Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.4153.454ON45245224080.0
Suva_7.3953.454ON45145120590.0
YGR110W (CLD1)3.454ON44544420150.0
Smik_6.2003.454ON44544419960.0
ZYRO0C06270g3.454ON43040213470.0
TDEL0F033903.454ON42445313350.0
Kpol_1035.93.454ON42742213111e-179
SAKL0B06116g3.454ON43141912111e-164
NCAS0E008603.454ON44045312111e-164
KAFR0I019703.454ON41139612071e-164
KLTH0E13948g3.454ON43844212021e-162
ABL019W3.454ON43143512001e-162
KNAG0B009503.454ON41840911911e-161
Kwal_27.123173.454ON43539511841e-160
Ecym_24653.454ON43840111741e-158
NDAI0G010903.454ON45645711701e-157
TPHA0O013103.454ON43839211571e-156
CAGL0L04686g3.454ON45143411031e-147
KLLA0B12914g3.454ON42640910201e-135
TBLA0F034603.454ON4414159131e-119
SAKL0G19074gna 1ON4324085045e-58
KLTH0C01254gna 1ON4344284662e-52
Kwal_14.985na 1ON4354114548e-51
Ecym_5577singletonON4334094513e-50
KAFR0B053808.284ON4113981782e-13
YLR099C (ICT1)8.284ON3943431756e-13
Suva_2.2888.284ON4353501749e-13
Skud_12.1678.284ON3943431739e-13
Smik_4.3718.284ON4353711741e-12
TPHA0A016908.284ON4053701731e-12
Suva_10.1838.284ON3943391712e-12
Skud_4.3868.284ON4463731712e-12
Smik_12.1588.284ON3943341622e-11
KNAG0G021408.284ON4083571596e-11
TDEL0F041008.284ON4343421571e-10
YDR125C (ECM18)8.284ON4533431525e-10
Kwal_56.237028.284ON4163461516e-10
Kpol_543.498.284ON4293761436e-09
CAGL0B01969g8.284ON4233351419e-09
KLTH0G13178g8.284ON4153481364e-08
CAGL0M11462g8.284ON3863621364e-08
NDAI0J01200singletonON4273541331e-07
SAKL0H16500g8.284ON4193631321e-07
TBLA0H014008.284ON4214151302e-07
KLLA0F19624g8.284ON4093471302e-07
ZYRO0D06666g8.284ON3803471266e-07
Ecym_42858.284ON4053421267e-07
NCAS0B051208.284ON3963491251e-06
AGR062C8.284ON3843431232e-06
KAFR0B028308.284ON3913451213e-06
NDAI0J012108.284ON4163421204e-06
TPHA0L016008.524ON3721161142e-05
NCAS0B037108.284ON4303411115e-05
KNAG0H031208.284ON4343501098e-05
ZYRO0F09064g8.524ON3491331071e-04
CAGL0M05467g8.524ON3541531062e-04
NDAI0C054308.524ON3621151043e-04
SAKL0H10450g8.524ON392145990.001
TDEL0B032508.524ON348115960.003
NCAS0B022608.524ON363216910.010
KNAG0A037708.524ON356115900.014
KLLA0A10395gna 2ON29465840.080
Skud_14.400na 3ON29363840.083
Suva_14.424na 3ON28963800.20
Kwal_27.10170na 2ON29362800.22
Kwal_27.119758.524ON336114800.25
YNR064Cna 3ON29052770.55
TDEL0G00150singletonON299134770.57
TBLA0H035408.524ON378117760.77
CAGL0G08756g2.235ON1354100770.83
Kpol_299.68.524ON349115751.0
SAKL0E14674g5.693ON377112741.3
KLLA0C11561gsingletonON355157732.0
KAFR0E03110singletonON35686722.2
TDEL0D00200singletonON56763713.7
YML088W (UFO1)8.863ON668116714.3
KAFR0B020508.130ON106361704.7
TBLA0D002302.98ON48271705.1
CAGL0K12430g8.45ON417102679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.415
         (452 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   932   0.0  
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   797   0.0  
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   780   0.0  
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   773   0.0  
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   523   0.0  
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   518   0.0  
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   509   e-179
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   471   e-164
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    471   e-164
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              469   e-164
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   467   e-162
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   466   e-162
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   463   e-161
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   460   e-160
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   456   e-158
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    455   e-157
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   450   e-156
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   429   e-147
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   397   e-135
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              356   e-119
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   198   5e-58
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   184   2e-52
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   179   8e-51
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   178   3e-50
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    73   2e-13
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    72   6e-13
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    72   9e-13
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    71   9e-13
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    72   1e-12
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    71   1e-12
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    70   2e-12
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    70   2e-12
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    67   2e-11
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    66   6e-11
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    65   1e-10
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    63   5e-10
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    63   6e-10
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    60   6e-09
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    59   9e-09
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    57   4e-08
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    57   4e-08
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              56   1e-07
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    55   1e-07
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    55   2e-07
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    55   2e-07
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    53   6e-07
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    53   7e-07
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    53   1e-06
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    52   2e-06
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    51   3e-06
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    51   4e-06
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    49   2e-05
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     47   5e-05
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    47   8e-05
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    46   1e-04
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    45   2e-04
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    45   3e-04
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    43   0.001
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    42   0.003
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    40   0.010
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    39   0.014
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    37   0.080
Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {O...    37   0.083
Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {O...    35   0.20 
Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {O...    35   0.22 
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    35   0.25 
YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON} E...    34   0.55 
TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON}        34   0.57 
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    34   0.77 
CAGL0G08756g Chr7 complement(829778..833842) [4065 bp, 1354 aa] ...    34   0.83 
Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON} (14238..15...    33   1.0  
SAKL0E14674g Chr5 (1211477..1212610) [1134 bp, 377 aa] {ON} simi...    33   1.3  
KLLA0C11561g Chr3 complement(997866..998933) [1068 bp, 355 aa] {...    33   2.0  
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               32   2.2  
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                 32   3.7  
YML088W Chr13 (92235..94241) [2007 bp, 668 aa] {ON}  UFO1F-box r...    32   4.3  
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    32   4.7  
TBLA0D00230 Chr4 (57128..58576) [1449 bp, 482 aa] {ON} Anc_2.98 ...    32   5.1  
CAGL0K12430g Chr11 complement(1214197..1215450) [1254 bp, 417 aa...    30   9.4  

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/452 (100%), Positives = 452/452 (100%)

Query: 1   MKVRFLTFKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTA 60
           MKVRFLTFKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTA
Sbjct: 1   MKVRFLTFKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTA 60

Query: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKT 120
           IPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKT
Sbjct: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKT 120

Query: 121 VVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHA 180
           VVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHA
Sbjct: 121 VVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHA 180

Query: 181 IDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240
           IDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY
Sbjct: 181 IDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240

Query: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT 300
           LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT
Sbjct: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT 300

Query: 301 LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFAL 360
           LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFAL
Sbjct: 301 LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFAL 360

Query: 361 RCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKS 420
           RCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKS
Sbjct: 361 RCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKS 420

Query: 421 NVFIVPHAGHHLYLDNYTFFNKILVKEMQNVK 452
           NVFIVPHAGHHLYLDNYTFFNKILVKEMQNVK
Sbjct: 421 NVFIVPHAGHHLYLDNYTFFNKILVKEMQNVK 452

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/451 (83%), Positives = 415/451 (92%)

Query: 1   MKVRFLTFKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTA 60
           M+ RFLTFKSTLSSII  PLKG QLLTGA+SS T+ ES E+  +D  E+RILRTPSAPTA
Sbjct: 1   MRTRFLTFKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAPTA 60

Query: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKT 120
           IPLREIIYKVPGLFPRPLEDSVKDFRDF KNED FQTELL TLPFYPNPS  KKSKLIKT
Sbjct: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPSTTKKSKLIKT 120

Query: 121 VVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHA 180
           +VDDDGNYINEFCIYPQ PSVPE +LKHLVFIHGYGAGLGFFIKN EDIPLL+NEWC+HA
Sbjct: 121 IVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHA 180

Query: 181 IDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240
           IDLPGYGFSSRPKFPF+YP+D++H+VQDWFHERIHTWF KRNLL+KP+KNIV+AHSLGSY
Sbjct: 181 IDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240

Query: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT 300
           LMALYLQKY+ SPSFKKL+LCSPAGVS+RDFD+  ++V KWKPPPWWYVKLWD+NISPFT
Sbjct: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300

Query: 301 LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFAL 360
           LVRN+RQ GSKITSGWSYRRFKHILNGDP QS+RFEALHRYAYSIFNKRGSGEYLLSFAL
Sbjct: 301 LVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFAL 360

Query: 361 RCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKS 420
           +CGGEPRLPLEEQLFNG+N+ VLKN+ YEWVWLYG+DDWMDV+GGLRVSK LN+KL QKS
Sbjct: 361 KCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKS 420

Query: 421 NVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451
           +V  VP+AGHHLYLDN+ FFN I++ EMQ V
Sbjct: 421 SVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/444 (82%), Positives = 408/444 (91%)

Query: 8   FKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTAIPLREII 67
           FKSTL+SII RPLKG QLL GA+SS TR +S  +  RD TE++ILRTPSAPTAIPLREII
Sbjct: 2   FKSTLNSIIRRPLKGFQLLRGADSSNTRPQSPRASARDVTEKQILRTPSAPTAIPLREII 61

Query: 68  YKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGN 127
           Y+VP LFPRPLEDSVKDFRDF KNED FQTELL+TLPFYP PS+ K ++LI+TVVDD+GN
Sbjct: 62  YRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTARLIRTVVDDEGN 121

Query: 128 YINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYG 187
           YINEFCI P+K SVPE +LKHLVFIHGYGAGLGFFIKN EDIPLLDNEWCIHAIDLPGYG
Sbjct: 122 YINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYG 181

Query: 188 FSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQ 247
           FSSRPKFPFEYP+DN+H+VQDWFHERIHTWF+KRNLL++P+KNIV+AHSLGSYLMALYLQ
Sbjct: 182 FSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQ 241

Query: 248 KYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQ 307
           KYKESPSFKKL+LCSPAGVS RDF+NT +EV KWKPPPWWYVKLWDRNISPFTLVRN RQ
Sbjct: 242 KYKESPSFKKLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDRNISPFTLVRNFRQ 301

Query: 308 LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPR 367
           LGSKITSGWSYRRFKHILNGDP QS+RFEALHRYAY+IFNKRGSGEYLLSFAL+CGGEPR
Sbjct: 302 LGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKCGGEPR 361

Query: 368 LPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPH 427
           L LE+QLF+G+ S +LKNSN +W+WLYG+DDWMDV+GGLRVS++L EKL QKSNV IVPH
Sbjct: 362 LSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNVIIVPH 421

Query: 428 AGHHLYLDNYTFFNKILVKEMQNV 451
           +GHHLYLDNY FFN IL KEMQ +
Sbjct: 422 SGHHLYLDNYKFFNNILTKEMQKI 445

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/444 (82%), Positives = 404/444 (90%)

Query: 8   FKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTAIPLREII 67
           FKSTL SI+ RPLK  QLLTGAN S T+ +   +  RD TE++I RTPSAPTAIPLREII
Sbjct: 2   FKSTLISIMRRPLKSFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREII 61

Query: 68  YKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGN 127
           YKVPGLFPRP+ DSVKDFRDF K+EDVFQTELL+TLPFYPNPSK KKS++I+TVVDDDGN
Sbjct: 62  YKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGN 121

Query: 128 YINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYG 187
           YINEFCI P  PSVPETELKHL+FIHGYGAGLGFFIKN EDIPLL+NEWC+HAIDLPGYG
Sbjct: 122 YINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 181

Query: 188 FSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQ 247
           FSSRPKFPFEYP+DNLH VQDWFH+R+HTWFNKRNLL+KPDKN+V+AHSLGSYLMALY+Q
Sbjct: 182 FSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQ 241

Query: 248 KYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQ 307
           KYKE PSFKKL+LCSPAGVS+RD +NTT+E  KWKPPPWWYVKLWDRNISPFTLVRN+RQ
Sbjct: 242 KYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQ 301

Query: 308 LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPR 367
            GSKITSGWSYRRFKHILNGD  QS RFEALHRYAYSIFNKRGSGEYLLSFAL+CGGEPR
Sbjct: 302 FGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR 361

Query: 368 LPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPH 427
           LPLEEQLFN  N  +L++SNYEW+WLYG+DDWMDV+GG+RVSK+LNEKL QKSNV IVPH
Sbjct: 362 LPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPH 421

Query: 428 AGHHLYLDNYTFFNKILVKEMQNV 451
           AGHHLYLDN  FFN ILVKEM+ V
Sbjct: 422 AGHHLYLDNSKFFNDILVKEMRKV 445

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/402 (61%), Positives = 306/402 (76%), Gaps = 10/402 (2%)

Query: 53  RTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKY 112
           R P+APTAIPL +II ++P LFPR ++ S +D++DF  +    Q ELL TLPFYP  ++ 
Sbjct: 36  RVPAAPTAIPLHKIIMRLPKLFPRSVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAES 95

Query: 113 KKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLL 172
           KK++++KT VDD GNYINEFCI P KPSVP  ++KHL+ IHGYGAGLGFF+KNLE IPLL
Sbjct: 96  KKAEVVKTTVDDQGNYINEFCITPVKPSVPSHKMKHLICIHGYGAGLGFFLKNLEGIPLL 155

Query: 173 DNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIV 232
           DN W IHAIDLPGYGFSSRPKFPF+YPKD+L  V  WFH+RIHTWF KR LL     N+V
Sbjct: 156 DNSWVIHAIDLPGYGFSSRPKFPFKYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNNLV 215

Query: 233 VAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLW 292
           +AHSLG+YLMALY  KY  +  FKKLV+CSPAGV      +TTA+      PPWWY KLW
Sbjct: 216 MAHSLGAYLMALYTTKY--TTHFKKLVMCSPAGVCK----STTAKNIGNTTPPWWYTKLW 269

Query: 293 DRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQS---RRFEALHRYAYSIFNKR 349
           D NISPF LVRNA  LGS +TSGWSYRRF  +L  +   +    +FEALHRYAY+IFN+R
Sbjct: 270 DLNISPFCLVRNAAALGSMVTSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYAIFNRR 329

Query: 350 GSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVS 409
           GSGEYLLSFAL CGG+PRLPLE+ +F  + S + + SN EW+W+YG  DWMDV+GG RVS
Sbjct: 330 GSGEYLLSFALSCGGDPRLPLEDTIFKDKTSGIFR-SNCEWIWIYGERDWMDVNGGERVS 388

Query: 410 KYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451
           +++  + G+KS V + P++GHHLY DN+ FFN  +VK+M+++
Sbjct: 389 RFIENQGGRKSQVHVAPNSGHHLYFDNHKFFNSFIVKQMKDM 430

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/453 (57%), Positives = 327/453 (72%), Gaps = 31/453 (6%)

Query: 1   MKVRFLTFKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTA 60
           M  RF+T   +L  I+G  L+    L   + S                   L  P+APTA
Sbjct: 1   MSTRFVT--QSLKGIVGSLLRNRVSLKAQSVS-------------------LDVPAAPTA 39

Query: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFTKNED-VFQTELLETLPFYPNPSKYKKSKLIK 119
           IPLREII K+P LFPR   DSV+D+RD  ++ D  FQ +LL TLPFY     +++S++I+
Sbjct: 40  IPLREIIVKLPSLFPRSFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGEGDLHRRSEVIR 99

