Sbjct: 418  TLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTM 477

Query: 475  MALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVL 534
            +ALTFFGILHVPINVPALAMS+QMDKYDVD+ELIAHG SN  SG+ GS+QNYLVYTNSVL
Sbjct: 478  LALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVL 537

Query: 535  FIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNK 594
            FIRAGADS FAG+LLI LTI VMLIGPVIISFIPICIVGSLIFLLGYELLVEAL+DTW+K
Sbjct: 538  FIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDK 597

Query: 595  LNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVY 654
            L  FEY+TVV+IV TMG+ DFVLGIIVGILIACF FL+DS+KLQTINGE++G VAKSTV 
Sbjct: 598  LTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVN 657

Query: 655  RDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDF 714
            RD +Q+KFL+GIG+QIYVLKLQN+LFFGT               ++++ KR+IKYLILDF
Sbjct: 658  RDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDF 717

Query: 715  KNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADL 774
            +NINADNIDYSAAEGFNRIKR T +K I+LIISSIK RDRIYN+FN VGLL  VELF DL
Sbjct: 718  RNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDL 777

Query: 775  NSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKIDGLGNGLSTGENR 834
            N ALEWCENEFL+QY                           +  KI  +     + +  
Sbjct: 778  NGALEWCENEFLYQYKMIR-----------------------ERIKIKNVKTATHSSDGN 814

Query: 835  DHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRP 894
                + M+L  NTPRNYQ+ SVAQN+F N+EQ V   K  +++  P+LP+LLFALKQYRP
Sbjct: 815  LSKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRP 874

Query: 895  DIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGT 954
            DI+S  +  + KEI+FW+QL PYF+++R+ASQS+L H +NIFFLVE G+LK T++LPQG 
Sbjct: 875  DIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGK 934

Query: 955  LYEIFSNGTCFGKI-----IAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLAL 1009
            +YE  S   C+GKI     ++  +A P  Q + I+TE D+V+W+IDSS+LKKMK+EN+ L
Sbjct: 935  VYETMSKRACYGKIMGKIPVSEADA-PSSQAMIIKTEADTVIWIIDSSALKKMKDENIEL 993

Query: 1010 YVEVTLMVMCIKDTRFKELLGYTLVSA 1036
            Y+E+ L+VM IKD RFK LLG+ LVS 
Sbjct: 994  YLELVLLVMTIKDIRFKSLLGHALVST 1020

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1140 bits (2948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1062 (57%), Positives = 751/1062 (70%), Gaps = 40/1062 (3%)

Query: 2    GRTIRRRRSNSSLSEAISVSLGINQD----------------SSKNKMHRASVSAMS-PP 44
            G+    RR   S SEA+SVSLG+++                 S  N    +SVS      
Sbjct: 9    GQDSSNRRVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNREFGR 68

Query: 45   LCRSYMSGFFTGGSSPMVKNMS--DSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSS 102
            + RSY +G  +  S  +  N S  D  LP   K     I G + LHRQTA++SN+F  +S
Sbjct: 69   IGRSY-AGSISSNSPSLYLNTSRTDELLPI-RKMPSKSILGPDALHRQTAEISNDFNDTS 126

Query: 103  VEENSPTIXXXXXXXXXXXXXXXXXXXTIVENIDEEYSDEYSRLLLSP---ASSNVDDER 159
            ++E    I                       ++      E  +  LSP   ++S +D   
Sbjct: 127  MDE--AKIKRYIELLNRKQIEAEEEGEESAVHLRPHTFIE-GKSFLSPIGSSASQLDGLE 183

Query: 160  NRAL--QSGPISELEDDYGGGYQSLRPSHNLRFRPRNIWQWCTSFPFK---FAHYLPAAV 214
             RAL   S  I   E D    Y  +   +N   R ++     +SF  K     +YLPAA+
Sbjct: 184  QRALLTPSSSIVGNEFDLESTYDEINNDYNSILRIQSRELTSSSFATKGLELLNYLPAAI 243

Query: 215  LGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGS 274
            LGLLLNILDALSYGMIIFPITEP+FS LGPTGISMFYISTI+ Q V SGG+SSFP GIGS
Sbjct: 244  LGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVLSGGFSSFPCGIGS 303

Query: 275  EMIEITPFYHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGF 334
            EMIEITPFYHTMA A+KDAL   D+E+ITTTIFCYVISS++TG+VF++LGKL++GKIVGF
Sbjct: 304  EMIEITPFYHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLVFFMLGKLKMGKIVGF 363

Query: 335  FPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVI 394
            FPRHILIGCIGGVGYFLIITGIEV+TR+ KFEY+W F   L TN DTL KWLLP LLT+ 
Sbjct: 364  FPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLDTLGKWLLPTLLTLS 423

Query: 395  LIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHY 454
            LI  QR  +NSLVLP+FYILT++LFHFIVAI+P LSLD LRE GWIFP+ +S + WYDHY
Sbjct: 424  LILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWIFPVTDSKNSWYDHY 483

Query: 455  KLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSN 514
            K FN+H +HW LVL+QIPTM+ALTFFGILHVPINVPALAMSL MDKYDVDRELIAHGYSN
Sbjct: 484  KYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDKYDVDRELIAHGYSN 543

Query: 515  FFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGS 574
              SGLLGSVQNYLVYTNSVLFIRAGADSS AGFLL+ALT+ VM+ G VI+SFIP+CIVGS
Sbjct: 544  LISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAGSVIVSFIPVCIVGS 603

Query: 575  LIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDS 634
            LIFLLGYEL+VEALVDT   +  FEY+T++IIVF MG++DFVLGIIVGILIAC SF+VD 
Sbjct: 604  LIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGIIVGILIACLSFMVDG 663

Query: 635  TKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXX 694
            TKL+TINGEY+G VAKSTVYRDY+QTKFL+GI +QIY+LKLQNVLFFGT           
Sbjct: 664  TKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLFFGTIISIEEKIDKL 723

Query: 695  XXXXNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDR 754
                +KD  KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT  KRI+LIISSIKE+D+
Sbjct: 724  LEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGKRIQLIISSIKEKDK 783

Query: 755  IYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMA 814
            IY+ FN V LL DVELF DLNSALEWCENEFL+QY                 S  S    
Sbjct: 784  IYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRIHKRISISKDSGSTY 843

Query: 815  ATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKME 874
             ++N+      +GLS  +     + LMSLP NTPRN Q+LSVA+ VF N+ Q    FK  
Sbjct: 844  FSRNRS----DSGLSAADQ----QMLMSLPINTPRNNQVLSVARKVFKNEAQTASKFKTH 895

Query: 875  YKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADN 934
             + D+P+L +LL++++ +RPD+ SE  ++REKEI FW QL PYF R    + S L+++ N
Sbjct: 896  NETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLFPTGSTLVNSSN 955

Query: 935  IFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVI 994
             FF+VE+G+++ T++LPQG + E  SN TC+GK++     +    K+  +TET+S++W+I
Sbjct: 956  FFFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIFKTETESIIWMI 1015

Query: 995  DSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
            D  ++ ++K+ENL LY E+ L+VM I++ R+K L+GYTLVSA
Sbjct: 1016 DDDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1129 bits (2919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/895 (63%), Positives = 697/895 (77%), Gaps = 38/895 (4%)

Query: 148  LSPASSNVDDERNRAL--QSGPISELEDDY-GGGYQSLRPSHNLRFRP--RNIWQWCTSF 202
            LSP SS  + E+  +L     P S + D   G G  +    H+LR +P  R+ + +   +
Sbjct: 188  LSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLR-QPVVRSYYDYAKGW 246

Query: 203  PFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYS 262
              K  +Y+PA +LGLLLN+LDALSYGMIIFPITEPVFSHLGPTG+SMFY+STI+SQ VYS
Sbjct: 247  SIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYS 306

Query: 263  GGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVVFYV 322
             G+S+F +GIGSEMIEITPF+HTMAL++ ++L G+DDEII+TTI CY +SS+ TG+ F++
Sbjct: 307  CGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFL 366

Query: 323  LGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTL 382
            LGKLRLGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KFEYSWPF   LF N + L
Sbjct: 367  LGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVL 426

Query: 383  AKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFP 442
             KW+LP++LT+ LI TQ YF NSLVLP+FYI+TL LFHF+VAI+P LSL++LRE+GWIFP
Sbjct: 427  GKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFP 486

Query: 443  IANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYD 502
            +A S + WYD YKL++   VHW+LVL+Q+PTM+ALTFFGILHVPINVPALAMS+ MDK+D
Sbjct: 487  MAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFD 546

Query: 503  VDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPV 562
            VD+ELIAHGYSN  SG  GS+QNYLVYTNS LFIRAG+DSS+AGFLL   T  VM+IGPV
Sbjct: 547  VDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMIIGPV 606

Query: 563  IISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVG 622
            IISFIPICIVGSLIFLLGYEL+ EAL DTW KLNRFEY+T+VIIVFTMGVFDFVLGIIVG
Sbjct: 607  IISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVG 666

