Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.263.564ON1015101548760.0
YGL241W (KAP114)3.564ON1004100637750.0
Smik_7.203.564ON1004100637400.0
Suva_7.203.564ON1008101035660.0
NCAS0F039503.564ON1012102424600.0
NDAI0B062603.564ON1013102024500.0
KAFR0J001903.564ON1012102322050.0
TDEL0D063203.564ON1018101721240.0
KNAG0D029403.564ON1009102221050.0
Kpol_380.63.564ON1002100420930.0
CAGL0H07777g3.564ON1021103020520.0
ZYRO0E09460g3.564ON1009101020470.0
TPHA0G036303.564ON1022102920410.0
SAKL0F00880g3.564ON1009102419940.0
TBLA0E002403.564ON1010101819830.0
Ecym_25943.564ON1019102318240.0
AFR269W3.564ON1017101217220.0
Kwal_47.192583.564ON1011101617110.0
KLTH0G00792g3.564ON1021101716980.0
KLLA0A00803g3.564ON9529237771e-87
Ecym_25903.561ON9552541069e-04
Kwal_47.192473.561ON959257980.008
KLLA0B05665g4.180ON86170900.066
TBLA0G013504.180ON86572860.16
KAFR0H027008.624ON1041147850.27
TPHA0N012803.561ON957219800.91
TPHA0H010105.111ON1072105781.4
KLTH0G00858g3.561ON959238781.7
NCAS0E002903.561ON958155762.9
TDEL0A057008.624ON1031155753.4
TPHA0A049705.111ON1085106753.5
TDEL0D062903.561ON957218754.0
CAGL0G03443g7.408ON111399754.0
YGL238W (CSE1)3.561ON96045744.4
SAKL0G15180g5.111ON108472744.7
Kwal_27.98705.111ON1084121736.4
SAKL0F00968g3.561ON961221727.5
KLLA0E16061g5.111ON1086108727.7
CAGL0B02189g5.111ON10871307110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.26
         (1015 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...  1882   0.0  
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...  1458   0.0  
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...  1445   0.0  
Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...  1378   0.0  
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   952   0.0  
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   948   0.0  
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   853   0.0  
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   822   0.0  
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   815   0.0  
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   810   0.0  
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   795   0.0  
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...   793   0.0  
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...   790   0.0  
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   772   0.0  
TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...   768   0.0  
Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...   707   0.0  
AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...   667   0.0  
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   663   0.0  
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   658   0.0  
KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...   303   1e-87
Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {O...    45   9e-04
Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]...    42   0.008
KLLA0B05665g Chr2 (510167..512752) [2586 bp, 861 aa] {ON} highly...    39   0.066
TBLA0G01350 Chr7 complement(361561..364158) [2598 bp, 865 aa] {O...    38   0.16 
KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8....    37   0.27 
TPHA0N01280 Chr14 complement(277121..279994) [2874 bp, 957 aa] {...    35   0.91 
TPHA0H01010 Chr8 (213903..217121) [3219 bp, 1072 aa] {ON} Anc_5....    35   1.4  
KLTH0G00858g Chr7 (59340..62219) [2880 bp, 959 aa] {ON} similar ...    35   1.7  
NCAS0E00290 Chr5 (43508..46384) [2877 bp, 958 aa] {ON} Anc_3.561...    34   2.9  
TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]...    33   3.4  
TPHA0A04970 Chr1 (1123879..1127136) [3258 bp, 1085 aa] {ON} Anc_...    33   3.5  
TDEL0D06290 Chr4 complement(1129171..1132044) [2874 bp, 957 aa] ...    33   4.0  
CAGL0G03443g Chr7 complement(331868..335209) [3342 bp, 1113 aa] ...    33   4.0  
YGL238W Chr7 (49552..52434) [2883 bp, 960 aa] {ON}  CSE1Nuclear ...    33   4.4  
SAKL0G15180g Chr7 (1306761..1310015) [3255 bp, 1084 aa] {ON} hig...    33   4.7  
Kwal_27.9870 s27 complement(93662..96916) [3255 bp, 1084 aa] {ON...    33   6.4  
SAKL0F00968g Chr6 (84333..87218) [2886 bp, 961 aa] {ON} highly s...    32   7.5  
KLLA0E16061g Chr5 complement(1428731..1431991) [3261 bp, 1086 aa...    32   7.7  
CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa] ...    32   10.0 