Query: 120 TVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIH 179
           T VDD+GNYINEF I P+  SVP   LKHLVFIHGYGAGLGFF+KN E+IPLL+NEWCIH
Sbjct: 100 TKVDDEGNYINEFYIMPKNASVPRDRLKHLVFIHGYGAGLGFFLKNFENIPLLNNEWCIH 159

Query: 180 AIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGS 239
           AIDLPGYGFSSR KFPF+YPKD +  V +WFH+R++ WF +RNLL  P+ NIV+AHSLG+
Sbjct: 160 AIDLPGYGFSSRCKFPFQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENNIVMAHSLGA 219

Query: 240 YLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPF 299
           YLMALY    K S  FKKLV+CSPAG+       TT  +G  K PPWWY KLWDRNISPF
Sbjct: 220 YLMALYAS--KNSSHFKKLVMCSPAGICE---STTTKAIGNRK-PPWWYSKLWDRNISPF 273

Query: 300 TLVRNARQLGSKITSGWSYRRFKHILNGDPGQS-RRFEALHRYAYSIFNKRGSGEYLLSF 358
           +LVR + +LGSK+TSGWSY+RF  +L     +S ++FEALH+Y YSIFNK G GEYLLSF
Sbjct: 274 SLVRVSSRLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGCGEYLLSF 333

Query: 359 ALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQ 418
           ALRCGG+PR+PLE+ LF   +S ++ N N EW+WLYG  DWMD +GG RVS++L +K GQ
Sbjct: 334 ALRCGGDPRIPLEDMLFKTNDSGIM-NGNLEWLWLYGERDWMDFNGGKRVSEHL-KKSGQ 391

Query: 419 KSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451
           KS V IVP+AGHHLY DNY +FN ++++EM+++
Sbjct: 392 KSEVCIVPNAGHHLYFDNYDYFNSLIIREMKSM 424

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  509 bits (1311), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/422 (57%), Positives = 314/422 (74%), Gaps = 11/422 (2%)

Query: 30  NSSITRSESDESPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFT 89
           N +  R  +   P RD   E++   P+AP AIPL EII K+P LFPR L++S+ D+ DF 
Sbjct: 17  NFNFRRVATSGVPSRD---EKLPTVPAAPAAIPLYEIILKLPNLFPRTLKESLNDYHDFH 73

Query: 90  KNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHL 149
           K+ D FQTELL TLP+YP  +  KK++LI T VDD+GNYINEFCI P      + +LKHL
Sbjct: 74  KDIDKFQTELLSTLPYYPMANDGKKAELITTKVDDEGNYINEFCISPIGAEADQRDLKHL 133

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDW 209
           +FIHGYGAGLGFF+KN E +PLLDN+WCIHAIDLPGYG+S R +FPF+YP+ ++  VQDW
Sbjct: 134 IFIHGYGAGLGFFLKNFEHLPLLDNKWCIHAIDLPGYGYSKRCEFPFKYPEHDISDVQDW 193

Query: 210 FHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNR 269
           FH+RI TWF  R+LL  P+ N+++AHSLG+YLMALY+ K+     FKK+V+CSPAG+   
Sbjct: 194 FHKRIRTWFKARSLLTTPENNMIMAHSLGAYLMALYIDKFPN--DFKKIVMCSPAGICQ- 250

Query: 270 DFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDP 329
              +T+ E+G  K  PWW+ KLWD+N+SPFTLVRN   LGSK+TSGWSYRRFK +     
Sbjct: 251 --SSTSEEIGNIK-TPWWFNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFKQLKQS-- 305

Query: 330 GQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYE 389
           G   +FE LHRYAYSIFN++GSGEY+L FAL+CGG+PR+PLE+ LF    ++ +  S+ E
Sbjct: 306 GHLMQFEKLHRYAYSIFNQKGSGEYILGFALKCGGDPRIPLEDNLFKSPKTEGIPKSDCE 365

Query: 390 WVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQ 449
           W+W+YG  DWMD+ GG RV+  L  + G+KS+  +VP +GHHLY DNY FFN++LVKEM+
Sbjct: 366 WLWVYGEKDWMDIGGGKRVTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNELLVKEMK 425

Query: 450 NV 451
           N+
Sbjct: 426 NM 427

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  471 bits (1211), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 229/419 (54%), Positives = 309/419 (73%), Gaps = 18/419 (4%)

Query: 33  ITRSESDESPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNE 92
           I+R++   S E   T   I +  + PTA+PL +I  ++P LFP   E S++D+  F +N 
Sbjct: 29  ISRAKVRTSAE---TTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENA 85

Query: 93  DVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFI 152
           + FQ++LL TLPFYP+P+  + S+++KT VDD+GNYINEF I P  PS   + +KHL+F+
Sbjct: 86  ESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPSS-SSSMKHLIFV 144

Query: 153 HGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHE 212
           HGYGAGLGFF+KN E+IPLL+N WCIHAIDLPGYGFSSRPKFPF YP+ N   V+DWFH+
Sbjct: 145 HGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQ 204

Query: 213 RIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFD 272
           RI  W +KR LL  P  N++VAHSLG+Y+ ALY  K+     F KL++CSPAG+      
Sbjct: 205 RIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPN--HFSKLIMCSPAGIC----- 257

Query: 273 NTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQS 332
             + ++G  + PP W+VKLWDRNISPF+LVRN+  LGSK+TSGW+YRRF+  L       
Sbjct: 258 -PSPKLG--QAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGY 314

Query: 333 RRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVW 392
            + +A+H+Y Y+IFNK GSGEYLLSFAL+CGG+PRLPLE++LF  +N+   K +N +W+W
Sbjct: 315 EQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLF--DNTSSFK-ANCDWLW 371

Query: 393 LYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451
           LYG++DWMD+ GG R S++L +K+G KS+V +VP AGHHLYLDNY  FN +++KEM+ +
Sbjct: 372 LYGDEDWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  471 bits (1211), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 247/453 (54%), Positives = 304/453 (67%), Gaps = 27/453 (5%)

Query: 5   FLTFKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAP-TAIPL 63
            LT K+TL +I  R  +          +I + ES  +     T   IL  PS P  AIP+
Sbjct: 8   MLTLKTTLQTIFKRRQRI--------GTIAKQESQRNVTEYATSNTILPQPSTPPVAIPI 59

Query: 64  REIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVD 123
            +II  +P LFPR L DS +D+  FT + D  Q  LL+TLPF+P  S  K +KLI+T +D
Sbjct: 60  TDIITSLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSSQKVAKLIRTPID 119

Query: 124 DDGNYINEFCIYP--QKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAI 181
           D+GNYINEFCI P  +       +LKHL+FIHGYGAGLGFF+KNLE+IPLLDN+WCIHAI
Sbjct: 120 DEGNYINEFCIMPAVKDGDYSSPDLKHLIFIHGYGAGLGFFLKNLENIPLLDNKWCIHAI 179

Query: 182 DLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYL 241
           DLPGYGFSSR KFPF YP D+   VQ WFH+RI+ WF +RNLL  P  N+V+AHSLG+YL
Sbjct: 180 DLPGYGFSSRFKFPFHYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQNNLVMAHSLGAYL 239

Query: 242 MALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKW-KPPPWWYVKLWDRNISPFT 300
           MA Y   +  S  FKK+++CSPAGVS          VGK  K PPWWY KLWD N SPF+
Sbjct: 240 MAHY--AFHFSNHFKKIIMCSPAGVSQ-------FAVGKQNKQPPWWYNKLWDLNYSPFS 290

Query: 301 LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFAL 360
           LVRN+   GSKITSGWSYRRFK        +S +FEALH+Y Y IFNK GSGEYLLSF L
Sbjct: 291 LVRNSGIYGSKITSGWSYRRFKPTSFNGLNES-QFEALHKYTYGIFNKNGSGEYLLSFIL 349

Query: 361 RCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLG--Q 418
            CGG+PR  LE+ LF  EN         +WVW+YG+ DWMD++G  R+S+ L +K G   
Sbjct: 350 SCGGDPRFALEDNLFKEENP---PEDLCDWVWVYGDRDWMDINGAHRISRRLVKKAGDTS 406

Query: 419 KSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451
           KS V ++P AGHHLYLDNY  FN +++KEM+ +
Sbjct: 407 KSKVHVIPSAGHHLYLDNYKAFNNLIIKEMETM 439

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  469 bits (1207), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 232/396 (58%), Positives = 288/396 (72%), Gaps = 16/396 (4%)

Query: 56  SAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKS 115
           SAP AIPL +II ++P LFPR +++S KD+R + +  +  Q +LL TLPFYPN SK K +
Sbjct: 32  SAPVAIPLVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNVSKDKVA 91

Query: 116 KLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNE 175
           ++IKTVVD++GNYINEFCI P K +V   +LKHL+FIHGYGAG GFF+KNLE IPLLDN 
Sbjct: 92  RIIKTVVDEEGNYINEFCITP-KNTVNSQKLKHLIFIHGYGAGFGFFLKNLESIPLLDNN 150

Query: 176 WCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAH 235
           WCIHAIDLPG+GFSSR  FPF+YP  N   V  WFHERI  W  +R LL  P  N++VAH
Sbjct: 151 WCIHAIDLPGFGFSSRKNFPFKYPTSNTSEVTAWFHERIRRWLEERTLLDNPKNNVIVAH 210

Query: 236 SLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRN 295
           SLG+YLMALY Q Y      +KL++CSPAGVS +  +N+ A +     PPWWY KLWD N
Sbjct: 211 SLGAYLMALYTQVY--PAHLRKLIMCSPAGVS-KSQNNSKAVL----QPPWWYAKLWDMN 263

Query: 296 ISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYL 355
           +SPFTLVR ++ LGSK+TSGWSYRRFK I N       +FE LHRY+Y+IFN+ GSGEYL
Sbjct: 264 LSPFTLVRLSKHLGSKLTSGWSYRRFKLIEN-----RMQFEMLHRYSYAIFNQPGSGEYL 318

Query: 356 LSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEK 415
           L F L CGG PR  LE+ LF+  N  V  +S  EW W+YG +DWMD++GG RV   L EK
Sbjct: 319 LGFILECGGNPRCSLEDTLFSN-NFNV--SSKVEWAWIYGENDWMDIEGGRRVHNLLLEK 375

Query: 416 LGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451
             + S  ++VP+AGHHLYLDN  +FN I+V+ M+NV
Sbjct: 376 FNRDSKFYMVPNAGHHLYLDNIRYFNNIIVQHMENV 411

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  467 bits (1202), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 230/442 (52%), Positives = 304/442 (68%), Gaps = 23/442 (5%)

Query: 8   FKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTAIPLREII 67
           F+S  S ++G     +Q      +    SES  +P        I   PS+P+AIPLRE++
Sbjct: 16  FRSAFSQVVG-----IQPKVRKPAFPCNSESASNPS-------ITCRPSSPSAIPLRELV 63

Query: 68  YKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGN 127
             +P LFPR +++SV+D+  F K+    Q +LL TLPF+P     K +++++T VD+  N
Sbjct: 64  INLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQAN 123

Query: 128 YINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYG 187
           YINEFC+ P  P  P   L+HL+ +HGYGAGLGFF+KNLE + L+DN W IHAIDLPGYG
Sbjct: 124 YINEFCVRPAMPH-PSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYG 182

Query: 188 FSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQ 247
           FSSRPKFP++Y  D    V+ WFH R  TW  KR LL  P++N++VAHS+G+YL ALY  
Sbjct: 183 FSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYAN 242

Query: 248 KYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQ 307
           KY     FKKLV+CSPAG+ N      T    + + PPWW+ KLWDRNISPF+LVRN+R 
Sbjct: 243 KYPN--HFKKLVMCSPAGICN------TPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRL 294

Query: 308 LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPR 367
           LGSK+TSGWSYRRF  +L+     +++FEA+H+YAY+IFN  GSGEYLLSFAL+CGG+PR
Sbjct: 295 LGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPR 354

Query: 368 LPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPH 427
             LE +LF+ + ++    +  EW+WLYG+ DWMDV GG RVS +LN  +G+KS V +V  
Sbjct: 355 DALERRLFHNKMNQF--KAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHD 412

Query: 428 AGHHLYLDNYTFFNKILVKEMQ 449
           +GHHLY DNY  FN+IL KEM+
Sbjct: 413 SGHHLYFDNYEQFNRILEKEMK 434

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  466 bits (1200), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 226/435 (51%), Positives = 302/435 (69%), Gaps = 18/435 (4%)

Query: 22  GLQLLTGANSSITRSESDE--SPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLE 79
           G  LL    +   R+  D+  +P +DG     +R P+ PTA+PL EII  +P LFP P  
Sbjct: 7   GTHLLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLPTS 66

Query: 80  DSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKP 139
            S +D++ F  + + FQ  LL TLPF+    + K  K+I+T VDD+GNYINEFCI P   
Sbjct: 67  QSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPA-- 124

Query: 140 SVPE---TELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPF 196
           S+ E       HL+FIHGYGAGLGFFIKN E +PLLD++W IHAIDLPGYG+S+R +FPF
Sbjct: 125 SMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPF 184

Query: 197 EYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFK 256
           +    ++  V+ WFHER+ TW +KR LL  P +N+V+AHS+G+YL A Y Q  +    FK
Sbjct: 185 DVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNH--FK 242

Query: 257 KLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGW 316
           KL++CSPAG+S              K PPWW++KLWDRN+SPF+LVRN+  LGSK+TSGW
Sbjct: 243 KLIMCSPAGIS--------PSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGW 294

Query: 317 SYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFN 376
           S+RRF+H+LN      R+FEALH+Y+Y+IFN  GSGEYLLSF L+CGG+PR+PL   +F+
Sbjct: 295 SFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFS 354

Query: 377 GENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDN 436
            E     K +  EW+WLYG+  WMD +GG R S Y+ +++G KS V IVP++GHHLY DN
Sbjct: 355 PEKEHGFK-AQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDN 413

Query: 437 YTFFNKILVKEMQNV 451
           Y++FNKIL++EMQ++
Sbjct: 414 YSYFNKILLREMQSI 428

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  463 bits (1191), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 228/409 (55%), Positives = 298/409 (72%), Gaps = 19/409 (4%)

Query: 44  RDGTEERI-LRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLET 102
           R  ++ R+ ++TP+APTAIPL EII K+P LFPR +  S++D++ F+ N D  Q +LL T
Sbjct: 28  RKQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLST 87

Query: 103 LPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFF 162
           LPF+P     K++++++T +D+D N+INEF I P   + P ++LKHL+FIHGYGAGLGFF
Sbjct: 88  LPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEP-SKLKHLIFIHGYGAGLGFF 146

Query: 163 IKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRN 222
           +KN E+I L DN WCIHAIDLPG+GFSSR KFPF+YP+D++  VQ WFHER+  WF KR+
Sbjct: 147 LKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRD 206

Query: 223 LLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWK 282
           LL  P  N+VVAHSLG+YLMALY  K      FKKL++CSPAG+ N    +T  +    K
Sbjct: 207 LLKNPGNNMVVAHSLGAYLMALY--KRNNPLHFKKLIMCSPAGMCN----STVVK----K 256

Query: 283 PPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYA 342
            PPWWY  LWD N+SPF+LVRN+  LGSK+TSGWSYRRF+ +         +FE LH Y+
Sbjct: 257 QPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL-----HSKIQFENLHLYS 311

Query: 343 YSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDV 402
           Y+IFN+ G GEYLL+FALRCGG+PR+ LE  LFN   +K   +S+ EWVWLYG+ DWMDV
Sbjct: 312 YAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKW--DSDSEWVWLYGDRDWMDV 369