Query: 623  ILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFG 682
            ILIACFSFLVDSTKLQTINGE+NG VA+STVYRDY+QTKFL+ +GEQI+VLKLQN+LFFG
Sbjct: 667  ILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFG 726

Query: 683  TXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRI 742
            T               +KD+ ++RIKYLILDFKNINADNIDYSAAEGFNRIKRFT TKRI
Sbjct: 727  TIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRI 786

Query: 743  KLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXX 802
            +LIISSI E+DRIYNAFN VGLL DVELFADLNSALEWCENEFL QY             
Sbjct: 787  QLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQY------------- 833

Query: 803  XXXSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFV 862
                 + +   A  Q +K           + +  +++L  LP NTPRN Q+++VAQ +F 
Sbjct: 834  ---KQIRTRTKAKLQAQK----------KQEKHLSKSL--LPINTPRNNQIVTVAQKIF- 877

Query: 863  NDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRR 922
             DEQ V + + +Y+  EP+LP+LL ALK++RP I+S  + V++ E  FW++LCPYF R+R
Sbjct: 878  PDEQNVTHLRTQYQKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKR 937

Query: 923  LASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNA-MPREQKL 981
             A  SLLLH +N+FFLVE+GMLK TY+L QG  YE  S+ TC+G+I   GNA       +
Sbjct: 938  FAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGRI--SGNAEFTTNLYV 995

Query: 982  TIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
             I+TETD  +W+ID+++L  +KE+NLALY E+ L+VM I   R KELLGY+LVS+
Sbjct: 996  NIKTETDCAVWIIDATNLANLKEKNLALYAELLLVVMSINQYRSKELLGYSLVSS 1050

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (54%), Gaps = 8/102 (7%)

Query: 8   RRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPP------LCRSYMSGFFTGGSSPM 61
           +++  S+SEAI++SLG++ D+ K        S+M+P       L RSY+ G F+  S   
Sbjct: 4   KKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYV-GSFSSPSFLQ 62

Query: 62  VKNMSDSKLPFS-NKQHPTVIHGSENLHRQTAQLSNEFCSSS 102
            ++ +D+    S +K     IH S  LHRQTA LSN F  SS
Sbjct: 63  RESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSS 104

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1059 (55%), Positives = 741/1059 (69%), Gaps = 43/1059 (4%)

Query: 6    RRRRSNSSLSEAISVSLGINQDSSKNKMHRASV--------------SAMSPPLCRSYMS 51
            + RR +SS SEA+SVSLG+ +  +     RA+V              ++++ P   S M 
Sbjct: 6    KERRVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLESTNSLTLPDSMS-MK 64

Query: 52   GFFTGGSSPMVKNMS-------DSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVE 104
                  +  +V + S       DS  P  NK     I  ++ LHRQTA+LS  F  S+  
Sbjct: 65   NNTVNINDKLVPDNSKNRTFYNDSIYPPENKTSMKSITVADILHRQTAELSKTFYDSNFT 124

Query: 105  ENSPTIXXXXXXXXXXXXXXXXXXXTIVENIDEEYSDEYSRLLLSPASSNV-DDERNRAL 163
            +                        T    + +EY D++   + +  S N+ DDE++R L
Sbjct: 125  DKDVKDYIDIIDNDVATSNESDSNSTPEPYLGDEY-DQHRLAIRTQKSPNIADDEQSRLL 183

Query: 164  Q-SGPISELEDDYGGGYQSLRPSHNLRFRPRNIWQWCTSFPFKFA---HYLPAAVLGLLL 219
              S  I   E D    Y    P   +R    +I +   S    F+   HY PAAVLGLLL
Sbjct: 184  TPSSSIIGAELDLEAHYDEFEP---VRMDASSINRQNESKLIDFSQILHYFPAAVLGLLL 240

Query: 220  NILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEI 279
            NILDALSYGMIIFPITEP+F+++G  GISMFYIS+II Q + SGG+SSFP+GIGSEMIEI
Sbjct: 241  NILDALSYGMIIFPITEPIFANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEI 300

Query: 280  TPFYHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHI 339
            TPFYHTMALA+K++L+   +EII+TTIFCYVISS++TG+VFY LGKL+LGKIV FFPRHI
Sbjct: 301  TPFYHTMALAIKNSLDVQ-EEIISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHI 359

Query: 340  LIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQ 399
            LIGCIGGVGYFL++TG+EVTTRVAK EYSW F S L ++++ + KWL P+LLT ILI TQ
Sbjct: 360  LIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQ 419

Query: 400  RYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNV 459
             +F+NSLVLP+FYI+T++LFHFIVA++P LSL+ LR++GWIFP+ NS+ KW+DHYK FNV
Sbjct: 420  HHFQNSLVLPSFYIITIILFHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNV 479

Query: 460  HKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGL 519
            + V W L+L+Q+PTM+ALTFFGILHVPINVPALAMSL +DK+DVDRE IAHGYSNF SGL
Sbjct: 480  YNVSWVLILKQMPTMLALTFFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGL 539

Query: 520  LGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLL 579
             GSVQNYLVYTNSVLFIRAGADS  AG+LLI LT  VMLIGPVIISFIPICIVGSLIFLL
Sbjct: 540  FGSVQNYLVYTNSVLFIRAGADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLL 599

Query: 580  GYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQT 639
            GYELL+EAL+DT  K+  FEY T++IIVFTMG++DFVLGIIVGIL+AC  F+VD TKLQT
Sbjct: 600  GYELLIEALLDTVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQT 659

Query: 640  INGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXN 699
            IN EY+G +AKSTVYRD++Q+KFLDGIGEQIY++KLQNVLFFGT               +
Sbjct: 660  INTEYDGTIAKSTVYRDFIQSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSD 719

Query: 700  KDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAF 759
             D+ K RI+YLILDFKNIN DNIDYSAAEGFNRIKRFT  + IKLIISSI   D+IY AF
Sbjct: 720  SDSSKHRIRYLILDFKNINDDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAF 779

Query: 760  NNVGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNK 819
            N +GLL D+ELF+DLN+ LEWCEN++L +Y                     + M+  Q+K
Sbjct: 780  NKIGLLQDIELFSDLNNGLEWCENKYLEKYRELHEKAKKRL---------HSRMSILQDK 830

Query: 820  KIDG--LGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKN 877
             I    + +  S G     ++ LMSLP NTPRN+Q+LSVA+NVF N+ QAV  FK     
Sbjct: 831  NISSRQINSTSSDGNEYQSSQRLMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNG 890

Query: 878  DEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFF 937
            ++    +LL +++++RPD+ SE + +R +EIKFW QL PYF +  + + S  L+ +N FF
Sbjct: 891  EDAFTQLLLQSIRRFRPDVFSESKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFF 950

Query: 938  LVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSS 997
            L+++G++K T++L  G L E   + T +G + +  N   +  K+T   ET SV+W+IDS 
Sbjct: 951  LLDSGVIKVTHDLAPGKLSETMLSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSE 1010

Query: 998  SLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
             LKKM++ENL LY E+TL++M I D RFK LLGYTLV+A
Sbjct: 1011 GLKKMEKENLKLYSELTLLIMSISDYRFKALLGYTLVNA 1049

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/918 (59%), Positives = 679/918 (73%), Gaps = 31/918 (3%)

Query: 132  VENIDEEY--SDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQS-------- 181
            ++ +DE+   +DEYSRLL +P+ S  DDE      S    +  D     Y S        
Sbjct: 251  IQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSSIPTTTD 310

Query: 182  LRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSH 241
            +  S +L F+        T    +  H +PA +LGLLLNILDALSYGMI+FPIT+ VF H
Sbjct: 311  VTQSTSLSFK-----DMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGH 365

Query: 242  LGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGND-DE 300
            LGPTG+SMFYISTIISQ VYSGG+S+FPSG+G EMIEI PF+HTMAL VK+++   D +E
Sbjct: 366  LGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNE 425

Query: 301  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVIS + TG+VF+ LGK +LGK+VGFFPRHILIGCIGGVGYFLI+TGIEVTT
Sbjct: 426  IITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTT 485

Query: 361  RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH 420
            RV K EYS  F   + TN  TL K +LP+ L+V+L   Q+ + +SL+LP+FYI+T + FH
Sbjct: 486  RVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFH 545

Query: 421  FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVA++P LSLD+LR  GWIFP+A S   WY HYK FN    HW LV +QIPTM ALTFF
Sbjct: 546  FIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFF 605

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMS+QMDKYDVD+ELIAHGYSN  SGL GSVQNYLVYTNSVLFIRAG 
Sbjct: 606  GILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGG 665

Query: 541  DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600
            +++ AG +L   T  ++ IGPVIISFIP+CIVGSLIFLLG+EL+VEAL+DTW K+ +FEY
Sbjct: 666  NTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEY 725

Query: 601  LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660
            +T++IIVFTMG++DFVLGI+VGILIACFSFLVDSTKLQT+NGE+NG VAKSTVYRDYVQ+
Sbjct: 726  ITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQS 785