Query: 403 DGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451
            GG R+S+ +NE    KS+V ++P+AGHHLY DN + FN IL KEM  +
Sbjct: 370 KGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  460 bits (1184), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 220/395 (55%), Positives = 282/395 (71%), Gaps = 11/395 (2%)

Query: 55  PSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKK 114
           PS+P+AIPL EII K+P LFPR LE S +DF+DF  N    Q+ELL TLPF+P     + 
Sbjct: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRT 110

Query: 115 SKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDN 174
           +++I+T VD  GNYINEF I P      +T +KHL+ +HGYGAGLGFF+K  E++ L++ 
Sbjct: 111 AEIIRTTVDAQGNYINEFNIRPTAVDTSKT-MKHLILVHGYGAGLGFFLKTFENLNLINE 169

Query: 175 EWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVA 234
            W IHAIDLPGYGFSSRP FPF+        V+ WFH R H W  +R LL  P+ N+VVA
Sbjct: 170 NWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVA 229

Query: 235 HSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDR 294
           HS+G+YL ALY  K+     FKKLV+CSPAGV +      +A   + +PPPWW+ KLWD+
Sbjct: 230 HSMGAYLTALYANKHPGH--FKKLVMCSPAGVCH------SAPEMRKRPPPWWFAKLWDK 281

Query: 295 NISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEY 354
           NISPF+LVRNA  LGSK+TSGWSYRR   +L      +R+ EALHRYAY+IFN++GSGEY
Sbjct: 282 NISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEY 341

Query: 355 LLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNE 414
           LLSFAL+CGGEPR+PLE +LF+    +    +N EW+WLYG+ DW+D  GG RVS++L  
Sbjct: 342 LLSFALQCGGEPRVPLERRLFHNRGQQF--KANCEWLWLYGDQDWIDRRGGERVSQFLTA 399

Query: 415 KLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQ 449
           ++G +S V IV ++GHHLYLDN+  FNKIL  EM+
Sbjct: 400 EMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  456 bits (1174), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 216/401 (53%), Positives = 288/401 (71%), Gaps = 17/401 (4%)

Query: 55  PSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKK 114
           P+ PTAIPL EI+  +P LFP PL++S KD++ F  + D FQT LL TLPF+P+ +  K 
Sbjct: 43  PTPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAADGKI 102

Query: 115 SKLIKTVVDDDGNYINEFCIYPQKPSV--PETELKHLVFIHGYGAGLGFFIKNLEDIPLL 172
            ++I+T VD++GNYINEFCI P  P V   ++++ HL+F+HGYGAGLGFF+KN E+I LL
Sbjct: 103 GEIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFENIKLL 162

Query: 173 DNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIV 232
           +N W IHAID PGYGFSSRPKFPF   K+    V++WFH+R   W  KR LL   ++N+V
Sbjct: 163 NNSWTIHAIDFPGYGFSSRPKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQERNLV 222

Query: 233 VAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGV--SNRDFDNTTAEVGKWKPPPWWYVK 290
           +AHSLG+YL+ALY Q   +    KKL++CSPAG+  SN+            K PPWW+VK
Sbjct: 223 LAHSLGAYLIALYAQSRPK--HLKKLIMCSPAGICPSNKVI----------KQPPWWFVK 270

Query: 291 LWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRG 350
           LWDRN+SPF+LVRN+   GSK+TSGWS+RRFK  LN       +F+ALHRYAY+IFNK G
Sbjct: 271 LWDRNLSPFSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNKPG 330

Query: 351 SGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSK 410
           SGEYLLSF L+CGG+PR PL  +LFN + +   K +  +W+W+YG+ DWMD  GG + S 
Sbjct: 331 SGEYLLSFVLKCGGDPRSPLLSRLFNSQAADSFK-AQCDWLWMYGDQDWMDCKGGEQASD 389

Query: 411 YLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451
           ++   +G++SNV ++P +GHHLYLDNY+ FN++L  EM  +
Sbjct: 390 FIVRHIGKESNVHVIPQSGHHLYLDNYSVFNELLQAEMAKM 430

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  455 bits (1170), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 311/457 (68%), Gaps = 32/457 (7%)

Query: 8   FKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSA---------- 57
            K++++ +I R  K LQ    +       E +ES     T   IL +P+           
Sbjct: 12  IKTSITKLIKRDRK-LQTPQTSPQIFQNKEGNESKRSTTTTTTILSSPATTTKINTIAPT 70

Query: 58  -PTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSK 116
            PTAIPL  II  +P LFPR ++ S++D++ F K+ +  Q +LL+TLPF+ N +K+K  K
Sbjct: 71  PPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGK 130

Query: 117 LIKTVVDD-DGNYINEFCIYPQKP-SVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDN 174
           ++KT ++D D  YINEFCI P    ++   ++KHL+FIHGYGAGLGFFIKNLE+IPLL+N
Sbjct: 131 ILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNN 190

Query: 175 EWCIHAIDLPGYGFSSR-PKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVV 233
            WCIHAIDLPGYG+S+R  KFPF+YP+D+   VQ+WFH++IH W  KRNLL+ P  N++V
Sbjct: 191 RWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIV 250

Query: 234 AHSLGSYLMALYLQKYKESPS-FKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLW 292
           AHSLG+YLMA Y  K+   PS F+KL++CSPAGV+                PPWWY KLW
Sbjct: 251 AHSLGAYLMAQYAFKF---PSHFQKLIMCSPAGVTKSSIKKLNNS------PPWWYEKLW 301

Query: 293 DRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSG 352
           D N SPF++VRN+   GSKITS WSYRRFK  L+ D    ++FEALHRYAYSIFN+ G G
Sbjct: 302 DLNFSPFSIVRNSGIYGSKITSAWSYRRFKP-LDLD---HKQFEALHRYAYSIFNRPGCG 357

Query: 353 EYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYL 412
           EYLLSF L CGG PR  LE+ LF  EN   L     +W W+YG++DWMD++G  RVS+ +
Sbjct: 358 EYLLSFILSCGGNPRFSLEDTLFQREN---LSTELCDWGWIYGDNDWMDINGAKRVSRLI 414

Query: 413 NEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQ 449
           NE+   KS+V ++P AGHHLYLDNY  FNK+L+KEM+
Sbjct: 415 NEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEME 451

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  450 bits (1157), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/392 (53%), Positives = 288/392 (73%), Gaps = 12/392 (3%)

Query: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKT 120
           + L E+I + P LFPR    S +D++ F  + + FQ  LLETLP++P+PS    SK+  T
Sbjct: 59  LSLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNT 118

Query: 121 VVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHA 180
           +VDD+G+ INEF +YP   SVP  +LKHL+F+HGYGAGLGFF+KNLE+I LL++EWC+HA
Sbjct: 119 IVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178

Query: 181 IDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240
           IDLPGYGFS+R KFPF+  K     V +WFH RI  W ++RNLL     N ++AHSLG+Y
Sbjct: 179 IDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238

Query: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT 300
           LMALY+ K+      +K+++CSPAG+ +       +   K K P WW+ KLW+RNISPFT
Sbjct: 239 LMALYVDKHPN--DLQKILMCSPAGIGD-------SMNLKKKTPAWWFEKLWERNISPFT 289

Query: 301 LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFAL 360
           LVR++  +GSK+TSGW+YRRF  +L+ +    ++FEALH+Y YSIFN+RGSGEYLL+FAL
Sbjct: 290 LVRSSSYIGSKLTSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFAL 347

Query: 361 RCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKS 420
           +CGG PR PLE+ LF   N K +  S+ EW+W YG++DWMD +GG+RVS+ L ++L ++S
Sbjct: 348 KCGGGPRYPLEKTLFMN-NDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRS 406

Query: 421 NVFIVPHAGHHLYLDNYTFFNKILVKEMQNVK 452
            V+IVP AGHHLY DN+ FFN +++KEM+ +K
Sbjct: 407 EVYIVPRAGHHLYFDNHQFFNDLILKEMECMK 438

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  429 bits (1103), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 221/434 (50%), Positives = 284/434 (65%), Gaps = 22/434 (5%)

Query: 36  SESDESPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVF 95
           S  ++S E  G +   +   +APTA PL EI+  +P LFPR L +S +D+  F  N D+ 
Sbjct: 23  SLGEKSSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLM 82

Query: 96  QTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGY 155
           Q ELL TLPF+      K++ L KT +D DGNYINE  I P     P  + K L+F+HGY
Sbjct: 83  QLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVD-PNKKRKRLIFVHGY 141

Query: 156 GAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIH 215
           GAGLGF++KN E +PLLD+ W IHAIDLPGYGFSSR  FPF++P+D+   V DWF  R+ 
Sbjct: 142 GAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLR 201

Query: 216 TWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDF---D 272
           T F KR    K D NIV+AHS+G+YLMA YL KY +S   KK+V+CSPAG+S   +   +
Sbjct: 202 TLFEKRGF-DKSD-NIVMAHSMGAYLMAFYLNKYPDS--VKKMVMCSPAGISRSQYSINN 257

Query: 273 NTTAEVGKWKPP--------PWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHI 324
           N T ++   K          PWWY KLWDRNISPF LVR    LGSKITSGW+YRRFK I
Sbjct: 258 NITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPI 317

Query: 325 LNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKV-- 382
           L        +FE LHRY+++IFN +GSGEYLLSF L CGG+PR PLE  LF+ + +K   
Sbjct: 318 LLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGI 377

Query: 383 ----LKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYT 438
               +KNS+ EWVW+YG +DWMD+ G  RV+K       +KS V  +P +GHHLY DNY 
Sbjct: 378 DNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYP 437

Query: 439 FFNKILVKEMQNVK 452
            FN +L+ EM++++
Sbjct: 438 MFNSLLIDEMKSLQ 451

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  397 bits (1020), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 198/409 (48%), Positives = 268/409 (65%), Gaps = 27/409 (6%)

Query: 41  SPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELL 100
           S  +       +R  +AP  +PL +I+  +  LFP    +S+KD++ +  N++ FQ +LL
Sbjct: 43  STNKKSVRVNTVRKSTAPIGLPLLQIVTNLHKLFPLSFAESLKDYKQYNINKEQFQEDLL 102

Query: 101 ETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLG 160
             LP+YP PS    SK+IKT +D  GNYINEF I P +P      LKH++ +HGYGAGLG
Sbjct: 103 SVLPYYPEPSARFSSKIIKTPIDAAGNYINEFQITPIRPESDGKPLKHIILVHGYGAGLG 162

Query: 161 FFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNK 220
           F++KN     LL     +HAIDLPGYGFSSRP FPF YPKD+   V+D+FH+ +H WF+K
Sbjct: 163 FYLKNFN--ALLSENVVVHAIDLPGYGFSSRPMFPFHYPKDSYLAVEDYFHDALHKWFDK 220

Query: 221 RNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVS-NRDFDNTTAEVG 279
           + L+   + N V+AHS+G+Y+ +LY  KYK    FKKL +CSP G+S N+D         
Sbjct: 221 KGLISCWENNYVIAHSMGAYIFSLYANKYKH---FKKLFMCSPGGISRNKDM-------- 269

Query: 280 KWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALH 339
              PPPWW++KLWD+NISPF+LVRNA  +GSK+ SGW+ RRF             F+ LH
Sbjct: 270 --PPPPWWFLKLWDQNISPFSLVRNAGHVGSKLVSGWTARRFGL-------HHPNFDKLH 320

Query: 340 RYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDW 399
            Y Y IFN+ GSGEY+LSF L CGG PR+PLE +LF  EN     +S+ +WVWLYG+ DW
Sbjct: 321 HYTYGIFNQPGSGEYMLSFMLGCGGWPRVPLETRLFTEEN---FNSSHLDWVWLYGDSDW 377

Query: 400 MDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEM 448
           MD++G  R++ +L +K    + + IVP+AGHHLY DN +FFN +L KE+
Sbjct: 378 MDINGARRINDFLRKKC-INTKLEIVPNAGHHLYWDNDSFFNNVLRKEL 425

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  356 bits (913), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 192/415 (46%), Positives = 260/415 (62%), Gaps = 37/415 (8%)

Query: 52  LRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSK 111
           L+  +AP A  L +I+  +P LFPR + DS++D+  F  N + FQ  LL  L FYP  S 
Sbjct: 42  LKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYP--SL 99

Query: 112 Y-------------KKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAG 158
           Y             ++ ++IKT V+++  YINEF I P   S P   LKHL+ IHGYGAG
Sbjct: 100 YNNNSNDTSGNDDPRQGQIIKTYVNEN-EYINEFQILPNT-STPYDRLKHLILIHGYGAG 157

Query: 159 LGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHT---VQDWFHERIH 215
           LGF+I  L+ + +  + WCIHA+DLPGYGFSSR KFP+      +++   V DWF +R+ 
Sbjct: 158 LGFYINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLK 215

Query: 216 TWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTT 275
           TWF+K+ LL  P+ N+V AHS+G+Y+M  YL  +     F+K+++CSPAG       N  
Sbjct: 216 TWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSD--FRKIIMCSPAGF--YPASNPL 271

Query: 276 AEVGKWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRF 335
             +      P WY  LWDRN SPF+LVR +  LGSK+TSGWSY RF H  +     +   
Sbjct: 272 TNI------PLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELS 323

Query: 336 EALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENS--KVLKNSNYEWVWL 393
            ALH YAYSIFN  GSGEY LS  L+ GG+PR PL+E+ F  +++    ++ SN E+ WL
Sbjct: 324 LALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWL 383

Query: 394 YGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEM 448
           YG  DW++  GG ++S++LN  L +KSNVFI P++GHHLY DNY +FN  L KEM
Sbjct: 384 YGQSDWINKTGGFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  198 bits (504), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 146/408 (35%), Positives = 198/408 (48%), Gaps = 85/408 (20%)

Query: 96  QTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGY 155
           +  +L  L FYP   + ++ + +   +   GN I+EFCI   K S      + +V +HGY
Sbjct: 45  EENILSMLDFYPEGDESRRCETMDVDIGT-GNSIHEFCIENTKES-DRDYCRDMVLVHGY 102

Query: 156 GAGLGFFIKN---LEDIPLLDNEWCIHAIDLPGYGFSSRPKFP-----------FEYPKD 201
           GA LG FI+N   L  IP +     +HAID+ GYG SSRPKFP            E  K+
Sbjct: 103 GAALGLFIRNFDGLSQIPGIR----LHAIDMLGYGLSSRPKFPDTGFLTSFWKKREVTKE 158

Query: 202 NLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLC 261
           ++   +D+F + I TW +KR+L    DK ++V HSLG YL   Y  KY E    +KL+L 
Sbjct: 159 DVLLAEDFFIDSIETWRHKRHL----DKFVLVGHSLGGYLSCRYALKYPE--RVEKLILV 212

Query: 262 SPAGVSNRDFDNT---------TAEVG------------------KWKPPPWWYVK---- 290
           SP GV    FD T          AE+G                    +P   ++V     
Sbjct: 213 SPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDKPVQPSSSFHVPNESG 272

Query: 291 --------------LWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFE 336
                         +W+ NISPF ++R+    G  + S WS+RRF H   GD  Q  +F 
Sbjct: 273 HVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRFSHC--GDKEQVMKF- 329

Query: 337 ALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGN 396
             H YAY+ FN RGSGEY L+  L  G   R+PL         S   KN   E +W+YG+
Sbjct: 330 --HDYAYNTFNARGSGEYALTRILAPGVLARIPLL--------SCAPKNLKCESLWMYGS 379

Query: 397 DDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKIL 444
            DWM  + G  + K LN K G  ++  +V  AGHHLYLDN   FN+ L
Sbjct: 380 HDWMSKEAGSVIVKELN-KAGNTADYSVVSDAGHHLYLDNPHEFNQKL 426

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  184 bits (466), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 139/428 (32%), Positives = 199/428 (46%), Gaps = 91/428 (21%)

Query: 83  KDFRDFTKNEDVFQTE--LLETLPFYPNPSKYKKSKLIKTVVDDDGN--YINEFCIYPQK 138
           K F+ +    D  + E  LL TL F+P     +  +L+     D GN  +I+EF I    
Sbjct: 28  KAFKTWWSRADAKENEKKLLSTLEFFPGGDSIRNCELLDV---DIGNKQHIHEFSIQ-NI 83

Query: 139 PSVPETELKHLVFIHGYGAGLGFFIKN---LEDIPLLDNEWCIHAIDLPGYGFSSRPKFP 195
            S      K LV +HGYGA LG F++N   L  IP ++    +HA+D+ G G SSRP+FP
Sbjct: 84  ESCSRDYCKDLVMVHGYGAALGLFVRNFDGLSRIPGIN----LHALDMLGCGLSSRPRFP 139

Query: 196 F-----------EYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMAL 244
                          K+ ++  +++F + +  W  +R L    DK ++V HSLG YL   
Sbjct: 140 GTGLISSVIKRGRVTKEEVYEAENFFIDSLEKWRQQRKL----DKFVLVGHSLGGYLSCC 195

Query: 245 YLQKYKESPSFKKLVLCSPAGVSNRDFD---------NTTAEVG----------KWKPP- 284
           Y  K+ E    +KLVL SP GV    FD         N  +E+G            +P  
Sbjct: 196 YALKFPER--VEKLVLVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTT 253

Query: 285 -------------------------PWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYR 319
                                    PW +  +W  NISPF L+R+A   G  ++S WS+R
Sbjct: 254 DDPVKTSSSFHVPDEAGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFR 313

Query: 320 RFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGEN 379
           RF    N     + +    H Y YSIF+  GSGEY L+  L  G   R+PL         
Sbjct: 314 RFSFAEN-----TEQLLTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLL-------- 360

Query: 380 SKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQ-KSNVFIVPHAGHHLYLDNYT 438
           S+V +N   +  W+YG+ DWM  + G  + + +N+  G  K++  +V  AGHHLYLDN  
Sbjct: 361 SRVPENLKCDSFWMYGSHDWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPE 420

Query: 439 FFNKILVK 446
            FN+ L K
Sbjct: 421 EFNQKLAK 428

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  179 bits (454), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 191/411 (46%), Gaps = 85/411 (20%)

Query: 96  QTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGY 155
           + +LL TL F+P     +K K++   + D    I+E  I   K S   +    LV +HGY
Sbjct: 44  EKQLLSTLEFFPQGDSTRKCKILDVDIGDK-QTIHELEIENLKTS-SRSYANDLVLVHGY 101

Query: 156 GAGLGFFIKN---LEDIPLLDNEWCIHAIDLPGYGFSSRPKFPF-----------EYPKD 201
           GA LG F++N   L  +P +     +HAID+ G G SSRPKFP               K+
Sbjct: 102 GAALGLFVRNFDGLSSVPGIK----LHAIDMLGCGLSSRPKFPGTGLISSLIKRGNVTKE 157

Query: 202 NLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLC 261
            ++  +D+F + +  W  KR +    +K ++V HSLG YL + Y  KY E    +KLVL 
Sbjct: 158 EVYEAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALKYPER--VEKLVLV 211

Query: 262 SPAGVSNRDFDNT---------TAEVGKW----------KPPPWWYVK------------ 290
           SP GV    FD T          AE+G            KP     VK            
Sbjct: 212 SPVGVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNSSSFHVPDEHG 271

Query: 291 --------------LWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFE 336
                         +W  NISPF ++R    +G  I+S WS+RRF      DP Q   F 
Sbjct: 272 MVERVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFS--FTDDPKQLLTF- 328

Query: 337 ALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGN 396
             H Y Y +F+  GSGEY L+  L  G   RLPL         S++  N   +  W+YG+
Sbjct: 329 --HEYCYGVFSGAGSGEYALTRILAPGVLARLPLL--------SRMPGNLKCDSFWMYGS 378

Query: 397 DDWMDVDGGLRVSKYLNEKLG-QKSNVFIVPHAGHHLYLDNYTFFNKILVK 446
            DWM  + G  + K LNE  G  K++  IV  AGHHLYLDN   FN+ L+K
Sbjct: 379 QDWMSKEAGSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLK 429

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  178 bits (451), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 191/409 (46%), Gaps = 82/409 (20%)

Query: 96  QTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGY 155
           +  +L  L FYP+    +  +++   +   G+Y++EFCI  + P   +T  K +V +HGY
Sbjct: 41  EDNVLRMLSFYPDGDSERTCEVLHVDIGG-GDYMHEFCIENKLPMTRDT-CKDIVLVHGY 98

Query: 156 GAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFP----FEY-------PKDNLH 204
           G  LG FI+N +++  +     +HAID+ GYG SSRP+FP    ++Y        K+ + 
Sbjct: 99  GTALGVFIRNFDELSQIPGVR-LHAIDMLGYGLSSRPRFPRSGFWDYYVKGKVVTKEQVE 157

Query: 205 TVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPA 264
               +F + +  W  KRN+    D  ++V HSLG YL + Y  ++ E     KLVL SP 
Sbjct: 158 EALAFFVDSLEAWREKRNV----DSFVLVGHSLGGYLSSFYALRHPER--IDKLVLVSPV 211

Query: 265 GVSNRDFDNTT------AEVGKWKPP---------------------------------- 284
           GV    +D T          G+  P                                   
Sbjct: 212 GVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSPQSSSLHIPNEK 271

Query: 285 ---------PWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRF 335
                    PW    LW+ N+SPF+L+R    LG KI + WS+RRF     G    +   
Sbjct: 272 GFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRF-----GACKDTNEL 326

Query: 336 EALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYG 395
              H+YAY+ F  +GSGEY +   L  G   R+PL  QL        LK  +   +W+YG
Sbjct: 327 MNFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQL-----PGALKCDS---LWMYG 378

Query: 396 NDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKIL 444
           ++DWM  + G  + + L EK   ++   IV +AGHHLYLDN   FN+ L
Sbjct: 379 SNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFNREL 427

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 100/398 (25%), Positives = 160/398 (40%), Gaps = 86/398 (21%)

Query: 95  FQTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHG 154
           FQ  +++ +P Y      +KS +I +   +  ++ N  C   +  +VP       + +HG
Sbjct: 50  FQDAIMKKVPSYA-----EKSNVITSEGLNQWHFHNSKC---RNVTVPT------LLLHG 95

Query: 155 YGAGLGFFIKNLEDIP--LLDNEWCIHAIDLPGYGFSSR--PKFPFEYPK--------DN 202
           + +    F +N   +   ++D    ++AIDLP  G S     KF    PK        D+
Sbjct: 96  FASSSMSFFRNFTGLSQDIMD----LYAIDLPANGLSRSLSTKFYRVSPKETRKFDMLDD 151

Query: 203 LH-----------------TVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALY 245
           +H                   +D++ + I  W  + N LHK +   +VAHS G YL   Y
Sbjct: 152 IHFQLLSHGNYHAEKELIQKCEDYYIDTIERW-RRSNELHKIN---IVAHSFGGYLSFKY 207

Query: 246 LQKYKESPSFKKLVLCSPAGVS------NRDFD-NTTAEVGKWKPPPWWYVKLWDRNISP 298
             KY ES    KL L SP GV       N +F+   T  V +  P    Y+   + N  P
Sbjct: 208 ALKYPES--INKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYI---NENEIP 262

Query: 299 -------FTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGS 351
                  F ++R +  +G+K+   +    +  I + D           RY + +   +G 
Sbjct: 263 KYVFDNLFKILRLSGPIGAKLCWNYVLSSYSRISSLD---------FKRYVFELLYGKGG 313

Query: 352 GEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGG---LRV 408
                          RL   + L +  +S     S    + LYG  DWM  + G   L  
Sbjct: 314 MTATAINLFTQLFTTRLLARDPLMDSAHSL----SCNGILLLYGEYDWMAKNAGKSLLTN 369

Query: 409 SKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVK 446
            K  N+    K+    VP +GH+L+LDN  FFNK + +
Sbjct: 370 CKADNKGSASKTKYLEVPKSGHNLFLDNPAFFNKSIAE 407

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 92/343 (26%), Positives = 135/343 (39%), Gaps = 74/343 (21%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKF--------------- 194
           V IHGY A    F +  E+  L DN   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFEN--LSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 195 --------------PFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240
                         P E  K +L   + +F +RI  W  K N L K +   VV HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQW-RKDNKLRKIN---VVGHSFGGY 187

Query: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT 300
           +   Y  KY +  S +KL L SP GV N    +  A   KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPD--SIEKLCLISPLGVEN----SIHAITHKWEPNTTYPLTFTDPSSRYYT 241

Query: 301 LVRNARQ---------------LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSI 345
              N  +               +GSK+ S +    +  +    P Q  +   LH +    
Sbjct: 242 RKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV----PDQIYKDYLLHSFV--- 294

Query: 346 FNKRGSGEYLLSFALRCGG---EPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDV 402
               G  + +    ++      E  L   + + N  N + L N     +++YG  DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIIN--NVRFL-NPATPVMFMYGEHDWMDK 347

Query: 403 DGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILV 445
             G   ++ + +   + S V  VP AGH+L+LDN   F   LV
Sbjct: 348 YAGYLTTESMLKNKAKASYVE-VPDAGHNLFLDNPQHFASSLV 389

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 144/350 (41%), Gaps = 90/350 (25%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRP----------------- 192
           + IHGY A    + +N   +    +   +++IDLP  G SS P                 
Sbjct: 112 LLIHGYAASSMSYFRNYSGLS--KHFQNLYSIDLPASGLSSIPPLEVNTTTPLPLDIKFI 169

Query: 193 ---KFPFEYPKDNLH------TVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMA 243
              KF   Y  +  H        +D++ +RI  W     + +K DK  +V HS G YL  
Sbjct: 170 GKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQW----RIDNKLDKMNIVGHSFGGYLSF 225

Query: 244 LYLQKYKESPSFKKLVLCSPAGVS------NRDFDNTTAEVGKWK-PPPWWYVK------ 290
            Y  KY  S   +KL L SP GV       N +  + T     +K P   +Y K      
Sbjct: 226 KYAVKYPNS--VEKLCLVSPLGVERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIPK 283

Query: 291 -LWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKR 349
            L++     F L+R    LG+K+   W+Y                       AYS     
Sbjct: 284 YLFEEQ---FKLLRLMGPLGAKVC--WNYIM--------------------AAYSRVTSL 318

Query: 350 GSGEYLLSFALRCGGEPRLPLEEQLFNGENSK-------VLKNSNY----EWVWLYGNDD 398
              EY+       GG P +  +  +F G  S+       +L + NY    + + +YG  D
Sbjct: 319 AFKEYIFELFYGKGGIPEVTTD--IFKGLFSRSILARDPILDSLNYLNVKKLLVVYGQYD 376

Query: 399 WMDVDGGLRVSKYLNEKLG---QKSNVFIVPHAGHHLYLDNYTFFNKILV 445
           WM+ + G+ + + +N KLG   ++++   VP +GH+L+LDN   FN+ +V
Sbjct: 377 WMNKNAGMLLVENVN-KLGNGLERASYLEVPSSGHNLFLDNPESFNQSIV 425

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 91/343 (26%), Positives = 131/343 (38%), Gaps = 74/343 (21%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKF--------------- 194
           V IHGY A    F +  E   L DN   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSDNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 195 --------------PFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240
                         P E  K +L   +++F +RI  W  K N L + +   VV HS G Y
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQW-RKDNKLRRIN---VVGHSFGGY 187

Query: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT 300
           +   Y  KY  S    KL L SP GV N    +  A   KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPNS--IDKLCLISPLGVEN----SIHAIAHKWEPNTTYPLTFTDPSSRYYT 241

Query: 301 LVRNARQ---------------LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSI 345
              N  Q               +GSK+ S +    +  +    P Q  +   LH +    
Sbjct: 242 RKLNVPQFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV----PDQLYKDYLLHSFV--- 294

Query: 346 FNKRGSGEYLLSFALRCGG---EPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDV 402
               G  + +    ++      E  L   + + N      L N     +++YG  DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIINNVG---LLNPATHVMFMYGEHDWMDK 347

Query: 403 DGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILV 445
             G   ++ + +   + S V  VP AGH+L+LDN   F   LV
Sbjct: 348 YAGYLTTESMLKNKAKASYVE-VPDAGHNLFLDNPHHFTSSLV 389

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 98/371 (26%), Positives = 150/371 (40%), Gaps = 93/371 (25%)

Query: 129 INEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGF 188
           IN++    +K S   T L   + IHGY A    F +N     L  +   +++IDLP  G 
Sbjct: 94  INQWHFRNEKAS---TVLTPTLLIHGYAASSMSFFRNYPG--LSKHIQNLYSIDLPASGL 148

Query: 189 SSRP----------------------KFPF----EYPKDNLHTVQDWFHERIHTWFNKRN 222
           SS P                      K P+     + K  +   +D++ ++I  W     
Sbjct: 149 SSIPPLEINATTPLPLDIEFTGKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQW----R 204

Query: 223 LLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVS------NRDF-DNTT 275
           + +K  K  +V HS G YL   Y  KY  S   +KL L SP GV       N +F  NT 
Sbjct: 205 IDNKLGKVNIVGHSFGGYLSFKYAAKYPNS--VEKLCLVSPLGVERNIWSINNNFRSNTL 262

Query: 276 AEVGKWKPPPWWYVKLWDRNISP-------FTLVRNARQLGSKITSGWSYRRFKHILNGD 328
             +G   P   +Y K   RN+ P       F L+R    +G+K+   W+Y          
Sbjct: 263 YTIGFEDPSSKFYSK---RNMIPKYLFERQFQLLRMMGPVGAKLC--WNYIM-------- 309

Query: 329 PGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSN- 387
                        AYS        EY+       GG P +  E  +F G  S+ +   + 
Sbjct: 310 ------------AAYSRVPSLAYKEYIFELFYGKGGIPEVTTE--IFKGLFSRCILAKDP 355

Query: 388 ----------YEWVWLYGNDDWMDVDGGLRVSKYLNEKLG---QKSNVFIVPHAGHHLYL 434
                      + + +YG  DWM+   G+ + + LN  LG   +K++   +P +GH+L+L
Sbjct: 356 LMDSLHYLNVRKLMVVYGQYDWMNKKAGMLMVENLNS-LGNCLEKASYLEIPSSGHNLFL 414

Query: 435 DNYTFFNKILV 445
           DN   FN+ +V
Sbjct: 415 DNPLSFNQSIV 425

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 93/370 (25%), Positives = 150/370 (40%), Gaps = 108/370 (29%)

Query: 150 VFIHGYG----------AGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFP---- 195
           + +HGY           AGL  +IK+L            ++IDLP +G S  P+ P    
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKDL------------YSIDLPTFGLSKTPELPTRKV 112