Query: 661  KFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINAD 720
            +FL GI EQIYVLKLQNVLFFGT               + D+ KRRIKYLILD KN+N+D
Sbjct: 786  QFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSD 845

Query: 721  NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFT +KRI+LIISSIK+ D+IY  FNNV LL +VELF+DLN ALEW
Sbjct: 846  NIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEW 905

Query: 781  CENEFLFQYXXXXXXXXXXXXXXXXSS--VASAIMAATQNKKIDGLGNGLSTGENRDHAR 838
            CENEFL+QY                S   V +  ++ + +  ++          +R  + 
Sbjct: 906  CENEFLYQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLN----------DRKSSG 955

Query: 839  NLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIIS 898
            N   LP NTPRN+QM+SVA+N+F N EQ V++F        P+L +L+FALKQYR DI S
Sbjct: 956  N---LPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFS 1012

Query: 899  EIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEI 958
            +   VR+KE++FW+QLCPYFT++ LA+++ LLH +N+FF+VE+G+LK  + LPQG++YE 
Sbjct: 1013 DDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYET 1072

Query: 959  FSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVM 1018
             SN TC+G+I+  G        L I+ ETD ++W+I+S  L KMK ENL LY E+TL+VM
Sbjct: 1073 MSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVM 1132

Query: 1019 CIKDTRFKELLGYTLVSA 1036
             +KD RF  LLGY L+SA
Sbjct: 1133 SVKDDRFNNLLGYALISA 1150

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 59/149 (39%), Gaps = 53/149 (35%)

Query: 8   RRSNSSLSEAISVSLGINQDS------------------SKNKMHRASVSAMSPPLCRSY 49
            R  + LSEAIS+SLG+ +                    + ++  R    ++ P L R+ 
Sbjct: 13  NRERNKLSEAISISLGLQEQQGNDNDKYNNDNSNIHGTLNNSRQRRKPSISLDPTLSRNI 72

Query: 50  MSGFFTGG------------SSPMVK-----------------NMSDSKLPFSNKQHPTV 80
            +  F  G            ++ M                   N ++  LP  N    + 
Sbjct: 73  GARSFNCGAFLSRSIDNNLPTTDMFNSSTFRSSNSNNYFTHGLNSNNDHLPVINPFPKSS 132

Query: 81  IHGSENLHRQTAQLSNEFCSSSVEENSPT 109
           IHGS+NLH++TA++SNEF       NSPT
Sbjct: 133 IHGSDNLHKRTAEISNEF------NNSPT 155

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/1055 (54%), Positives = 723/1055 (68%), Gaps = 74/1055 (7%)

Query: 7    RRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSP--------P---LCRSYMSGFFT 55
            R R+  SLSEAISVSLG+ Q    ++    SV   +P        P   L RSY++    
Sbjct: 5    RPRNKHSLSEAISVSLGL-QSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANL-- 61

Query: 56   GGSSPMV--KNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSS--------SVEE 105
                P+   +  S      S  +    IH S +L RQTA LSNEF  +         + E
Sbjct: 62   -SPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLAE 120

Query: 106  NSPTIXXXXXXXXXXXXXXXXX--XXTIVENIDEEYSDEYSRLLLSPASSNVDDERNRAL 163
            N  T                      ++++N D       S LLL P +        R L
Sbjct: 121  NGNTAVPDESVMAGSAISPTSSGPEPSVLDNTD------VSNLLLPPNT-------QRDL 167

Query: 164  QSGPISELEDDYGGGYQSLRPSHNLR-FRPRNIWQWCTSFPF-KFAHYLPAAVLGLLLNI 221
            + G I E +  Y    QS R   N R   P    +  T F F +  +Y+PA +LGLLLNI
Sbjct: 168  EYGSIDEFDHQY-VSLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVILGLLLNI 226

Query: 222  LDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITP 281
            LDALSYGMIIFPITEP+FSHLGP+G+SMFY+S+++SQ VYS G+S+F + +GSEMIEITP
Sbjct: 227  LDALSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITP 286

Query: 282  FYHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILI 341
            FYH+MA ++  ++ G  D ++TTTI CY +SS++TG+VF++LG+L+LGKIVGFFPRHILI
Sbjct: 287  FYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILI 346

Query: 342  GCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRY 401
            GCIGGVGYFL+ITG EVTTR +KFEYS+ F S L T+ + L KW LP L+ V+L+  QR 
Sbjct: 347  GCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRA 406

Query: 402  FKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHK 461
             KNSLVLPTFYI  L+LFHFIVA+IP+LSL +LR++GW+FP   +   W+D YKL+N   
Sbjct: 407  CKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKL 466

Query: 462  VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521
            V W LVL+Q+PTM+ALTFFGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++G
Sbjct: 467  VSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIG 526

Query: 522  SVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGY 581
            SVQNYLVYTNS+LFI+AGAD S AG +L A T  +M+IGPVI+++IP+CIVGSLIFLLGY
Sbjct: 527  SVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGY 586

Query: 582  ELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTIN 641
            ELL EALVDTW KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQTIN
Sbjct: 587  ELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTIN 646

Query: 642  GEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKD 701
            GE++G VA+STV RDY+QT+FL+ IGEQI+VLKLQN+LFFGT               +KD
Sbjct: 647  GEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKD 706

Query: 702  AKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNN 761
            A K+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK  DRIY AFN 
Sbjct: 707  ASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNK 766

Query: 762  VGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKI 821
            VG L+ VELF DLNSALEWCENEFL Q+                      +   T+ K +
Sbjct: 767  VGTLDGVELFDDLNSALEWCENEFLRQFRD--------------------LRNKTKLKAV 806

Query: 822  DGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPI 881
                  LS G          +LP NTPRN   +SVAQ +F  DEQ++ + K  YK   P+
Sbjct: 807  RKQERQLSKG----------ALPFNTPRNNHFVSVAQKLFT-DEQSMPHLKTHYKEKTPV 855

Query: 882  LPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVET 941
            L +LL AL++YRP+I+S  + V+E E K W++L  +F +RRLA+QSLL H +NIF +VE+
Sbjct: 856  LHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVES 915

Query: 942  GMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKK 1001
            GM+K TY L QG LYEI S  TC+G+I AP ++      + I+ ETD  LW++D ++L K
Sbjct: 916  GMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDEANLAK 975

Query: 1002 MKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
            +K+ENLALY E+ L+ +C+   R KELLG+ LVS+
Sbjct: 976  LKKENLALYTELLLVTLCMNQDRLKELLGHCLVSS 1010

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/1077 (53%), Positives = 723/1077 (67%), Gaps = 117/1077 (10%)

Query: 7    RRRSNSSLSEAISVSLGI----------------------NQDSSKNKMHRASVSAMSPP 44
            R ++  S+SEAISVSLG+                         S    + R+ V+ +SPP
Sbjct: 5    RPKNKPSISEAISVSLGLQSQSNSDQDSSYIPRANPFSHTGDGSPHYYLGRSYVANLSPP 64

Query: 45   -LCRSYMSGFFTGGSSPMVKNMSDSKLPFSNK-QHPTVIHGSENLHRQTAQLSNEFCSSS 102
             L R  + G   G            +LP S + +    IH S +L RQTA LSNEF  + 
Sbjct: 65   PLAR--LPGGLPG------------ELPLSYRPEQSQSIHQSVSLRRQTAALSNEFEDTF 110

Query: 103  VEENSPTIXXXXXXXXXXXXXXXXXXXTIVENIDEEYSDEYSRL---LLSPASS------ 153
              E+                        + E+     + E   +   L+SP SS      
Sbjct: 111  EFEDQ--------------------LAGVSEDDGHSTTAEEPSMNGTLISPVSSVPDTPI 150

Query: 154  NVDDERNRALQSGPISELE----DDYGGGYQSLRP------SHNL----RFRPRNIWQWC 199
            ++++  N  L      +LE    D Y   Y SL+       +HN+      R + ++   
Sbjct: 151  DINEPSNALLPPNAEHDLEYGSIDGYEHQYVSLQSRRSGANTHNIGPDASLREKMMFT-- 208

Query: 200  TSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQA 259
                 +  +Y+PA +LGLLLNILDALSYGMIIFPITEP+FSHLGPTG+SMFY+S+IISQ 
Sbjct: 209  ---ARRMVNYMPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQL 265

Query: 260  VYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVV 319
            +YSGG+S+F + +GSEMIEITPFYH MA ++   L G  D +++TTI CY +SS++TG+V
Sbjct: 266  IYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSSIITGLV 325

Query: 320  FYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNY 379
            F++LG+LRLGKIVGFFPRHILIGCIGGVGYFL+ITG+EVTTRVAKFEYS+ F S LFTN 
Sbjct: 326  FFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFLSSLFTNI 385

Query: 380  DTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGW 439
            + L KW LP L+ V+L+  Q  F NSLVLP FYI  L+LFHFIVA+IP+LSLD LR++GW
Sbjct: 386  EVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGW 445

Query: 440  IFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD 499
            IFP  +S   W+D Y L+N   V W ++L+QIPTM+ALTFFGILHVPINVPALAMS+ +D
Sbjct: 446  IFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLD 505

Query: 500  KYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLI 559
            K DVD+ELIAHGYSNF SG++GSVQNYLVYTNSVLFIRAG D + AG +L A T  +M++
Sbjct: 506  KLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAATFGIMIV 565

Query: 560  GPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGI 619
            GPVI+++IP+CIVGSLIFLLGYELL EAL DTW KLN FEY TVV IVFTMG FDFVLGI
Sbjct: 566  GPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGI 625

Query: 620  IVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVL 679
            IVGILIACFSFLVDSTKLQT+NGE++G VA+STV RDY+QT+FL+ IGEQI+VLKLQN+L
Sbjct: 626  IVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLL 685

Query: 680  FFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGT 739
            FFGT               +KD+ K+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +
Sbjct: 686  FFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSS 745

Query: 740  KRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXX 799
            KRI LIISSIK  DRIY AFN VG+L  VELF DLNSALEWCENEFL Q+          
Sbjct: 746  KRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDL------- 798

Query: 800  XXXXXXSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQN 859
                             +NK        L  G+ +D   + + LP NTPRN Q +SVAQ 
Sbjct: 799  -----------------RNK------TKLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQK 835

Query: 860  VFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFT 919
            +F  DEQ++ + K  Y+   P+LP+LL AL+++RP I+S  ++V+E E + W+ LC YF 
Sbjct: 836  LF-TDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFY 894

Query: 920  RRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQ 979
            ++RLA+ SLLLH DNIFF++ETGM+K TY L QG LYE  S  TC+G++  P N      
Sbjct: 895  KKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSIPNNNNNPIS 954

Query: 980  KLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
             + +E ETD  LW+ID + L K+K ENL LY EV L+ +CI   R KELLG+ LVS+
Sbjct: 955  CVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/911 (55%), Positives = 641/911 (70%), Gaps = 55/911 (6%)

Query: 138  EYSDEYSRLLLSPASSN---------VDDERNRALQSGPISELEDDYG-GGY--QSLRPS 185
            + SD    L L P +S+          D+E   A Q   IS L D    GG+  Q  R S
Sbjct: 191  DVSDSTENLALLPTNSHNSMYVEYGTFDEENQPATQY--ISLLPDGASSGGFTSQGFRSS 248

Query: 186  HNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPT 245
             +   + R++         +   Y PA  LGLLLNILDALSYGMIIFPITEP+FSHLGPT
Sbjct: 249  MSHYDKARDLM-------LRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPT 301

Query: 246  GISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDAL-EGNDDEIITT 304
            G+SMFY+ST+I Q  +S G SSFPS IGSEMIEITPF+HTMAL++ +++ EGND+++I+T
Sbjct: 302  GLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVIST 361

Query: 305  TIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
            TI CY +SS++TG+ F++LGK+RLGKIVGFFPRHILIGCIGGVGYFLIITG+EV TRV +
Sbjct: 362  TIVCYALSSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPE 421

Query: 365  FEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVA 424
            F+YSW F S LFT++D L KWL PV+LT+ILI  Q    NSLVLP+FYI+TL+LFHF+VA
Sbjct: 422  FKYSWQFLSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVA 481

Query: 425  IIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILH 484
            ++P+LSLD LR+ GWIF   N+   WYD YKL++   V WSL+ +Q+PTM+ALTFFGILH
Sbjct: 482  LVPSLSLDKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILH 541

Query: 485  VPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSF 544
            VPINVPALAMSL +DKYDVD+ELIAHGYSN  SG LGS+QNYLVYTNSVLFIRAGADS  
Sbjct: 542  VPINVPALAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPI 601

Query: 545  AGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVV 604
            AG +L   T  VM+IGPVIISFIPICIVGSLIFLLGYEL+ EA++DTW KL  FEYLT+ 
Sbjct: 602  AGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIW 661

Query: 605  IIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLD 664
            IIV TMGV DFV+GIIVGIL+ACFSFLV+ST+LQTINGEY+G VAKSTVYRDY+Q+KFL 
Sbjct: 662  IIVITMGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLR 721

Query: 665  GIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKDAKKRRIKYLILDFKNINADNIDY 724
             IGEQIYVLKLQN+LFFGT                 D+ K+RIKYLILDFKNI A +IDY
Sbjct: 722  NIGEQIYVLKLQNILFFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSIDY 781

Query: 725  SAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENE 784
            SAAEGFNRIKRF   +RI LIISSI + D+IY AF+ V L  +VELF+DLN ALEWCENE
Sbjct: 782  SAAEGFNRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENE 841

Query: 785  FLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLP 844
            FL +Y                      I   T+ +K+      L   +NR     +  LP
Sbjct: 842  FLMRY--------------------KRIRTKTRARKL----AQLKKSQNR-----MSKLP 872

Query: 845  TNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVR 904
             NTPRN+Q +S  +N++  +E  ++    E K  +  LPI L +++++R  I S  +  R
Sbjct: 873  VNTPRNHQFVSEVRNIYT-EEMEIQKLSNELKERQQFLPIFLMSIRKFRNAIQSPNELKR 931

Query: 905  EKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTC 964
              E+  W +L  YF +++    + + H +N+F +VE+G+L  T+ L QG  YE  S  T 
Sbjct: 932  TNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTA 991

Query: 965  FGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTR 1024
            +G +I+  N+ P    ++I T+T+ VL  ID+ SL  +K  +  L+ E+ ++VM I   R
Sbjct: 992  YG-VISNVNSDPL--AVSITTDTECVLRYIDAESLADLKLTDPELFTELLILVMAIHRDR 1048

Query: 1025 FKELLGYTLVS 1035
            F+ELLGY+L+S
Sbjct: 1049 FRELLGYSLIS 1059

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 41/86 (47%), Gaps = 19/86 (22%)

Query: 28 SSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSPM--------------VKNMSDS-KLPF 72
          ++KN+ +   +   S  L RSY+  F    S PM                N+ D  K PF
Sbjct: 17 TAKNRKYSFQMPTTSTYLGRSYVGSFI---SPPMEYRSNSNTTSNNNNNSNVGDPFKSPF 73

Query: 73 SNKQHPTVIHGSENLHRQTAQLSNEF 98
          S+ +   +IH S NLH+QTA LSN F
Sbjct: 74 SS-EGSKLIHESGNLHKQTAFLSNTF 98

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1059 (49%), Positives = 666/1059 (62%), Gaps = 93/1059 (8%)

Query: 13   SLSEAISVSLGINQDSSKNKMHRASVSAMSPPLCR-------SYMSGFFTGGS----SPM 61
            S+SEA+++ L I    S        VS   P L R       SY+  F   GS       
Sbjct: 15   SISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSREAG 74

Query: 62   VKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNE---FCSSSVEENS----------- 107
                    LP    Q  + +H   +LHRQTA L ++   +     EE +           
Sbjct: 75   AAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVFEGNMILQE 134

Query: 108  ---PTIXXXXXXXXXXXXXXXXXXXTIVENIDEEYSDEYS--RLLLSPASSNVDDERNRA 162
               P                      + E +D+  SD+ +  RL LSP +++        
Sbjct: 135  GAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTDYIHSYGAI 194

Query: 163  LQSGPISELEDDYGGGYQSLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNIL 222
             +    SE       G   LR              W T    +   Y+PA +LGLLLNIL
Sbjct: 195  NEEQSASETASRAETGPSPLR-------------LWGT----RTVRYIPAVILGLLLNIL 237

Query: 223  DALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPF 282
            DALSYGMIIFPI EP+FSHLGP G+SMFY+STIISQ VYSGG+SSF  G GSEMIE+TPF
Sbjct: 238  DALSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSFGYGTGSEMIEVTPF 297

Query: 283  YHTMALAVKDALEG-NDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILI 341
            +HTMAL++K++L     D+IITTTI CY +S+++TG VF  LGKLRLGK+V FFP HILI
Sbjct: 298  FHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILI 357

Query: 342  GCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRY 401
            GCIGGV YFLIITGIEV+TRV KFEYS  F   LF + D LAKWL+P LL V +I  QR 
Sbjct: 358  GCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRR 417

Query: 402  FKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHK 461
              NS++LP FY+    LFHFIVA+IP+LSLDTLR+ GWIFP+  S  +WYD+ +L+N  +
Sbjct: 418  IHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQR 477

Query: 462  VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521
            +HW LVL +IPTM+ALTFFGILHVPINVPALA+S  +DK DVD+ELIAHGYSN FSG  G
Sbjct: 478  IHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAG 537

Query: 522  SVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGY 581
            S+QNYLVYTNSVLFIRAGADS +AGFLL   T   M  GP IIS IP+CIV SLIFLLGY
Sbjct: 538  SIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISIIPVCIVSSLIFLLGY 597

Query: 582  ELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTIN 641
            ELL E L D++N+L+ FEY+TVVII+ TMG+FDFVLGIIVG+L+ACFSFLV+ST+ +TI+
Sbjct: 598  ELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTIS 657