Query: 196 -----------------------FEYPKDNLHTVQDWFHE--------------RIHTWF 218
                                  F+  KD++   + +++E              RI  W 
Sbjct: 113 TKNLKVTLSNSNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKW- 171

Query: 219 NKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVS------NRDFD 272
               + +K DK  +V HS G YL   Y  KY +S   +KL L SP G+       N  F+
Sbjct: 172 ---RIENKLDKINLVGHSFGGYLSYKYATKYPDS--IEKLCLVSPLGMESNIYSINNKFE 226

Query: 273 NTTA-EVGKWKPPPWWYVKLWDRNISPF------TLVRNARQLGSKITSGWSYRRFKHIL 325
           N    E+ +  P   ++     R I  F       ++R    +GS +T  W Y +  +  
Sbjct: 227 NDKIYEIEEEDPSSIFFTNT--RTIPKFLFNNQLNVLRWLGPVGSTLT--WKYIKASY-- 280

Query: 326 NGDPGQSRRFEALHR-YAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLK 384
                  R  +AL++ Y + +   +G  E             +L  ++ + +  +    K
Sbjct: 281 ------RRVDDALYKDYIHELIYGKGGMEETTIKTFTNLFTTKLLAKDPITDTVDKLKAK 334

Query: 385 NSNYEWVWLYGNDDWMDVDGGLRVSKYLNE-------KLGQ--KSNVFIVPHAGHHLYLD 435
           N     + LYG +DWM+   G +++K LNE       K+G+   +    VP AGH+L+LD
Sbjct: 335 NV----LLLYGQEDWMNNYAGYQMTKKLNELKGYNTSKVGELNYATYMEVPEAGHNLFLD 390

Query: 436 NYTFFNKILV 445
           N +FFNK L+
Sbjct: 391 NPSFFNKALL 400

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 95/339 (28%), Positives = 123/339 (36%), Gaps = 66/339 (19%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKF--------------- 194
           V IHGY A    F +  ++  L DN   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFKN--LSDNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 195 --------------PFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240
                         P E  K +L   + +F +RI  W    NL     K  VV HS G Y
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNL----RKINVVGHSFGGY 187

Query: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDF-------DNTTAEVGKWKPPPWWYVKLWD 293
           +   Y  KY    S  KL L SP GV N           NTT  V    P   +Y +   
Sbjct: 188 ISFKYALKYPN--SIDKLCLISPLGVENSIHAINHKWEANTTYPVTFTDPSSRYYTR--K 243

Query: 294 RNISPFTLVRNARQL------GSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFN 347
            N+  F        L      GSK+ S +    +  +    P Q  +   LH    S   
Sbjct: 244 LNVPQFIFENQLNVLKWMGPIGSKLCSSYISTAYVKV----PDQLYKDYLLH----SFVG 295

Query: 348 KRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGG-L 406
           K  S +           E  L   + + N      L N     +++YG  DWMD   G L
Sbjct: 296 KNQSVQPQTIKVFTQLFERNLIARDPIINNVG---LLNPATHVMFMYGEHDWMDKYAGYL 352

Query: 407 RVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILV 445
                L  K   K++   VP AGH+L+LDN   F   LV
Sbjct: 353 TTESMLKNK--AKASYMEVPDAGHNLFLDNPNHFTSSLV 389

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 152/373 (40%), Gaps = 93/373 (24%)

Query: 127 NYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGY 186
           N +N++    +K S   T L   + IHGY A    + +N   +     +  +++IDLP  
Sbjct: 103 NELNQWHFQNEKAS---TVLTPTLLIHGYAASSMSYFRNYPGLSKHIRD--LYSIDLPAS 157

Query: 187 GFSSRP--------------------KFPFEYPKDNLH------TVQDWFHERIHTWFNK 220
           G SS P                    KF   Y  +  H        +D++ +RI  W   
Sbjct: 158 GLSSIPSLEINATTPLPLDIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQW--- 214

Query: 221 RNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVS------NRDF-DN 273
             + +K  K  +V HS G+YL   Y  KY  S   +KL L SP GV       N +F  N
Sbjct: 215 -RIDNKLGKMNIVGHSFGAYLSFKYAVKYPNS--VEKLCLVSPLGVERNIWSVNNNFRSN 271

Query: 274 TTAEVGKWKPPPWWYVKLWDRNISP-------FTLVRNARQLGSKITSGWSYRRFKHILN 326
           +   +    P   +Y K   RNI P       F ++R    LG+K+   W+Y     IL 
Sbjct: 272 SPYTIDFENPSSKFYSK---RNIIPRYLFQQQFQILRMMGPLGAKLC--WNY-----ILA 321

Query: 327 GDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNS 386
                          AYS        EY+       GG P +  E  +F G  S+ +   
Sbjct: 322 ---------------AYSRVPSLAYKEYIFELFYGKGGIPAVTTE--IFEGLFSRSILAR 364

Query: 387 N-----------YEWVWLYGNDDWMDVDGGLRVSKYLNEKLG---QKSNVFIVPHAGHHL 432
           +            + + +YG  DWM+ + G+ + K LN  LG   +K+    +P +GH+L
Sbjct: 365 DPLMDSLNSLNVRKLLVVYGQYDWMNKNAGMLMVKELNN-LGDHFEKATYTEIPFSGHNL 423

Query: 433 YLDNYTFFNKILV 445
           +LDN   FN+ +V
Sbjct: 424 FLDNPESFNQSIV 436

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 128/334 (38%), Gaps = 74/334 (22%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKF--------------- 194
           V IHGY A    F +  E   L +N   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSNNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 195 --------------PFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240
                         P E  K +L   +++F +RI  W  K N L K +   VV HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQW-RKDNKLRKIN---VVGHSFGGY 187

Query: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT 300
           +   Y  KY    S  KL L SP GV N    +  A   KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPN--SIDKLCLISPLGVEN----SIHAITHKWEPNTTYPLTFTDPSSRYYT 241

Query: 301 LVRNARQ---------------LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSI 345
              N  +               +GSK+ S +    +  +    P Q  +   LH +    
Sbjct: 242 RKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV----PDQIYKDYLLHSFV--- 294

Query: 346 FNKRGSGEYLLSFALRCGG---EPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDV 402
               G  + +    ++      E  L   + + N      L N     +++YG  DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIINNVG---LLNPTMHVMFMYGEHDWMDK 347

Query: 403 DGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDN 436
             G   ++ +  K   K++   VP AGH+L+LDN
Sbjct: 348 YAGYLTTESM-LKNKAKASYIEVPDAGHNLFLDN 380

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 144/357 (40%), Gaps = 88/357 (24%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPK--------- 200
           V IHGY A    F  N+  +    ++ C+  +DLP  G S  P  P   PK         
Sbjct: 84  VLIHGYAASSMAFHLNVAGLSNAFSDLCV--VDLPANGLSREP--PMLGPKVKGQPVHWK 139

Query: 201 -------------------------DNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAH 235
                                    D+    +D+F +RI  W     L H  D   VV H
Sbjct: 140 ELDKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKW----RLAHGFDNINVVGH 195

Query: 236 SLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTA--EVGKW-------KPPPW 286
           S G Y+   Y  KY  S    KLVL SP GV  R+ D+ +   +VGK           P 
Sbjct: 196 SFGGYMSFKYAIKY--SKHVDKLVLLSPLGVE-RNIDSVSNKWDVGKTYDLTDIDATSPL 252

Query: 287 WYVKLWDRNISPFTL-----------VRNARQLGSKITSGWSYRRFKHILNGDPGQSRRF 335
           +Y         PFT+           +R    LG+ +       R+ ++    PG     
Sbjct: 253 YY--------RPFTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRYSNV----PGT---- 296

Query: 336 EALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYG 395
            A H Y + +F    +       A       +L   + L   +N + LK +  + + +YG
Sbjct: 297 -AYHAYLHHVFYGAHTFPSANITAFTHLFTRQLLARDPLL--DNIQRLKVN--KLMMVYG 351

Query: 396 NDDWMDVDGGLRVSKYLNEK--LGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQN 450
           + DWM+ + G  + + +N++  +  K+    +P AGH+L+LDN + FNK+L+  +++
Sbjct: 352 DHDWMNKEAGYGMVQEINKERYVPAKAVYAELPSAGHNLFLDNPSGFNKLLIDFLRD 408

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 89/342 (26%), Positives = 140/342 (40%), Gaps = 73/342 (21%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPK--------- 200
           + IHGY A    + +N   +     +  ++AIDLP  G S+   F     K         
Sbjct: 116 LLIHGYAASSMAYYRNFTGLSQTVTD--LYAIDLPANGLSAEQPFKLNGDKPRSLKVKYL 173

Query: 201 DN-----------------LHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMA 243
           DN                 +   + ++ ++I  W  K N L K +   +V HS G YL  
Sbjct: 174 DNDKFSVQHVIDESGTKQMIQQCESYYLDKIEEW-RKVNKLEKIN---LVGHSFGGYLSF 229

Query: 244 LYLQKYKESPSFKKLVLCSPAGV-------SNRDFDNTTAEVGKWKPPPWWYVKLWDRNI 296
            Y  KY  S   +KL L SP GV       +N+   NT   +    P   +Y +   R I
Sbjct: 230 KYALKYPNS--IEKLCLVSPLGVETSIYSVNNKLEKNTKYALDLEDPTSNFYTR--RREI 285

Query: 297 SPFT------LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHR-YAYSIFNKR 349
             F       ++R    LG+K+   W+Y     IL+     SR  E  ++ Y + +   +
Sbjct: 286 PKFIFKNQSEILRWMGPLGAKMC--WNY-----ILSA---YSRIPEMEYKSYIFELLYGK 335

Query: 350 G----SGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGG 405
           G    +   + +         + P+ + L   +  KVL         +YG+ DWM+   G
Sbjct: 336 GGIAPTARQIFTNLFTRNLLAKDPIMDSLGQLQAKKVL--------LVYGDHDWMNKYAG 387

Query: 406 LRVSKYLNEKLGQKSNVFI-VPHAGHHLYLDNYTFFNKILVK 446
            ++ + LN      S  +I VP +GH+L+LDN TFFN  L +
Sbjct: 388 YKLVERLNTIRNNTSAQYIEVPESGHNLFLDNPTFFNASLTE 429

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 89/343 (25%), Positives = 138/343 (40%), Gaps = 76/343 (22%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRP----------------- 192
           + IHGY A    F +N     L  +   +++ID+P  G SS P                 
Sbjct: 130 LLIHGYAASSMSFFRNYPG--LSKHIRNLYSIDMPASGLSSVPSLEINTTTPLPLDIKFI 187

Query: 193 ---KFPFEYPKDNLHT------VQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMA 243
              KF   Y  +  H        +D++ +RI  W     + +K  K  VV HS G YL  
Sbjct: 188 GENKFKVPYTINANHNKFVIQMYEDFYLDRIEQW----RIDNKLGKMNVVGHSFGGYLSF 243

Query: 244 LYLQKYKESPSFKKLVLCSPAGVS------NRDFDNTTAEVGKWK-PPPWWYVKLWDRNI 296
            Y  KY    S  KL L SP GV       N +F + T     +K P   +Y K   RN+
Sbjct: 244 KYAVKYPN--SVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYSK---RNM 298

Query: 297 SP-------FTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKR 349
            P       F ++R    LG+K+   +    +  +    P       A   Y + +F  +
Sbjct: 299 IPKYLFEQQFHILRMMGPLGAKLCWNYIMAAYSRV----PSL-----AYKEYIFELFYGK 349

Query: 350 G-----SGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDG 404
           G     + +   +   RC    + PL + L      K+L         +YG  DWM+   
Sbjct: 350 GGIPEVTTDIFKALFSRC-ILAKDPLMDSLQYLNVKKLL--------IVYGQYDWMNKKA 400

Query: 405 GLRVSKYLN--EKLGQKSNVFIVPHAGHHLYLDNYTFFNKILV 445
           G+ + K LN  +   + ++   +P +GH+L+LDN   FN+ +V
Sbjct: 401 GMFMVKELNNLKNCLEGASYLEIPSSGHNLFLDNPESFNQSIV 443

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 86/346 (24%), Positives = 146/346 (42%), Gaps = 65/346 (18%)

Query: 142 PETELKH-LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFS----------- 189
           P+ E++   + +HGY A    F +N   +     +  ++AIDLP  G S           
Sbjct: 91  PKGEIRTPTLLVHGYAASSMGFHRNFPGLSQSIKD--LYAIDLPASGLSPALPLEMRCTQ 148

Query: 190 --------SRPKFPFEYPKDNLH------TVQDWFHERIHTWFNKRNLLHKPDKNIVVAH 235
                   S+  F   Y  + LH        +D++ + I  W +   L   P    +VAH
Sbjct: 149 PLDLKINMSKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKL--GPIN--IVAH 204

Query: 236 SLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFD-------NTTAEVGKWKPPPWWY 288
           S G YL   Y  K+  +   +KL L SP GV    F        NT+  +    P   +Y
Sbjct: 205 SFGGYLSFKYAVKFPHA--VEKLCLVSPLGVERNIFSVNNQWRSNTSYNLDFENPASKFY 262

Query: 289 VK--------LWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHR 340
           +K        ++++      L+RN   LG+K++  +    +  + + D  +   FE L  
Sbjct: 263 IKKGPAIPRLVFEQQTQ---LLRNLGPLGAKLSWNYINAAYSRVPSLD-YKKYVFELL-- 316

Query: 341 YAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWM 400
           Y  +  N+     ++  F  R      L L+   F G+++K++         +YG+ DWM
Sbjct: 317 YGKNGLNQTSKDLFIGLFNNRVLARDPL-LDSIQFFGKSAKLM--------CIYGDHDWM 367

Query: 401 DVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVK 446
           +   G+ +    N+ LG ++    V  +GH+L+LDN   FN  LV+
Sbjct: 368 NRRAGMEMVNEANQ-LGIEAKYNEVSSSGHNLFLDNPEEFNDKLVR 412

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 97/376 (25%), Positives = 147/376 (39%), Gaps = 92/376 (24%)

Query: 127 NYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGY 186
           N IN++  +  + S+ +T     + IHGY A    + +      L D    ++AIDLP +
Sbjct: 83  NEINQWHFHNPEASLVDTPT---LLIHGYAASSLAYFRTFSG--LSDKIKNLYAIDLPSF 137

Query: 187 GFSSRPKFPFE---------YPKDN-------------------LHTVQDWFHERIHTWF 218
           G S+ P   F+            DN                   +   +D++ E+I  W 
Sbjct: 138 GLSNAPPLDFKEKVSDIKIKLSDDNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDW- 196

Query: 219 NKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGV-SNRDFDNTTAE 277
            K N L K +   +V HS G Y+   Y  KY ++    +L L SP G+ SN    N   E
Sbjct: 197 RKANKLEKIN---LVGHSFGGYISFKYAIKYPDA--INRLCLVSPLGMESNIHSVNNNFE 251

Query: 278 VGKW------KPPPWWYVKLWDRNISPF------TLVRNARQLGSKITSGW---SYRRFK 322
             K        P   +Y K  +R I  F       ++R    +GSK+   +   SYRR  
Sbjct: 252 TKKEYPLDLEDPSSRFYAK--ERRIPNFLFKNQLNVLRWMGPIGSKLCWNYINASYRRVP 309

Query: 323 HILNGDPGQSRRFEALH------RYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFN 376
           + L     +   FE L+           IF    +   L           R P+ + +  
Sbjct: 310 NPL----FKEYLFELLYGKGGMPSVTIDIFTNLFTRSLL----------ARDPIMDSISK 355

Query: 377 GENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNE-------KLGQKSNVFIVPHAG 429
            +  KVL         LYG  DWM+   G  + + LN+            +N   VP AG
Sbjct: 356 LKAEKVL--------LLYGEHDWMNNLAGYNMVESLNQLKPNNNISTIDYANYVEVPDAG 407

Query: 430 HHLYLDNYTFFNKILV 445
           H+L+LDN  FFN  ++
Sbjct: 408 HNLFLDNPQFFNSAVL 423

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 131/335 (39%), Gaps = 83/335 (24%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWC-IHAIDLPGYGFSSRPKFPFEYPK-------- 200
           V IHGY A    F ++   IP L+ +   ++ IDLPG G S  P    E  K        
Sbjct: 110 VLIHGYAATSTAFFRS---IPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIEN 166

Query: 201 -------------DNLH------TVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYL 241
                        D+ H       + D++ +RI  W     L +K  K  VVAHS G YL
Sbjct: 167 IDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQW----RLDNKLGKINVVAHSYGGYL 222

Query: 242 MALYLQKYKESPSFKKLVLCSPAGVS------NRDFDNTTAEVGKWKPPPWWYVK----- 290
              Y  KY    +   L L SP GV       N +F + T    +W      +       
Sbjct: 223 SFNYALKY--PANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKL 280

Query: 291 ---LWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEAL--HRYAYSI 345
              L+ + + P   +R    +G+K+   W+Y R  +          R  ++    Y +  
Sbjct: 281 NDYLFQKQLKP---LRWLGPIGAKLC--WNYIRSAYA---------RVPSIDYKDYTFET 326

Query: 346 FNKRG----SGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMD 401
           F  RG        + +  L      R PL + +   +  K+        + +YG  DWM+
Sbjct: 327 FYGRGGLPEQTSQIFTSLLTSSLLARDPLLDHVSQLQVPKL--------IMMYGQYDWMN 378

Query: 402 VDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDN 436
            +GG    K + +    ++    +P+AGH+L+LDN
Sbjct: 379 KNGG----KLMTQIFNGETKYIDIPNAGHNLFLDN 409

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 141/348 (40%), Gaps = 79/348 (22%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFS-------------------S 190
           + +HGY A    F +N E +     +  ++AIDLP  G S                   S
Sbjct: 100 LLLHGYAASSMAFHRNFEGLSKCIRD--LYAIDLPANGLSPPQPLEIRCTEPQPLKIEIS 157

Query: 191 RPKFPFEYPKDNLH------TVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMAL 244
              F   Y  ++LH        +D++ + +  W     L +K     +VAHS G Y+   
Sbjct: 158 NDTFKLPYTINSLHHKSAIQNFEDYYLDALEQW----RLDNKLGPINIVAHSFGGYISFR 213

Query: 245 YLQKYKESPSFKKLVLCSPAGVSNRDF-------DNTTAEVGKWKPPPWWYVKLWDRNIS 297
           Y  KY    + K+L L SP GV    F        NT  ++    P   +Y++     I 
Sbjct: 214 YAVKYPH--AVKRLCLLSPLGVERNIFSVNNNWRSNTQYKLDFENPASKFYIR-KGPAIP 270

Query: 298 PFT------LVRNARQLGSK-----ITSGW----SYRRFKHILNGDPGQSRRFEALHRYA 342
           P        ++R    LG++     IT+ +    S +  ++I     G++    AL + +
Sbjct: 271 PAIFELQTKVLRGLGPLGARLCWNYITAAYARVPSLKYKQYIFEMFYGKN----ALTQTS 326

Query: 343 YSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDV 402
             IF    +   L           R PL + L +  + K+L         +YG+ DWM+ 
Sbjct: 327 KDIFTGLFTNRLL----------ARDPLLDSLCHVRSKKLL--------LMYGDHDWMNR 368

Query: 403 DGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQN 450
             GL +     +KLG  +    V  +GH+L+LDN    N+++V  ++N
Sbjct: 369 KAGLEMVTE-AKKLGIDAQYGEVSSSGHNLFLDNPEESNELIVSFLRN 415

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 87/362 (24%), Positives = 144/362 (39%), Gaps = 92/362 (25%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRP---------KFPFEYPK 200
           + +HGYGA    + +     PL  +   ++AIDLP  G S  P         K  F+  +
Sbjct: 48  LLVHGYGASSMAYHRCF--APLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKIEE 105

Query: 201 DNLHTVQ----------------------------------DWFHERIHTWFNKRNLLHK 226
           +    VQ                                  D++ E I  W  + NL   
Sbjct: 106 NKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNL--- 162

Query: 227 PDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAG-------VSNRDFDNTTAEVG 279
            DK  +V HS G YL   Y  KY E  S  KL L SP G       ++N   +N   E+ 
Sbjct: 163 -DKFNLVGHSFGGYLSYKYALKYPE--SVNKLCLLSPLGMERNIHSINNTFEENVVYELQ 219

Query: 280 KWKPPPWWYVKLWDRNISP-------FTLVRNARQLGSKITSGWSYRRFKHILNGDPGQS 332
           +  P  + Y +   +  +P       F+++R    +G K+   +    +  +    P Q+
Sbjct: 220 ESDPSSYLYTR---KRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKV----PSQA 272

Query: 333 RR---FEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYE 389
            +   FE+     +       + ++L + +L      R P+ + +   +  KV   S + 
Sbjct: 273 YKDYLFESFLGKKHFAKQNVHALKHLFTRSLLA----RDPIMDTI---DKLKVPDVSVF- 324

Query: 390 WVWLYGNDDWMDVDGGL----RVSKY-LNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKIL 444
               YG+ DWM+   G     R+ K+ +    G  ++   VP AGH+L+LDN  +F+K L
Sbjct: 325 ----YGDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKL 380

Query: 445 VK 446
           V+
Sbjct: 381 VQ 382

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 85/354 (24%), Positives = 135/354 (38%), Gaps = 94/354 (26%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPK-----------FPFEY 198
           + +HGY      F +     PL      ++AID P  G S  P            +  ++
Sbjct: 107 LLLHGYATSSIAFFRTFG--PLSKQIRDLYAIDFPANGLSKAPPLNVNHLKKHTPYKVKF 164

Query: 199 PKDNL-----HTV------------QDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYL 241
             DN      HTV            ++++ + +  W     L +K +K  +V HS G Y 
Sbjct: 165 KDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKW----QLTNKIEKFNLVGHSFGGYF 220

Query: 242 MALYLQKYKESPSFKKLVLCSPAGVS------NRDFDNTTAEVGKWKPPPWWYVKLWDRN 295
              Y  +Y +S    KL L SP GV       N +F++      + + P     K + R 
Sbjct: 221 AYKYALRYPDS--VDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPT---SKYYGRT 275

Query: 296 IS--------PFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFN 347
                      F ++R    LG + T  W+Y    +         RR  ++         
Sbjct: 276 FQIPKCLFEGQFDILRKFGPLGPRFT--WNYINSSY---------RRVPSME-------- 316

Query: 348 KRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSK-------------VLKNSNYEWVWLY 394
                EY+  F L  G     P+  ++F+   S+              LK SN   + +Y
Sbjct: 317 ---FKEYI--FELLYGNRKTSPILTEVFSNIVSRNLLARDPILDSIDELKASNV--MLMY 369

Query: 395 GNDDWMDVDGGLRVSKYLNE--KLGQKSNVFIVPHAGHHLYLDNYTFFNKILVK 446
           G +DWM+   G  + K LNE  +    ++   VP+AGH+L+LDN  FF   L +
Sbjct: 370 GQEDWMNSQAGYLMVKELNEIRENPNAASYVEVPNAGHNLFLDNPDFFCSSLTR 423

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/363 (23%), Positives = 143/363 (39%), Gaps = 76/363 (20%)

Query: 129 INEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGF 188
           IN++  Y    S+    L     +HGY A    F +N     L      ++AIDLP  G 
Sbjct: 83  INQWHFYNASASIKTPTL----LLHGYAAASMGFHRNFAG--LSSRIQNLYAIDLPANGL 136

Query: 189 S---------------------SRPKFPFEYPKDNLHT------VQDWFHERIHTWFNKR 221
           S                     S  +F   Y  + LH       ++D++   I  W    
Sbjct: 137 SPGSSQPLVVSCGEPLPMKAEFSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQW---- 192

Query: 222 NLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAG-------VSNRDFDNT 274
            + +K +K  +VAHS G YL   Y  KY    + ++L L SP G       V+N    NT
Sbjct: 193 RIDNKLNKINIVAHSFGGYLSTKYAIKYPH--AVERLCLVSPLGVERNIHSVNNHWCSNT 250

Query: 275 TAEVGKWKPPPWWYVKLWDRNI------SPFTLVRNARQLGSKITSGWSYRRFKHILNGD 328
             ++    P   +Y++   R I      S   L+R    LG+K+   W+Y      +N  
Sbjct: 251 WYDLNYEDPGSKYYMRRM-RGIPSTVFQSQVKLLRLLGPLGAKLC--WNY------INAA 301

Query: 329 PGQSRRFEALHRYAYSIF-NKRGSGEYLLSFALRCGGEPRL---PLEEQLFNGENSKVLK 384
             + +  E    Y + +F  K G  +  +           L   PL + L +    +++ 
Sbjct: 302 YSRVKN-EKYKEYVFELFYGKEGVTQTAMDIFTNLFTRQLLAKDPLMDSLQHLHVGRLM- 359

Query: 385 NSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQK--SNVFIVPHAGHHLYLDNYTFFNK 442
                    YG  DWM+   G+ ++K  N   G+   +   ++  +GH+++LDN   FN+
Sbjct: 360 -------LAYGEHDWMNKYAGVLMTKEFNHLRGKSDAATYTVISSSGHNMFLDNPDEFNE 412

Query: 443 ILV 445
            ++
Sbjct: 413 KVI 415

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 94/415 (22%), Positives = 152/415 (36%), Gaps = 128/415 (30%)

Query: 127 NYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGY 186
           N IN++  +    S  +T     V IHGY A    + K      L  +   ++ IDLPG+
Sbjct: 34  NEINQWHFHNANASTIKTPT---VLIHGYAASSMAYYKTFR--YLTGSIKDLYTIDLPGF 88

Query: 187 GFSSRPKF-------------------------PFEYPKDNLHTVQ-------------- 207
           G S+ PK                           F   K NL  ++              
Sbjct: 89  GLSASPKIIINDHNRKKSQFDIKLIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFD 148

Query: 208 DWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGV- 266
           D++ +RI  W  K N L K +   V+ HS G Y+   Y  KY +S   + L L SP G+ 
Sbjct: 149 DYYIDRIEKW-RKFNNLGKIN---VIGHSFGGYISFKYAIKYPDS--IENLCLVSPFGME 202

Query: 267 ----------------------------------------------SNRDFDNTTAEVGK 280
                                                         +N D D T  E+  
Sbjct: 203 SNVYSINNYDDWKEKFSNPSSTRTSSVSSLGSSNSILNDSGTKIFKTNSDTD-TQLELDL 261

Query: 281 WKPPPWWYVKLWDRNISP-------FTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSR 333
             P   +Y +     + P       F +++    LGSK+T  +  RR++HI +       
Sbjct: 262 VDPTSKYYFR---EKVVPGVLFNNQFNVLKCMGPLGSKLTWSFISRRYEHIAS------- 311

Query: 334 RFEALHRYAYSIFNKRGSGEYL-LSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVW 392
             EA   + + +F    +      S         + P+ + +   ++ K+L         
Sbjct: 312 --EAYQNFLFKLFATVPNVTINNFSNMFTRNLLAKDPIMDSINKLQSKKLL--------L 361

Query: 393 LYGNDDWMDVDGGLRVSKYLNEKLGQK--SNVFIVPHAGHHLYLDNYTFFNKILV 445
            YG +DWM+ + G  +++ LN   G    +N   VP++GH+L LD+  FF+K L+
Sbjct: 362 FYGENDWMNKEAGFLMAEKLNILKGDSKYANWIEVPNSGHNLILDDPKFFSKNLI 416

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 92/347 (26%), Positives = 137/347 (39%), Gaps = 83/347 (23%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFS----------SRPK------ 193
           + IHGY A    F +N E + L   +  ++A+DLPG G S           +P       
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSLSLKD--VYAVDLPGNGLSKELPLSVDSMQKPDRVEFNE 147

Query: 194 ------FPFEYPKD------NLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYL 241
                 F  + P D      +L   +D++ + +  W  K N L K +   +V HS G YL
Sbjct: 148 TVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKW-RKENKLSKIN---LVGHSYGGYL 203

Query: 242 MALYLQKYKESPSFKKLVLCSPAGVSNRDFD-------NTTAEVGKWKPPPWWYVKLWDR 294
              Y  KY +  +  KL L SP GV    F            E+    P    Y     R
Sbjct: 204 TFKYSLKYPD--NVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPSKSNYSN--KR 259

Query: 295 NISPFTL------VRNARQLGSKITSGW---SYRRFKHILNGDPGQSRRFE------ALH 339
           NI    L      +R    LG+K   G+   SY R   +    P +   F+       + 
Sbjct: 260 NIPKLILQYQNKALRWMGPLGAKACWGYVNSSYGRVPSV----PYREYVFQLVFGKGIMT 315

Query: 340 RYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDW 399
             +  IFN+  S   LL++          P+ + L   + SK++         +YG  DW
Sbjct: 316 DTSIRIFNQLFS-RSLLAYD---------PIMDSLDKVKVSKLM--------LVYGEHDW 357

Query: 400 MD-VDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILV 445
           M+ V G L + ++ + +        IV  AGH+L LDN + FN  LV
Sbjct: 358 MNKVAGRLAIEEFNSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKLV 404

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 84/347 (24%), Positives = 134/347 (38%), Gaps = 82/347 (23%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSR----------PKFPFEYP 199
           + IHGY A    + +  +   L D    ++ IDLP  G S            P    E  
Sbjct: 62  LLIHGYAASSMAYYRTFQG--LTDKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEIH 119

Query: 200 KDN-----------------LHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLM 242
           KD                  +   +D++ + I  W  K N + + +   +V HS G Y+ 
Sbjct: 120 KDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELW-RKHNGIGRFN---LVGHSFGGYIA 175

Query: 243 ALYLQKYKESPSFKKLVLCSPAGVS------NRDFD-NTTAEVGKWKPPPWWYVKLWDRN 295
             Y  KY ++   ++L L SP GV       N D+  +T  E+    P    Y K W+  
Sbjct: 176 FKYAVKYPKA--VEQLGLISPLGVESNIYSVNNDWKLDTVYEMESTDPASRMYGKNWEIP 233

Query: 296 ISPFT----LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGS 351
              F     L+R    +G+K+   W+Y                       AY+       
Sbjct: 234 KVLFERQTELLRWMGPIGAKLC--WNYITA--------------------AYNKLPTMEY 271

Query: 352 GEYLLSFALRCGGEPRLPLEEQLFNGENSKVL-----------KNSNYEWVWLYGNDDWM 400
            +Y+       GG P+     ++F G  ++ L           K    + + LYG+ DWM
Sbjct: 272 KDYVFELLYGNGGIPKTA--RKVFGGLFTRSLLARDPIMDSMDKLGARKVLLLYGDSDWM 329

Query: 401 DVDGGLRVSKYLNEKLGQKSNVFI-VPHAGHHLYLDNYTFFNKILVK 446
           +   G R+ + LN+K G+    +  VP A H+L+LDN   FN  L++
Sbjct: 330 NNYAGYRMVELLNQKRGKGYATYDEVPDARHNLFLDNPDSFNDKLIQ 376