Query: 642  GEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKD 701
             E++G VAKS  +RDY+Q+ FL+ + EQIYVLKLQN LFFGT               N  
Sbjct: 658  SEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGT-IISIEEKIGNLLEPNGS 716

Query: 702  AKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNN 761
              K+ IKYLILDFK+IN DNIDYSAAEGFNRIKR    KRIKLI+SSI E D+IY  F+ 
Sbjct: 717  EYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSK 776

Query: 762  VGLLNDVELFADLNSALEWCENEFLFQYXXXXXXXXXXXXXXXXSSVASAIMAATQNKKI 821
            +GLL DVELF DLNSALEWCENE L +Y                     ++++     K+
Sbjct: 777  IGLLQDVELFQDLNSALEWCENELLCEY--------------------RSLLSRAHRVKV 816

Query: 822  DGLGNGLSTGENRDHARNLM---SLP-TNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKN 877
                        R  +++++    +P  NTPRN Q+++ AQ V+  ++Q  K    +YK 
Sbjct: 817  ------------RRRSKDIVPKAQIPLENTPRNAQIMTAAQAVYSGEQQLNKTLS-KYKA 863

Query: 878  DEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFF 937
              P L +LL ALK YR    S       KEI+ W  LCPYF R+  + Q+ +    ++FF
Sbjct: 864  SHPALALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFF 919

Query: 938  LVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSS 997
            +VE+G+LK TY LPQG+L E  ++ TC+G I  PG+         + TET+ VLW+ID+ 
Sbjct: 920  VVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSL---SYSSVVRTETECVLWMIDAP 976

Query: 998  SLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036
             L+K++EENL LY E+ ++ + +   RFKELLG++L++ 
Sbjct: 977  GLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 86/362 (23%), Positives = 157/362 (43%), Gaps = 33/362 (9%)

Query: 286 MALAVKDALE---GNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIG 342
           ++L V  A E    +D EI T TI   +  + ++GVV + LG +RLG +     + +L G
Sbjct: 149 ISLVVGQATEKFSAHDSEISTVTITMMI--TFISGVVLFFLGSVRLGFLGNILSKALLRG 206

Query: 343 CIGGVGYFLIITGIEVTTRV------AKFEYSWPFFSGLF-----TNYDTLAKWLLPVLL 391
            I  VG  +II  + +  ++          Y  P    +F     + Y      +L ++ 
Sbjct: 207 FISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLFRYASEYYHKPTAILSLIC 266

Query: 392 TVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLD-TLREAGWIFPIA--NSDS 448
            ++LI T R  K  L+    +++ +     +V++   LSL    + +  I  I   N+D 
Sbjct: 267 FLVLIST-RIAKKKLMNRYRFLIFVPEILLVVSVTILLSLKYDFKHSYGISTIGEFNADG 325

Query: 449 KWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD---KYDVDR 505
                  L N ++  +S +  +   +  L FF            + SL  D    Y  +R
Sbjct: 326 FGSIGNPLSNENRALYSSLWNEGLAVAMLGFF-------ESTTASKSLGSDYNLTYSSNR 378

Query: 506 ELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIIS 565
           ELIA G+ N    L G++ ++  Y  S + + +G  +  +G ++  +T+    +   +I 
Sbjct: 379 ELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIH 438

Query: 566 FIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY--LTVVIIVFTMGVFDFV-LGIIVG 622
           + P C++  +  ++G  LL E   D    ++   Y  LTV  + F   +   V LG+ VG
Sbjct: 439 YTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTFIATLSQSVELGVTVG 498

Query: 623 IL 624
            +
Sbjct: 499 CI 500

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 9/128 (7%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGF---LLIALTICVMLIG 560
           +REL+A G  N FS +LGS+  +  Y  S +   +GA +  +G    LL+ LTI  +L  
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLL-- 450

Query: 561 PVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVL-GI 619
             +I +IPIC++  +  ++G  LL EA  D       F Y    ++VFT+ V   +   +
Sbjct: 451 -PMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDE--LLVFTLTVLTTMFYSV 507

Query: 620 IVGILIAC 627
            VGI I C
Sbjct: 508 EVGICIGC 515

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 89/393 (22%), Positives = 153/393 (38%), Gaps = 63/393 (16%)

Query: 286 MALAVKDALEG--NDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGC 343
           ++L V  A+E     D  +  T  C V++  ++G + +  G +R G +     R +L G 
Sbjct: 160 ISLVVGQAIEKLTKHDASLNVTNLCVVLT-FISGSILFSFGLMRFGFLDSVLSRALLRGF 218

Query: 344 IGGVGYFLIITGI------EVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVIL-- 395
           I  VG  ++I  +      + T + A   Y  PF   +F  +   A + LP  L  ++  
Sbjct: 219 ISAVGLIMVINSLISELKLKDTFKNAPGHYHAPFQKVVFLVHYAPANYHLPTALVSLVCF 278

Query: 396 --IGTQR--------------YFKNSLVLPTFYILTLVLFHF-------IVAIIPTLSLD 432
             +G  +              +F + LV+  F  L    + F       IV  I T S +
Sbjct: 279 AALGALKVIKKKLVKRFKKVIFFPDILVVVAFATLVSYCYDFKVRYNIDIVGDIETGSSN 338

Query: 433 TLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPAL 492
           T++      PI+       D+ KLFN    H   ++            G         +L
Sbjct: 339 TIKN-----PISK------DNLKLFN-DLFHAGFLV---------ALLGFFESTTASKSL 377

Query: 493 AMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIAL 552
             +  +     +REL+A G  N    L G++ ++  Y  S +   +GA +  +G  +  +
Sbjct: 378 GTNYDL-AISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLI 436

Query: 553 TICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVD---TWNKLNRFEYLTVVIIVFT 609
           T+         I  IPIC++  +  ++G  L  EA  D    +      E LT  I V T
Sbjct: 437 TLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELLTFAITVLT 496

Query: 610 MGVFDFVLGIIVGILIACFSFLVDSTKLQTING 642
                F   +  GI + C   ++ + K  T +G
Sbjct: 497 T----FFYSVEAGITLGCGYSIIRAIKNSTQSG 525

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 110/531 (20%), Positives = 199/531 (37%), Gaps = 84/531 (15%)

Query: 292 DALEGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFL 351
           + L  ++ EI T +I   V+ + ++G+  +V G  R G +     R +L G I  VG  +
Sbjct: 166 EKLRAHNHEISTMSI--SVLVTFISGMFLFVFGICRFGFLGNVLSRALLRGFISSVGVVM 223

Query: 352 IITGI------EVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPV----LLTVILIGTQRY 401
           I+  +             K  +  PF    F      A + +P     L   I++ T R 
Sbjct: 224 IVNSLISELKLHKLLLETKGHFHTPFQKIRFIIKYAPANYHIPTAVLSLTCFIILVTARV 283

Query: 402 FKNSLVL----PTFYILTLVLF--------------HFIVAIIPTLSLDTLREAGWIFPI 443
            K  L+     P F    L+L               H+ ++I+     D L    +  PI
Sbjct: 284 IKKKLMRRRRWPVFVPEILILIITTIILSHKFKFKKHYEISIVGDFDTDGL--VNFYNPI 341

Query: 444 ANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTF----FGILHVPINVPALAMSLQMD 499
           + S+ +                      P +M   F     G         +L  + +  
Sbjct: 342 SKSNREL--------------------APNLMNAGFIVAILGFFESTTAAKSLGSAYEF- 380

Query: 500 KYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLI 559
               +REL+A G  N  + +LG++  +  Y  S +   +GA +  +G  +  + +  +  
Sbjct: 381 AISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKF 440

Query: 560 GPVIISFIPICIVGSLIFLLGYELLVEALVD---TWNKLNRFEYLTVVIIVFTMGVFDFV 616
               I +IP+CI+  +  ++G  LL EA  D    +N     E L   + V T   +   
Sbjct: 441 FLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLE 500

Query: 617 LGIIVGILIACFSFLVDSTK--LQTING-EYNGNVAKSTVY-------RDYVQTKFLDGI 666
           +G+ +G   +  S +  S K  +Q +   E  G    S  Y        D    + L+G 
Sbjct: 501 MGVCIGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEG- 559

Query: 667 GEQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXN-------KDAKKRR-IKYLILDFKNIN 718
                V+K+   L F                 +       K +++R  IKYL+ D   + 
Sbjct: 560 ---CLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMT 616

Query: 719 ADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVE 769
              +D SAA+    I +    +R+K+ ++ +   +++ +      +LN VE
Sbjct: 617 F--MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 115/551 (20%), Positives = 209/551 (37%), Gaps = 91/551 (16%)

Query: 286 MALAVKDALEG--NDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGC 343
           ++L V  A+E     D  +++   C +I+  ++GVV +  G  R G +     R  L G 
Sbjct: 172 ISLVVGQAIEPMIRHDPSLSSLDLCVIIT-FISGVVLFTFGVFRFGFLDNVLSRAFLRGF 230