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 127/342 (37%), Gaps = 74/342 (21%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSS------------------- 190
           + +HGY      + +N+    L +    ++ IDLP  G S                    
Sbjct: 87  LLLHGYATSSMCYHRNMPQ--LSEGIKHLYTIDLPANGLSKELPLELDIAKPIVFKPEFN 144

Query: 191 --RPKFPFEYPKDNLH------TVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLM 242
             + +F   Y  D LH       ++D++ + I  W  K +L        +V HS G Y+ 
Sbjct: 145 SVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSL----GAINLVGHSFGGYIS 200

Query: 243 ALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT-- 300
             Y  KY +  + KKL L SP GV      N  +    W+    + +   D +   F   
Sbjct: 201 FKYSIKYPQ--NVKKLCLISPIGVER----NIYSVHNNWRSNCPYSIDYEDPSSKHFANK 254

Query: 301 -------------LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFN 347
                        L+R    LG+K+  GW Y      +N    +   F  L      I+ 
Sbjct: 255 TMIPEFVFNEQTKLLRLMGPLGAKL--GWKY------INAVYSKVPNFLYLEFIFTLIYG 306

Query: 348 KR---GSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDG 404
           K     +   + ++        R P+ + L +    K+L         LYG  DW+    
Sbjct: 307 KNVMTDTSRNIFTYLFTNSLLARDPMLDSLEHLHVDKLLM--------LYGEHDWVRSQP 358

Query: 405 GLRVSKYLNEKLGQKSNVF-IVPHAGHHLYLDNYTFFNKILV 445
           G  + +  N++    S    +VP A H+L+LDN  FFN  L+
Sbjct: 359 GKMMVEEFNKQRSHPSGTLTVVPDASHNLFLDNPVFFNVALL 400

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 83/349 (23%), Positives = 134/349 (38%), Gaps = 77/349 (22%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRP----------------- 192
           V IHGY A    + + L    L  N   ++ IDLP    SS P                 
Sbjct: 70  VLIHGYAASSMAYYRTLA--TLSKNVKDVYVIDLPANSLSSVPPHSDISHLKINKIKVVQ 127

Query: 193 --------KFPFEYP----------KDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVA 234
                   K+ F+            K  +  +++++ + I  W   R   +  DK  +V 
Sbjct: 128 VSKDKENEKYVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKW---RRANYGLDKFNLVG 184

Query: 235 HSLGSYLMALYLQKYKESPSFKKLVLCSPAGVS------NRDFDNTTAEVGKWKPPPWWY 288
           HS G YL   Y  KY E     KL L SP GV+      N  FD     V   + P    
Sbjct: 185 HSFGGYLSFKYAIKYPEV--VDKLCLVSPLGVASNIRSVNNVFDTKKEYVMDLQNPGSM- 241

Query: 289 VKLWDRN-ISPFTLVRNARQL-------GSKITSGWSYRRFKHILNGDPGQSRRFEALHR 340
             L++R  + P  L  N   +       GSK+T  +    +  +   D            
Sbjct: 242 --LYNRQRMIPNFLFNNQLNVLKWMGPVGSKLTRKYINSAYVKVPTMD---------YKD 290

Query: 341 YAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWM 400
           Y Y  F + G  +  +    +      +  +  +   +N   LK++   ++ +YG++DWM
Sbjct: 291 YLYEYF-QMGVPQVNVDIFTKLFSRNLMARDPIM---DNMNRLKST--RFMMMYGDNDWM 344

Query: 401 DVDGGLRVSKYLNE---KLGQKSNVFIVPHAGHHLYLDNYTFFNKILVK 446
           D   G  + + +N+      +K+    +P AGH+L+LDN   F+  L+K
Sbjct: 345 DKFSGYTLVQNINKIKNNFDRKATYVEIPDAGHNLFLDNPEDFSNNLIK 393

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/343 (22%), Positives = 127/343 (37%), Gaps = 96/343 (27%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSR-PKFPFEYPKD------- 201
           V +HGY +    F +NL  +     +  ++A+DLPG G S   P  P             
Sbjct: 86  VLLHGYASSAVSFHRNLAALGAQVEQ--LYALDLPGNGMSQELPLGPAAARALARRCGAR 143

Query: 202 -NLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVL 260
            ++  + D++ + +  W     L    +      HS G YL   Y    +     ++L L
Sbjct: 144 ADIRALADYYLDALERWRAANGL----ETLNAAGHSFGGYLAFKY--ALRHPARVQRLCL 197

Query: 261 CSPAGVSNRDFDNTTAEVGKWKP------------------------PPWWYVKLWDRNI 296
            SP GV  +         G+  P                        PP  + +      
Sbjct: 198 VSPLGVEAQ-------TAGRRMPGRATRRRTRPPTPASPHYTRAAALPPLLFEQ------ 244

Query: 297 SPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLL 356
               ++R    LG+ +   +    F  +    PG+       HRY +++ ++        
Sbjct: 245 -QLRVLRWLGPLGAHLLWQYVNASFSRV----PGRE-----FHRYTFALLHR-------- 286

Query: 357 SFALRCGGEPRLPLEEQLFNG-------------ENSKVLKNSNYEWVWLYGNDDWMDVD 403
             ALR       PL  +LF G             ++   LK  N +   LYG+ DWMD  
Sbjct: 287 -LALR-------PLPRKLFTGLFTNALLARDPLLDSLAELKVPNVQL--LYGDHDWMDAR 336

Query: 404 GGLRVSKYLNEKLGQ-KSNVFIVPHAGHHLYLDNYTFFNKILV 445
            G  +   LN   G+  +++ IVP AGH+L+LDN   F+  L+
Sbjct: 337 AGRALVAELNALRGRPDASLAIVPAAGHNLFLDNPEDFHSWLL 379

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 80/345 (23%), Positives = 128/345 (37%), Gaps = 79/345 (22%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFP-------------- 195
           + IHGY A    F +    +     +  ++AIDLPG G SS P+                
Sbjct: 72  LLIHGYAASSMAFHRTFNRLSTDIKD--LYAIDLPGNGLSSAPELSDVIKMKDLKITLNK 129

Query: 196 ------------FEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMA 243
                        E  K NL   ++++  RI  W       H  +K  V+ HS G ++  
Sbjct: 130 SKDGFTLKKAIDLEIEKANLAKYENYYLSRIDEW----RKFHGIEKLNVIGHSFGGFISF 185

Query: 244 LYLQKYKESPSFKKLVLCSPAGVS------NRDFDNTTAEVGKWKPPPWWYVKLWDRNIS 297
            Y   +    +   L+L SP G+       N +F+  T     ++ P   Y   + R+ +
Sbjct: 186 KYAITHPNQVN--DLILVSPLGMEKNIHSLNNNFELETKYTLDFENPASLY---YARSFN 240

Query: 298 -PFTLVRNARQ-------LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKR 349
            P  L  N          LG ++   +    +K + +          A   Y Y +F   
Sbjct: 241 VPSILFNNQLNILRWMGPLGGRMARQYIDMAYKKVPD---------VAYKNYLYYVFYDG 291

Query: 350 GS------GEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVD 403
            S        +   F+       R P+ + L      KV+         +YG  DWMD  
Sbjct: 292 KSFPKVTINNFTNMFSKNLLA--RDPIMDNLLKLRAKKVM--------LVYGEHDWMDKY 341

Query: 404 GGLRVSKYL---NEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILV 445
            G  + + L   N KL    +   +P AGH+L+LDN T F++ +V
Sbjct: 342 AGYNMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDNPTDFSENVV 386

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 77/342 (22%), Positives = 131/342 (38%), Gaps = 74/342 (21%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFS-------------------- 189
           + +HGY A    F +     PL +N   ++AIDLP  G S                    
Sbjct: 98  LLLHGYAASSMSFYRTFA--PLSNNFKNLYAIDLPANGLSVAIPLKITKQRKRLYEVKYK 155

Query: 190 SRPKFPFEYP------KDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMA 243
              KF   YP      K  +   ++++ + + +W    N+    +K  +V HS G Y   
Sbjct: 156 ENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSWQVANNI----EKFNLVGHSFGGYFSF 211

Query: 244 LYLQKYKESPSFKKLVLCSPAGVSNRDF-------DNTTAEVGKWKPPPWWYVK------ 290
            Y  ++ +  S  KL L SP G+ +  F       +N    V    P   +Y K      
Sbjct: 212 KYALRFPD--SINKLCLVSPLGMESNIFSIHNKFEENKIYNVNLTDPTSPFYGKKFQIPN 269

Query: 291 -LWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIF--N 347
            L++  +    ++R     G+++   +    +K +    P    +      Y + +F  N
Sbjct: 270 YLFENQLD---VIRKLGPFGARLCWNYILSAYKRV----PSMEYK-----EYLFELFYGN 317

Query: 348 KRGSGEY--LLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGG 405
           ++ S     L +  L      R P+ + +   + S VL         +YG  DWM+   G
Sbjct: 318 RQVSPILCELFTNLLTRNLLARDPILDSIDQLQLSNVLV--------MYGEHDWMNRYAG 369

Query: 406 LRVSKYLN--EKLGQKSNVFIVPHAGHHLYLDNYTFFNKILV 445
             +   LN   +    +    VP AGH+L+LDN  +F+  L 
Sbjct: 370 YCMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSALA 411

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 12/116 (10%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDN--LHTVQ 207
           +FIHG G  L  F+  L+   L +  +   A+DLPG+G   + +F  EY   N  + ++ 
Sbjct: 93  IFIHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFG---QSEFNDEYNIANYSMSSII 147

Query: 208 DWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSP 263
            +   ++ + +     L    K I+  HS+G YL   + Q+YK     +K+VL +P
Sbjct: 148 GFLKSQVFSRY-----LTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 77/341 (22%), Positives = 125/341 (36%), Gaps = 90/341 (26%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKF----------PFEYP 199
           + +HGY A    F +    +PL  +   ++A DLPG G S    F            +Y 
Sbjct: 112 LLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSFFSVMYGNEYMKVKYE 169

Query: 200 KDNLHTV----------------QDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMA 243
           ++N  ++                +D++ + I  W    NL   P  N+ V HS G YL  
Sbjct: 170 ENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKINL-VGHSFGGYLSF 225

Query: 244 LYLQKYKESPSFKKLVLCSPAGVSNRDF-------DNTTAEVGKWKPPPWWYVKLWDRNI 296
            Y  +Y +  +  KL L SP GV +  +       +N   +V    P   +Y     RN 
Sbjct: 226 KYALRYPD--NVNKLCLVSPLGVESNLYSVNNSLKENYLYDVDYSDPKSSYY----SRNF 279

Query: 297 S--------PFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNK 348
           +         F ++R    +G+++   +    +K +    P    +              
Sbjct: 280 AIPKSLFEGQFGILRWMGPIGARVCWNYILSSYKRV----PSMKYK-------------- 321

Query: 349 RGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVL-----------KNSNYEWVWLYGND 397
               EYL  F L  G   +L    + F    ++ L           K    + + +YG  
Sbjct: 322 ----EYL--FHLLFGNAKKLVTSAKTFTNLFTRNLLAKDPIMDSIEKLQCEKLMVMYGQH 375

Query: 398 DWMDVDGGLRVSKYLNEKLGQKSNVFI--VPHAGHHLYLDN 436
           DWM+   G  +   LN     K   +   +P AGH+L LDN
Sbjct: 376 DWMNKYAGYCLIAKLNNYRSTKDAGYFTEIPEAGHNLILDN 416

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 139/350 (39%), Gaps = 84/350 (24%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWC--IHAIDLPGYGFS----------------- 189
           ++ IHGY +    + +N   +    +  C  ++AIDLP  G S                 
Sbjct: 111 VLLIHGYASSSMSYFRNFRGL----SSQCKDVYAIDLPANGLSREISLSEDADLKDLVKY 166

Query: 190 --------SRPKFPFEYPKDN------LHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAH 235
                   S  +     P +N      L  ++D++ + I  W     + ++ D+  +V H
Sbjct: 167 SLQVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERW----RVENQIDQLHLVGH 222

Query: 236 SLGSYLMALYLQKYKESPSFKKLVLCSPAGVS------NRDFDNTTAEVGKWKPP--PWW 287
           S G Y+   Y  KY ++    KL L SP GV       N      +   G ++ P  P +
Sbjct: 223 SFGGYISYKYALKYPQN--VMKLALISPLGVERNLYSVNNHLPQDSIVQGTFEDPSSPSY 280

Query: 288 YVKL-WDRNI--SPFTLVRNARQLGSK-----ITSGWS---YRRFKHILNGDPGQSRRFE 336
             KL   R I  +   ++R    +G++     ITS ++    R FK  L         FE
Sbjct: 281 LRKLEVPRYIFENQLKILRWGGPMGARLCWNYITSAYAKVPSREFKEYL---------FE 331

Query: 337 ALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGN 396
               Y      K     ++L F        R P+ + +   +   V+        + YG 
Sbjct: 332 LF--YGDGGITKTALTTFILLFTRNLLA--RDPIMDSIAELKVKDVM--------FQYGQ 379

Query: 397 DDWMDVDGGLRVSKYLNEKLGQKSNVFI-VPHAGHHLYLDNYTFFNKILV 445
            DWM+ + G R ++ L ++    S +++ +P +GH+L+LD+   FN  L+
Sbjct: 380 YDWMNKNAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSPQSFNFSLI 429

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 58/133 (43%), Gaps = 16/133 (12%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQD 208
            +FIHG G  L  F   L  +  +D  +   A+DLPG+G S       EYP   L  V+ 
Sbjct: 86  FLFIHGLGGELEQFEPLLRLVDAMDQRFL--ALDLPGFGKSDEWD---EYPM--LKVVET 138

Query: 209 WFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSN 268
              E I   FN         K ++V HS+G YL + + + Y +  S  ++VL SP     
Sbjct: 139 I--EEIAAKFNAA-------KIVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSPPKRVL 189

Query: 269 RDFDNTTAEVGKW 281
            +      + G W
Sbjct: 190 YELQGNVVQWGIW 202

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 23/153 (15%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFS--SRPKFPFEYPKDNLHTV 206
            + IHG G  +  F   ++ + LL  ++ + A+DLPG+G S  S   +   Y    +  V
Sbjct: 78  FLLIHGLGGSMDQFQPLMKLLTLL--KYRVIALDLPGFGQSGSSTNGYDMLYVTSVVKKV 135

Query: 207 QDWFHERIHTWFNKRNLLHKPDKNI-VVAHSLGSYLMALYLQKYKESPSFKKLVLCS--P 263
            D             N+ +K D +  VV HS+G Y+ + ++Q Y E  +  KLVL    P
Sbjct: 136 VD------------NNIENKTDIDFKVVGHSMGCYIASHFVQMYHEEYNIDKLVLTCPPP 183

Query: 264 AGVSNRDFDNTTAEVG----KWKPPPWWYVKLW 292
             +S    DN   ++      W P  +   ++W
Sbjct: 184 PSISTLRQDNYIMKMAMRGLMWAPFIFNIYRVW 216

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 53/115 (46%), Gaps = 14/115 (12%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDW 209
           +FIHG G  L  F   L  + L +N++   A+DLPG+G S       EY   N+  V   
Sbjct: 93  LFIHGLGGVLEQFEPLLRLLDLNENKFL--ALDLPGFGKSD------EYEDYNMFDVISI 144

Query: 210 FHERIHTWFNKRNLLHKPDKNIV-VAHSLGSYLMALYLQKYKESPSFKKLVLCSP 263
            H  +      R +  +   NIV V HS+G Y+      K     SFKKLV  SP
Sbjct: 145 IHTIV-----DRLIPERTTSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 64/145 (44%), Gaps = 25/145 (17%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDW 209
           VFIHG G  L  F   L+ + LL+  +   ++DLPG+G S                V+ +
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGF--FSMDLPGFGSSDE--------------VESY 176

Query: 210 FHERIHTWFNKRNLLHKPDKNIV-VAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSN 268
               I     K      P +N+V + HS+G YL   +   ++E  SF++LVL +P  +  
Sbjct: 177 GMLEIVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSLDL 236

Query: 269 RDFDNTTAEV-----GKWKPPPWWY 288
              + T+  V      +W   PW +
Sbjct: 237 PQVERTSTRVLMSLLFRW---PWMF 258

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (46%), Gaps = 12/115 (10%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQD 208
            +FIHG G  L  F   L ++   +  +   A DLPG+G S       +YP  ++    D
Sbjct: 81  FLFIHGLGGTLEQFEPVLRELDQRNKSFL--AFDLPGFGKSDEWD---QYPMLDVVKSID 135

Query: 209 WFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSP 263
           W    IH   N  NL  K +K  ++ HS+G YL   +   + ES    +LVL +P
Sbjct: 136 WL---IHQLTN--NL--KFEKLNLIGHSMGCYLAVHFYLLFHESWCISRLVLLAP 183

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 88/216 (40%), Gaps = 32/216 (14%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSR-PKFPFEYPKDNLHTVQD 208
           +FIHG G  LG F   L    L   ++    +DLPG+G S     +  +   + + +V D
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFL--TLDLPGFGQSDELESYSMKSVIETIRSVVD 142

Query: 209 WFHERIHTWFNKRNLLHKPD-KNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSP---- 263
                     N+++L      K I+  HS+G YL   + + Y ++   +K+ L SP    
Sbjct: 143 L------ATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSPPKPI 196

Query: 264 -AGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFK 322
              +S R++    A  G +K P              F L RN       ++S    R F 
Sbjct: 197 MTSLSKRNYWTQWALWGVFKLP------------FIFDLYRNYFDQTRGLSSSGMKRFF- 243

Query: 323 HILNGDPGQ-SRRFEALHRYAYSIFNK-RGSGEYLL 356
              N DP     R+  L ++  ++ NK R    YLL
Sbjct: 244 --FNNDPNDYDLRYRKLWQFHSNVQNKSRSVVGYLL 277

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 52/115 (45%), Gaps = 12/115 (10%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLD-NEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQD 208
           +FIHG G  L  F   L+   LLD +E    AIDLPG+G S       +YP   +  V  
Sbjct: 86  IFIHGLGGSLDQFFPLLK---LLDLSEKYFVAIDLPGFGKSDEHT---DYP---MIQVVK 136

Query: 209 WFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSP 263
                I    N+  L    D   ++ HS+G YL   ++  + +     K+VL +P
Sbjct: 137 HIDAVISELLNEARLAF--DTVRLIGHSMGCYLTLHFMTLFSKKYRIGKVVLLAP 189

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 5/65 (7%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNL-HTVQ 207
           +V +HGY      F ++L  IPL+ +++ + A DLPG+GF+  P+  + Y  DNL  TV+
Sbjct: 33  IVLLHGYPTSSTMF-RHL--IPLISDKFHVIAPDLPGFGFTEVPE-DYHYSFDNLAATVR 88

Query: 208 DWFHE 212
           ++  E
Sbjct: 89  EFLKE 93

>Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {ON}
           YNR064C (REAL)
          Length = 293

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 6/63 (9%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRP---KFPFEYPKDNLHT 205
           +V +HG+ +    F +NL  IPLL +++ + A DLPG+GFS  P    F F+   D +  
Sbjct: 32  IVLLHGFPSSSNMF-RNL--IPLLASQFHVIAPDLPGFGFSETPDDYTFSFDALSDTVGY 88

Query: 206 VQD 208
           + D
Sbjct: 89  LLD 91

>Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {ON}
           YNR064C (REAL)
          Length = 289

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRP---KFPFEYPKDNLHT 205
           +V +HG+      F +NL  IPLL   + + A DLPG+GFS  P   KF F    D +  
Sbjct: 32  IVLLHGFPTSSNMF-RNL--IPLLAGHFHVIAPDLPGFGFSETPDDYKFTFGALSDTIGY 88

Query: 206 VQD 208
           + D
Sbjct: 89  LLD 91

>Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {ON}
           YNR064C - Hypothetical ORF [contig 41] FULL
          Length = 293

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%), Gaps = 5/62 (8%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNL-HTVQ 207
           ++ +HGY      F +NL  IPL+   + + A DLPG+GF++  + PF +  +NL +T+ 
Sbjct: 33  ILLLHGYPTSSNMF-RNL--IPLIAASFHVVAPDLPGFGFTTMDE-PFSFSFENLANTIA 88

Query: 208 DW 209
           D+
Sbjct: 89  DF 90

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 17/114 (14%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDW 209
           VFIHG G  L  F   L  + +L+  +    IDLPG+G S       E    ++  +   
Sbjct: 82  VFIHGLGGTLTQFEPLLRVLDVLNEGFL--TIDLPGFGHSD------ELDSYSMLDIAKI 133

Query: 210 FHE-RIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCS 262
             E  + T  NK        K IVV HS+G ++   + Q Y    + K +V  S
Sbjct: 134 IREVLVETTKNK--------KVIVVGHSMGCHIALHFGQLYNAEFAIKDMVFLS 179

>YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON}
           Epoxide hydrolase, member of the alpha/beta hydrolase
           fold family; may have a role in detoxification of
           epoxides
          Length = 290

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 6/52 (11%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRP---KFPFE 197
           ++ +HG+      F +NL  IPLL  ++ I A DLPG+GF+  P   KF F+
Sbjct: 32  ILLLHGFPTSSNMF-RNL--IPLLAGQFHIIAPDLPGFGFTETPENYKFSFD 80

>TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON} 
          Length = 299

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 40/134 (29%)

Query: 149 LVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQD 208
           ++ +HG+ +    F +NL  IPLL   + + A D+PG+GF+       EYP+D       
Sbjct: 38  ILLLHGFPSSSNMF-RNL--IPLLAARFYVVAPDIPGFGFT-------EYPED------- 80

Query: 209 WFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYK------ESPSFKKLVLCS 262
             +E     FN  NL           +S+  +L AL ++KY        +P   +L L S
Sbjct: 81  --YE-----FNFANL----------TNSIEQFLKALNIKKYSVYVFDYGAPIGFRLALKS 123

Query: 263 PAGVSNRDFDNTTA 276
           P+ ++     N  A
Sbjct: 124 PSAITGIVVQNGNA 137

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 52/117 (44%), Gaps = 9/117 (7%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNL-HTVQD 208
           VF+ G G  L  +   L  + +L+ ++     DLPG+G S        Y    + H + +
Sbjct: 98  VFLPGLGGSLDQYEPLLRLMDILNEKFI--GFDLPGFGGSEEDTSEGGYNMIKVCHIINE 155

Query: 209 WFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFK--KLVLCSP 263
                I   ++ R+ +       +V HS+G YL+  +   ++    +K  +L+L SP
Sbjct: 156 ALQSIITQNYSTRDTIELR----LVGHSMGCYLVLHFFNSFQTKTEYKISQLILTSP 208

>CAGL0G08756g Chr7 complement(829778..833842) [4065 bp, 1354 aa]
           {ON} highly similar to uniprot|P32597 Saccharomyces
           cerevisiae YIL126w STH1 subunit of the RSC complex
          Length = 1354

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 10/100 (10%)

Query: 29  ANSSITRSESDESPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLE-----DSVK 83
           A  S+   E D  P    +EE  LR P   ++  L ++I++   +  RP       D+++
Sbjct: 10  AVDSVVPKEEDLVP----SEELKLRIPKPRSSEELEQLIFRYRAIITRPDSNKVEIDAIE 65

Query: 84  D-FRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVV 122
           D F   T+ +D F   L E      + SKY   KL K V+
Sbjct: 66  DVFAQITQEQDEFNARLKELQDLRDSLSKYDSEKLRKQVL 105

>Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON}
           (14238..15287) [1050 nt, 350 aa]
          Length = 349

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 53/115 (46%), Gaps = 16/115 (13%)

Query: 150 VFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDW 209
           +FIHG G     F   L  +   D ++    +DLPG+G S           D L +   +
Sbjct: 86  LFIHGLGGNFEQFEPLLRLVDASDKKFL--TMDLPGFGKS-----------DELESYGMF 132

Query: 210 FHERIHTWFNKRNLLHKPDKNI-VVAHSLGSYLMALYLQKYKESPSFKKLVLCSP 263
               +  +  K+ +  K  K+I V+ HS+G  L   +++K+ +  +  +LVL +P
Sbjct: 133 DIIEVINYVAKKFI--KDGKSINVIGHSMGCLLSIHFMEKFSKELNITQLVLLTP 185

>SAKL0E14674g Chr5 (1211477..1212610) [1134 bp, 377 aa] {ON} similar
           to uniprot|Q12405 Saccharomyces cerevisiae YOR084W
           Putative lipase of the peroxisomal matrix
           transcriptionally activated by Yrm1p along with genes
           involved in multidrug resistance
          Length = 377

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 47/112 (41%), Gaps = 12/112 (10%)

Query: 135 YPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEW-C--IHAIDLPGYGFSSR 191
           Y QK S     + + VF+HG G     +   L DI   D+ W C  I  ID   +G S+ 
Sbjct: 49  YTQKASQNSKTVVNFVFLHGSGMNRSVWEYYLADIIDNDSGWSCGKILLIDQVNHGDSA- 107

Query: 192 PKFPFEYPKDNLHTVQDWFH-ERIHTWFNKRNLLHKPDK--NIVVAHSLGSY 240
                   +D L T+ DW    R         L  KP    N+VV HS+G +
Sbjct: 108 -----VLNRDKLGTIFDWSDGARDVCKIAMDELYPKPANTINVVVGHSMGGF 154

>KLLA0C11561g Chr3 complement(997866..998933) [1068 bp, 355 aa] {ON}
           no similarity
          Length = 355

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 62/157 (39%), Gaps = 27/157 (17%)

Query: 188 FSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQ 247
           F  R  FPF  PK     ++    + ++T+  +  +L +  K I+       Y  AL   
Sbjct: 105 FKERTGFPFSDPK----HMRKRMDQIVYTFKTQGEMLPENVKQII-----SEYNTALEAA 155

Query: 248 KYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQ 307
           K ++S + K+L L  P  + + +    +++                       +V N+ +
Sbjct: 156 KQRDSSNRKRLSLMEPLEIDDGNITGNSSDE------------------DSHAMVSNSNK 197

Query: 308 LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYS 344
           +G +  S  S   F H  + +P Q R    LHR + S
Sbjct: 198 IGIRNNSLSSSSHFYHHNHHNPQQQRIHNDLHRLSSS 234

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 13/86 (15%)

Query: 180 AIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPD--KNIVVAHSL 237
           AIDLPG+G S        Y   ++ T+ D   E +        +   PD  K  V+ HS+
Sbjct: 112 AIDLPGFGKSEDYS---NYSMTHIATLIDQMLETV--------IGTAPDNYKINVMGHSM 160

Query: 238 GSYLMALYLQKYKESPSFKKLVLCSP 263
           G++L   + + + +  + +KL+L SP
Sbjct: 161 GTHLALHFYELFNKKYTVEKLILVSP 186

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 104 PFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIH-GYGAGLGFF 162
           P++PN  K      +  V+D++   I+E  + PQ   V   + +H+  I  G   G G F
Sbjct: 15  PYFPNQMKENMKASVNEVIDEEQGSISELEVKPQNEMVRGLKSRHIQLIALGDAIGTGLF 74

Query: 163 IKN 165
           I +
Sbjct: 75  IGS 77

>YML088W Chr13 (92235..94241) [2007 bp, 668 aa] {ON}  UFO1F-box
           receptor protein, subunit of the Skp1-Cdc53-F-box
           receptor (SCF) E3 ubiquitin ligase complex; binds to
           phosphorylated Ho endonuclease, allowing its
           ubiquitylation by SCF and subsequent degradation
          Length = 668

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 45/116 (38%), Gaps = 15/116 (12%)

Query: 178 IHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERI----HTWFNKRNLLHKPDKNIV- 232
           +H    P   FS   KF  EY  +    +  W H +     +T    RN      + IV 
Sbjct: 56  VHTTHFPT--FSQSSKFSVEYI-ERTRGLHHWQHNKAIRTKYTIIPTRNWDQPSIERIVF 112

Query: 233 ----VAHSLGSYLMALYLQKYKESPSFKKLV---LCSPAGVSNRDFDNTTAEVGKW 281
               VA      +  L LQ +K    FKKL+     +P G S  DF+   A  G++
Sbjct: 113 DYPRVAAYNDGTITILQLQNHKRQKKFKKLIYIPCTTPQGCSTMDFNINAAVFGRF 168

>KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {ON}
           Anc_8.130 YPR022C
          Length = 1063

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 344 SIFNKRGSGEYLLSFALRCGGEPRLP-LEEQLFNGENSKVLK-NSNYEW--VWLYGNDDW 399
           S+F K+     ++S + +C  E  +P L   +FN  N+K+++ N+NY W  +  +  D W
Sbjct: 724 SLFGKKILLAGIISISFQCQEENIIPILSNYMFNKNNNKIMQTNNNYSWREITSFAYDYW 783

Query: 400 M 400
           +
Sbjct: 784 L 784

>TBLA0D00230 Chr4 (57128..58576) [1449 bp, 482 aa] {ON} Anc_2.98
           YNL160W
          Length = 482

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 374 LFNGENSKVLKN-SNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHL 432
           ++ G  +++L N S+Y+++ LY   + ++      VSK +NE L  +S   I+   G+  
Sbjct: 218 VYTGGKTQLLTNTSHYDFITLYNTTNALNSTELYNVSKCVNESLASRSYSGII-VLGNPD 276

Query: 433 YLDNYTFFNKI 443
            +++ +FFN I
Sbjct: 277 SIESLSFFNAI 287

>CAGL0K12430g Chr11 complement(1214197..1215450) [1254 bp, 417 aa]
           {ON} similar to uniprot|P06842 Saccharomyces cerevisiae
           YFL026w STE2 pheromone alpha-factor receptor
          Length = 417

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 7/102 (6%)

Query: 186 YGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDK---NIVVAHSLGSYLM 242
           Y   SR    +  P  NL  V       I  W N  N   +  K   N     S GS++ 
Sbjct: 259 YAVDSRSNQDYLIPIANLFVVLSLPLSSI--WANTSNNSSRSPKYWKNSQTNKSNGSFVS 316

Query: 243 ALYLQKYKESPSFKKLVLCSPAGVSNRDF--DNTTAEVGKWK 282
           ++ +    ++P +KK+V  +  G + R    D+T AEVGK+ 
Sbjct: 317 SISVNSDSQNPLYKKIVRFTSKGDTTRSIVSDSTLAEVGKYS 358

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,830,942
Number of extensions: 2907397
Number of successful extensions: 6923
Number of sequences better than 10.0: 90
Number of HSP's gapped: 6958
Number of HSP's successfully gapped: 115
Length of query: 452
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 339
Effective length of database: 40,524,141
Effective search space: 13737683799
Effective search space used: 13737683799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)