Query: 344 IGGVGYFLIITGIEVTTRVAKF------EYSWPFFSGLF------TNYDTLAKWLLPVLL 391
           I  VG  ++I  + V  ++ K        Y  PF   LF       NY  L   LL +  
Sbjct: 231 ISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFLIKYAPANYH-LPTSLLSLCC 289

Query: 392 TVILIGTQRY-------FKNSLVLPT--FYILTLVLFHF-----------IVAIIPTLSL 431
            +IL+  +         F++ +  P     ++T++ F +           +V  I     
Sbjct: 290 FLILMSLRLIKKKLLKRFRSLVFFPEILLVVVTVIFFSYNFDLKHRYNIEVVGDIEASVF 349

Query: 432 DTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPA 491
           D LR      P++ +   +Y    LF+               M+A+   G         +
Sbjct: 350 DKLRN-----PLSKNKRPFYG--DLFSAG------------FMVAM--LGFFESTTASKS 388

Query: 492 LAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIA 551
           L  +  +     +REL+A G  N    L G++ ++  Y  S +   +GA +  +G  +  
Sbjct: 389 LGTAYDL-AVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGT 447

Query: 552 LTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY---LTVVIIVF 608
           +T+  +      I +IP+C++  +  ++G  LL EA  D    +    Y   ++ +I V 
Sbjct: 448 ITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITVL 507

Query: 609 TMGVFDFVLGIIVGILIACFSFLVDSTK-----LQTING--------EYNGNVAKSTVYR 655
           T   +    GI VG   +    +  STK     L  + G        EY G  + S   R
Sbjct: 508 TTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEGKNSTSE-RR 566

Query: 656 DYVQTKFLDGIGEQIYVLKLQNVLFFGTXXXXXXX--------XXXXXXXXNKDAKKRRI 707
              Q + ++G      ++++   L F                          +   +   
Sbjct: 567 VNPQLEEIEG----CLIVRIPEPLTFTNTDDLKTRLNRLELYGSTKTHPAAPRSRDQEMT 622

Query: 708 KYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLND 767
           KY+I D   +    ID SA +    I      + + + +  +    ++ N F N G+L  
Sbjct: 623 KYVIFDLHGMT--TIDSSAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRFVNSGILEM 680

Query: 768 VELFADLNSAL 778
           VE  +D++ +L
Sbjct: 681 VE--SDIHRSL 689

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 77/345 (22%), Positives = 134/345 (38%), Gaps = 32/345 (9%)

Query: 315 LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT------------------GI 356
           ++G + + +G  R+G I     +  L G +  +   ++IT                  G 
Sbjct: 72  VSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELLPELKLEELYAHYVAQGY 131

Query: 357 EVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTL 416
             TT   KF +          N DT   W L  L T IL+ T RY K  L     +   +
Sbjct: 132 IGTTTWEKFRF---ILEKAPENSDTFT-WNLS-LFTFILLMTIRYLKRHLAEKCGWKKCI 186

Query: 417 VLFHFIVAIIPTLSLDTLREAGWI--FPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTM 474
                ++ ++ +++L   ++   +    I        DH K   V    +S   +   T 
Sbjct: 187 FFPEILIVVVGSITLSNTQKWSELKGIKIIGDIPPNSDHIK---VPVQTFSEFKELFGTS 243

Query: 475 MALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVL 534
             +   G+    I   ++  +  +D    +REL++ G  N  S +  ++  +  Y  S +
Sbjct: 244 ALIAMLGLFESTIVFKSVCSNSNVDASS-NRELVSLGVVNLVSSIFSALPAFGGYGRSKM 302

Query: 535 FIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDT--- 591
            I  GA + F+G  +  L I  M         +PICI+  +I  + + LL EA  D    
Sbjct: 303 NISCGAQTQFSGVFVSLLAIICMNFLMNAFHHLPICILAVIISTVAFSLLEEAPADLMFY 362

Query: 592 WNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTK 636
           W+     E    +IIV T  V+    G+ +G+ +     L  ST+
Sbjct: 363 WSVGGYQELFIFIIIVVTTLVWSPQFGVTMGMCLTMIRLLKHSTR 407

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 71/331 (21%), Positives = 139/331 (41%), Gaps = 35/331 (10%)

Query: 306 IFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF 365
           I   +  ++++G +  + G  RLG +     + +L G IG VG+ +II  +    ++   
Sbjct: 206 ILIVIAVTLISGTILLISGIFRLGYLGNILNKALLHGFIGSVGFVMIIDSLINELKLGDI 265

Query: 366 ------EYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQ----RYFKNSLV-------- 407
                  Y+ PF   +F        + +P  L   +        R FK  L+        
Sbjct: 266 LADTPEHYNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIF 325

Query: 408 LPTFYIL--TLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWS 465
           +P   I+  T+++  + +    T  +D L +       +N +S +++     N   +H  
Sbjct: 326 IPEILIVLTTVLILSYKLDFADTYDIDILGDFK-----SNENSIFHNPLSNKNRGLIH-- 378

Query: 466 LVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQN 525
            V+  I  + A+  FG         AL  S +      +REL+A G SN     LG++ +
Sbjct: 379 -VVFNIGIITAI--FGFFESTTASKALGASSER-SVSSNRELVALGLSNIVISTLGALPS 434

Query: 526 YLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLV 585
           +  Y  S +   +G  +  +G  +   TI  +L    +I +IP+CI+  +  ++G+ LL 
Sbjct: 435 FGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLE 494

Query: 586 EALVDT---WNKLNRFEYLTVVIIVFTMGVF 613
           E   +    W +   +  L ++++ F   +F
Sbjct: 495 EIPKEVSFHW-RCRGYNELFLIVLTFMTSIF 524

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 117/551 (21%), Positives = 213/551 (38%), Gaps = 52/551 (9%)

Query: 259 AVYSGGWSSFPSGI-GSEMIEITPFYHTMALAVKDALEG---NDDEIITTTIFCYVISSM 314
            +YS   S F  GI GS    I      ++L V  A+E    + D +  + I   ++ + 
Sbjct: 142 GLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKDNV--SLIDISIVITF 199

Query: 315 LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYS 368
           ++G +    G  R G +     + +L G I  VG  +II  +    ++ KF       Y 
Sbjct: 200 VSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYH 259

Query: 369 WPFFSGLFTNYDTLAKWLLPVLL----TVILIGTQRYFKNSLVL--PTFYILTLVLFHFI 422
            PF   LF      A++  P  +      I++   R  K  L+    +      +L   I
Sbjct: 260 TPFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMRLLKKKLMKRHKSAVFFPDILLVVI 319

Query: 423 VAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGI 482
           V I+ ++ L +L++   I  + +     +D  K    H     L+       + +   G 
Sbjct: 320 VTILISMKL-SLKQRYGISIVGDFSMDNFDKLKNPLTHS-RRKLMPDLFSASLIVAMLGF 377

Query: 483 LHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADS 542
                   +L  +  +     +REL+A G  N F  L G++ ++  Y  S +   +GA S
Sbjct: 378 FESTTASKSLGTTYNL-TVSSNRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQS 436

Query: 543 SFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLT 602
             +G  +  +T+  M +    + +IP C++  +  ++G  LL E   D    L    Y  
Sbjct: 437 VMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSE 496

Query: 603 VVIIVFTMGV---FDFVLGIIVGILIACFSFLVDSTK-----LQTINGEYNGNVAKSTVY 654
           + +   T GV   +    GI +G + +  + +  S K     L  I G  N      T  
Sbjct: 497 LFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILARIAGTSN-----FTNL 551

Query: 655 RDYVQTK-----FLDGIGEQI---YVLKLQNVLFFGTXXXXXXXXXXXXXXXNKD----- 701
            DY++T       ++G  E+I    ++++   L F                 +       
Sbjct: 552 DDYLRTTKKNPPAVEGRIEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGR 611

Query: 702 ---AKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNA 758
                K  IKY+I D   + +  ID SAA+  + I      + + + ++++   D+I   
Sbjct: 612 KSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIISCYKRRNVFIYLANVSINDKIRTR 669

Query: 759 FNNVGLLNDVE 769
               G+  +VE
Sbjct: 670 LLKAGVTPNVE 680

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 89/395 (22%), Positives = 155/395 (39%), Gaps = 42/395 (10%)

Query: 259 AVYSGGWSSFPSGI-GSEMIEITPFYHTMALAVKDALEG---NDDEIITTTIFCYVISSM 314
            +YS   S F  G+ GS    I      ++L V  A+E    + D +  + I   ++ + 
Sbjct: 142 GLYSLAISPFVYGVFGSVPQMIVGPESAISLVVGQAVESITLHKDNV--SLIDISIVITF 199

Query: 315 LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYS 368
           ++G +    G  R G +     + +L G I  VG  +II  +    ++ KF       Y 
Sbjct: 200 VSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYH 259

Query: 369 WPFFSGLFTNYDTLAKWLLPVLLTVILIGT---------------QRYFKNSLVLPTFYI 413
            PF   LF      A++ +P   T I  G                 +Y K ++  P    
Sbjct: 260 TPFEKILFLIDYAPAQYHMP---TAIFSGCCLIILFLMRLLKRKLLKYHKGAIFFPD--- 313

Query: 414 LTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFN-VHKVHWSLVLQQIP 472
              +L   IV I+ ++  D L+    I  + +     +D  KL N + +    L+     
Sbjct: 314 ---ILLVVIVTILISMKFD-LKHRYGITIVGDFSMDNFD--KLKNPLTRSRRKLIPDLFS 367

Query: 473 TMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNS 532
             + +   G         +L  +  +     +REL+A G+ N    L G++ ++  Y  S
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPSFGGYGRS 426

Query: 533 VLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTW 592
            +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G  LL E   D  
Sbjct: 427 KINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIK 486

Query: 593 NKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIAC 627
             L    Y  + +   T GV  F   I  GI I C
Sbjct: 487 FHLRCGGYSELFVFAVTFGVTIF-YSIEAGICIGC 520

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 82/380 (21%), Positives = 158/380 (41%), Gaps = 47/380 (12%)

Query: 285 TMALAVKDALEG-NDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGC 343
            ++L V  A+E     ++   T+    + S ++G+     G  RLG +     + +L G 
Sbjct: 146 AISLVVGQAVETLTSHDLSLETVDIATMISFMSGLTLLFGGIFRLGFLGNILSKALLRGF 205

Query: 344 IGGVGYFLIITGIEVTTRVAKF------EYSWPFFSGLF------TNYDTLAKWLLPVLL 391
           I  +G+ +I+  +    ++ K        Y  PF   LF      +NY     +L   + 
Sbjct: 206 ISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVRYGPSNYHLPTSFLSLAVF 265

Query: 392 TVILIGTQRYFKNSLV--------LPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPI 443
           T ++  T R FK  ++        +P   IL++V+F  +++      +  L++   I  I
Sbjct: 266 TTLM--TIRIFKKKMMRRIKWIVFIPE--ILSVVIFSIVLSY-----MCDLKKKYDISVI 316

Query: 444 ANSDSKWYDHYKLFNVHKVHWSLV--LQQIPTMMALTFFGILHVPINVPALAMSLQMDKY 501
            + ++  +D ++   + K +  L+  L+ +  + AL  F        + ++  S  +  Y
Sbjct: 317 GDFNTDGFDDFR-NPLSKCNRGLIPALRDVSLVSALLGF--------LESITASKSLGGY 367

Query: 502 -----DVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICV 556
                  +REL+A G  N      G +  +  Y  S +   +GA +  AG  + ++T+  
Sbjct: 368 GNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFT 427

Query: 557 MLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFV 616
           +     +I +IP C++  +   +G  LL EA  D    +    Y  +++ V T     F 
Sbjct: 428 IKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCF- 486

Query: 617 LGIIVGILIACFSFLVDSTK 636
             I  GIL  C   L+   K
Sbjct: 487 YSIEFGILAGCTYSLISIVK 506

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 152/366 (41%), Gaps = 39/366 (10%)

Query: 286 MALAVKDALEG--NDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGC 343
           ++L V  A+E   N DE I+T I   ++ + ++G     LG  RLG +     R +L G 
Sbjct: 135 ISLVVGQAVEPMVNHDERIST-ISISIVVTFISGSFLLFLGIFRLGFLGNILSRALLRGF 193

Query: 344 IGGVGYFLIITGIEVTTRVAKF------EYSWPFFSGLFT------NYD------TLAKW 385
           I  VG+ +II  +    ++ K        Y  PF   LF       NY       +L  +
Sbjct: 194 ICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEKILFLIKYGQHNYHAPTAILSLYSF 253

Query: 386 LLPVLLTVILIGTQRYFKNSLVLPTFYILTL--VLFHFIVAIIPTLSLDTLREAGWIFPI 443
           ++ +L+ V+     + FK  + +P   I+ +  ++F F   I     +  + +    F +
Sbjct: 254 IILMLMKVMKKRLMKRFKWVIFVPEILIVIVGTIMFSFHFDIKHKFDISIIGD----FKV 309

Query: 444 ANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDV 503
              DS    H  L   +++    +L        L FF          AL  +  +     
Sbjct: 310 NGFDSL---HNPLDKTNRLLLKPLLDAGIVCAVLGFF---ESTTASKALGTTYDL-TVSS 362

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVI 563
           +REL+A G  N    L G++  +  Y  S +   +G  +  +G  L ++T+  +     +
Sbjct: 363 NRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPV 422

Query: 564 ISFIPICIVGSLIFLLGYELLVEALVDT--WNKLNRFEYLTVVIIVFTMGVFDFVLGIIV 621
           +   P C++  +  ++G  LL EA  D   + + + +  L V+ + F   +F     + V
Sbjct: 423 VHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIF---YSVEV 479

Query: 622 GILIAC 627
           GI + C
Sbjct: 480 GICVGC 485

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 89/396 (22%), Positives = 154/396 (38%), Gaps = 44/396 (11%)

Query: 259 AVYSGGWSSFPSGI-GSEMIEITPFYHTMALAVKDALEG------NDDEIITTTIFCYVI 311
            +YS   S F  GI GS    I      ++L V  A+E       N   I  +T+  +V 
Sbjct: 152 GLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKENVSLIDISTVITFV- 210

Query: 312 SSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------ 365
               +G +    G  R G +     + +L G I  VG  +II  +    ++ KF      
Sbjct: 211 ----SGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQ 266

Query: 366 EYSWPFFSGLFTNYDTLAKWLLPVLL-----TVILIGTQ-------RYFKNSLVLPTFYI 413
            Y  PF   LF      A++ +P  +      ++L  T+       +Y K+++  P    
Sbjct: 267 HYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAIFFPD--- 323

Query: 414 LTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPT 473
              +L   IV I+ ++  + L+    I  I +     +D  K   + +    L+      
Sbjct: 324 ---ILLVVIVTILISMKFN-LKHRYGISIIGDFSMDNFDELK-NPLTRPRRKLIPDLFSA 378

Query: 474 MMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSV 533
            + +   G         +L  +  +     +REL+A G+ N    L G++  +  Y  S 
Sbjct: 379 SLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPAFGGYGRSK 437

Query: 534 LFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWN 593
           +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G  LL E   D   
Sbjct: 438 INALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKF 497

Query: 594 KL--NRFEYLTVVIIVFTMGVFDFVLGIIVGILIAC 627
            L    F  L V  + F   +F     I  GI I C
Sbjct: 498 HLRCGGFSELFVFAVTFCTTIF---YSIEAGICIGC 530

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 80/187 (42%), Gaps = 18/187 (9%)

Query: 499 DKYDVD----RELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTI 554
           +K+D+D    REL++ G  N  S +  ++  +  Y  S L I   A +  AG ++    I
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 555 CVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDT---WNKLNRFEYLTVVIIVFTMG 611
             M        ++P+C++  +I  + Y LL E   D    W+     E LT V +V T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 612 VFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIY 671
           V+    G+ +G+ +     L  +T+ +              + RD V  KF +   EQ  
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTTQSRV-----------QILGRDPVTKKFQNIYAEQSE 509

Query: 672 VLKLQNV 678
            + L+ +
Sbjct: 510 QIPLEEI 516

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 117/552 (21%), Positives = 211/552 (38%), Gaps = 54/552 (9%)

Query: 259 AVYSGGWSSFPSGI-GSEMIEITPFYHTMALAVKDALEG---NDDEIITTTIFCYVISSM 314
            +YS   S F  GI GS    I      ++L V  A+E    + D +  + I   V+ + 
Sbjct: 142 GLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKDNV--SLIDISVVITF 199

Query: 315 LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYS 368
           ++G +    G  R G +     + +L G I  VG  +II  +    ++ KF       Y 
Sbjct: 200 VSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYH 259

Query: 369 WPFFSGLFTNYDTLAKWLLPVLL----TVILIGTQRYFKNSLVLPTFYILTL--VLFHFI 422
            PF   LF      A++  P  +     +I++ + R  K  LV      +    +L   I
Sbjct: 260 TPFEKVLFLIDYAPAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIFFPDILLVVI 319

Query: 423 VAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGI 482
           VAI  ++   +L+    I  I +     +D  K    H     L+       + +   G 
Sbjct: 320 VAIFISMKF-SLKHRYGITIIGDFSMDNFDKLKNPFTHS-RRKLIPDLFSASLIVAMLGF 377

Query: 483 LHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADS 542
                   +L  +  +     +REL+A G+ N    L G++ ++  Y  S +   +GA S
Sbjct: 378 FESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQS 436

Query: 543 SFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLT 602
             +G  +  +T+  M +    + +IP C++  +  ++G  LL E   D    L    Y  
Sbjct: 437 VMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSE 496

Query: 603 VVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTK---------LQTINGEYNGNVAKSTV 653
           + +   T GV   +  I  GI I C   +++  K         L  + G  N      T 
Sbjct: 497 LFVFAVTFGV-TILCSIEAGICIGCVYSILNIIKHSAKSRIQILARVAGTSN-----FTN 550

Query: 654 YRDYVQTKFLDGIG--------EQIYVLKLQNVLFFGTXXXXXXXXXXXXXXXNKD---- 701
             DY++T   + +G        E   ++++   L F                 +      
Sbjct: 551 LDDYLRTMKKNPLGGENRLEEVEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPG 610

Query: 702 ----AKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYN 757
                 K  IKY+I D   + +  ID SAA+  + I      + + + ++++   D+I  
Sbjct: 611 RKSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIITSYKRRNVFIYVANVSINDKIRT 668

Query: 758 AFNNVGLLNDVE 769
                G++ ++E
Sbjct: 669 RLLKAGVIPNLE 680

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/336 (21%), Positives = 140/336 (41%), Gaps = 18/336 (5%)

Query: 305 TIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
           TI   V+ + L+G +  + G  RLG +     R +L G I  VG  ++I  +    ++ K
Sbjct: 176 TINISVVVTFLSGAILLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTK 235

Query: 365 FEYSWP-FFSGLFTNYDTLAKW---------LLPVLLTVILIGTQRYFKNSLV--LPTFY 412
              + P  +   F     L K+          +  L + I++ T R+ K  L+    +  
Sbjct: 236 LLATVPEHYHTPFEKVQFLFKYGPENLHKPTAILSLCSFIILMTLRFLKKKLMKRYKSVI 295

Query: 413 ILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFN-VHKVHWSLVLQQI 471
               +L   I ++I +++ + L++   I  + +  +  +D  KL N + K + SL  + +
Sbjct: 296 FFPEILLIVISSLIISVNFN-LKKDFDISMLGDFSTSGFD--KLNNPLGKDNRSLCHELL 352

Query: 472 PTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTN 531
              +     G         +L     +     +REL+A G  N    L G++ ++  Y  
Sbjct: 353 SVGLMCAILGFFESTTASKSLGTIYDL-TISSNRELVALGSMNLVGSLFGALPSFGGYGR 411

Query: 532 SVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDT 591
           S +   +GA +  +G  +  +T+  +     +I + P+CI+  +  ++G  LL EA  D 
Sbjct: 412 SKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDI 471

Query: 592 WNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIAC 627
              +    Y  ++I      V   +  +  GI + C
Sbjct: 472 RFHIRCHGYNELIIFTLIF-VTTIIHSVEAGISVGC 506

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 78/407 (19%), Positives = 149/407 (36%), Gaps = 56/407 (13%)

Query: 261 YSGGWSSFPSGIGSEMIEITPFYHT---------------MALAVKDALEGN--DDEIIT 303
           YS   +  P   G   +  TPF +                ++L V  A+E     D+ + 
Sbjct: 105 YSTSVAHVPPICGLNALAFTPFVYAVFGSVPHMIVGPESAISLVVGQAIEKQMKHDKSLD 164

Query: 304 TTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVA 363
               C +++  ++G + +  G +R G +     R +L G I  VG  +++  +    ++ 
Sbjct: 165 VVNLCLILT-FISGAILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLK 223

Query: 364 KF------EYSWPFFSGLFTNYDTLAKWLLPVLLT------------VILIGTQRYFKNS 405
           K        Y  PF   +F  +     + +P  L             ++     R +K  
Sbjct: 224 KVFNDAPGHYHAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKV 283

Query: 406 LVLPTFYIL----TLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFN-VH 460
           + +P   I+    TL  +HF   +   + +    E G             D  K  N + 
Sbjct: 284 IFVPEILIVVALVTLGSYHFSFKLRYNIDIVGDIEVG-------------DTSKFRNPLS 330

Query: 461 KVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLL 520
           K + SL  +       +   G         +L  S ++     +REL+A G  N    + 
Sbjct: 331 KKNLSLFSELFHAGFMVALLGFFESTTASKSLGSSYELS-VSSNRELVALGSLNLVGSIF 389

Query: 521 GSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLG 580
           G++ ++  Y  S +   +GA +  +G  +  +T    +     I  IP+C++  +  ++G
Sbjct: 390 GALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVG 449

Query: 581 YELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIAC 627
             L  EA  D         Y  ++I   T+ +  F   +  GI + C
Sbjct: 450 ITLFEEAPADLRYHFRCRGYNELLIFALTV-LTTFFYSVEAGITLGC 495

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVI 563
           +REL+A G  N  + LLG + ++  Y  S +   +GA +  +G ++  +T+  +      
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 564 ISFIPICIVGSLIFLLGYELLVEALVDT---WNKLNRFEYLTVVIIVFTMGVFDFVLGII 620
           I FIP C++  +  ++G  L+ EA  +    W    R +    +II F          + 
Sbjct: 488 IHFIPTCVLSVITTIVGLSLIEEAPGEVKFHW----RCKGYNELIIFFMTACGTIFFSVE 543

Query: 621 VGILIAC 627
           VGI+I C
Sbjct: 544 VGIIIGC 550

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 501 YDVD----RELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAG-FLLIALTIC 555
           +D+D    REL++ G  N    +  S+  +  Y  S L I  GA +  AG F+ ++   C
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 556 V-MLIGPVIISFIPICIVGSLIFLLGYELLVEALVDT---WNKLNRFEYLTVVIIVFTMG 611
           +  L+G  +  ++P+CI+  +I  + Y LL E   D    W+     E +T   +V +  
Sbjct: 403 MRFLMG--VFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTL 460

Query: 612 VFDFVLGIIVGILIACFSFLVDSTK 636
           ++    G+++G+ +     L  +T+
Sbjct: 461 IWSPQFGLVMGLGLTMIRLLKHTTQ 485

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 7/136 (5%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVI 563
           +RELIA G  N    +   +  +  Y  S +   +GA ++ +GF +  +T+  +     I
Sbjct: 377 NRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPI 436

Query: 564 ISFIPICIVGSLIFLLGYELLVEALVDT---WNKLNRFEYLTVVIIVFTMGVFDFVLGII 620
           I +IP+CI+  +  ++G  LL EA  D    W +   +  LTV  +     +F     + 
Sbjct: 437 IRYIPVCILSVITTVVGLTLLEEAPHDLKFHW-RCKGYSELTVFTVTLLATLF---YSLE 492

Query: 621 VGILIACFSFLVDSTK 636
            GI I C   +++  K
Sbjct: 493 AGIYIGCACSIINVIK 508

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 47/84 (55%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVI 563
           +REL+A G  N  + L G++ ++  Y  S +   +G+ +  +G  + ++T+  +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 564 ISFIPICIVGSLIFLLGYELLVEA 587
           I +IP+CI+  +  ++G  LL EA
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEA 475

>Kwal_27.11303 s27 (739517..740956) [1440 bp, 479 aa] {ON} YLR141W
           (RRN5) - transcription factor, member of UAF (upstream
           activation factor) along with Rrn9p and Rrn10p [contig
           28] FULL
          Length = 479

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 45/106 (42%), Gaps = 14/106 (13%)

Query: 144 SRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQSLRPS----HNL-RFRPRNIWQW 198
           SR+  +   S++D+E +     G   + EDD  G Y S+       H L R     + +W
Sbjct: 42  SRVRWARGDSDLDEEDDYMTDEGECQDEEDDELGVYWSIEEKELFFHYLSRSSIHRLEEW 101

Query: 199 CTSFPFK-----FAHYLPAAVLGLLLNILDALSYGMII----FPIT 235
           C   P K      A+Y       L L  LD+ S+G I+    FPI 
Sbjct: 102 CVHIPSKSRYEILAYYEVLQANLLSLKRLDSKSHGRILTKGEFPIA 147

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 70/154 (45%), Gaps = 16/154 (10%)

Query: 466 LVLQQIPTMMALTFFGIL-HVPINVPALAMSL-QMDKYDV--DRELIAHGYSNFFSGLLG 521
           LV + +P + A T   +L H+     A+A S  +++ Y V  D+ELIA G +N F+    
Sbjct: 397 LVEKLLPELPAATIILLLEHI-----AIAKSFGRINNYKVVPDQELIAIGVTNLFATFFN 451

Query: 522 SVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGY 581
           +      ++ S L  +    +  +G    A  +  +        FIP   + ++I     
Sbjct: 452 AYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVA 511

Query: 582 ELLVEALVDTW-----NKLNRFEYL-TVVIIVFT 609
           +L+    V TW     N L+ F ++ TV+I VF+
Sbjct: 512 DLIASYKV-TWMFWRTNPLDFFAFIVTVIITVFS 544

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 884 ILLFALKQYRPDIISEIQTVREKEIKFWAQ 913
           +L+  LK Y+PDI+S +Q V   E+KFW +
Sbjct: 140 VLVHELKTYKPDIVS-LQEVDYNELKFWQE 168

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,147,933
Number of extensions: 4413225
Number of successful extensions: 12248
Number of sequences better than 10.0: 59
Number of HSP's gapped: 12514
Number of HSP's successfully gapped: 75
Length of query: 1036
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 916
Effective length of database: 39,721,479
Effective search space: 36384874764
Effective search space used: 36384874764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 71 (32.0 bits)