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (REAL)
          Length = 1015

 Score = 1882 bits (4876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 949/1015 (93%), Positives = 949/1015 (93%)

Query: 1    MPYCDVTTTDMDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXX 60
            MPYCDVTTTDMDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFT            
Sbjct: 1    MPYCDVTTTDMDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSA 60

Query: 61   XXXXXXXXXXXRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNG 120
                       RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNG
Sbjct: 61   LQSRQFALLSLRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNG 120

Query: 121  ASYCIVQISAVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGL 180
            ASYCIVQISAVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGL
Sbjct: 121  ASYCIVQISAVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGL 180

Query: 181  ETAEIIFKVLVAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRL 240
            ETAEIIFKVLVAETSS                QMSSHNGHYEESRKDFVSQCISTSLQRL
Sbjct: 181  ETAEIIFKVLVAETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRL 240

Query: 241  GQLLTLNFDNEDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISL 300
            GQLLTLNFDNEDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISL
Sbjct: 241  GQLLTLNFDNEDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISL 300

Query: 301  IDTNDDGDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDA 360
            IDTNDDGDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDA
Sbjct: 301  IDTNDDGDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDA 360

Query: 361  SELWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQT 420
            SELWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQT
Sbjct: 361  SELWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQT 420

Query: 421  FESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLD 480
            FESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLD
Sbjct: 421  FESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLD 480

Query: 481  KFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTE 540
            KFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTE
Sbjct: 481  KFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTE 540

Query: 541  LQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKD 600
            LQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKD
Sbjct: 541  LQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKD 600

Query: 601  PANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLE 660
            PANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLE
Sbjct: 601  PANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLE 660

Query: 661  FIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQ 720
            FIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQ
Sbjct: 661  FIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQ 720

Query: 721  TRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQ 780
            TRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQ
Sbjct: 721  TRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQ 780

Query: 781  NISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKE 840
            NISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKE
Sbjct: 781  NISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKE 840

Query: 841  SIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFI 900
            SIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFI
Sbjct: 841  SIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFI 900

Query: 901  SELGFQAKQLDPEQLVASSIQESANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXXXX 960
            SELGFQAKQLDPEQLVASSIQESANANN             LDYEKLKEYI         
Sbjct: 901  SELGFQAKQLDPEQLVASSIQESANANNDDETGDWEDVDDVLDYEKLKEYIDDDVDGEEE 960

Query: 961  XXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
                 ITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL
Sbjct: 961  DDRDDITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
            KAP114Karyopherin, responsible for nuclear import of
            specific proteins; cargoes include Spt15p, Sua7p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear; function is
            regulated by sumoylation
          Length = 1004

 Score = 1458 bits (3775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/1006 (73%), Positives = 841/1006 (83%), Gaps = 3/1006 (0%)

Query: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXX 70
            MDIN+LII AQSAD HTREVAE QLLQWCDSDASQ+F                       
Sbjct: 1    MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLS 60

Query: 71   XRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130
             RKLITMYWSPGFESYRSTSNV++ VK+FIRE LLKLCLNDNENT+IKNGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISA 120

Query: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190
            VDFPDQWPQLL+VIYD IS QHSLNAM LLNEIYDDVVSEEMFFEGGIGL T EI+FKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVL 180

Query: 191  VAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250
              ETS+                QMSSHN + E SRK FVSQC++TSLQ LGQLLTLNF N
Sbjct: 181  NTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGN 240

Query: 251  EDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYP 310
             DVISQLK KSIIYENLVFIKNDFS+KHF+ +LQ  FK++AI+DL+N++ I+ N   +  
Sbjct: 241  VDVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINAN--VETT 298

Query: 311  ESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNE 370
            ESE  ++TVHDCS+YIVEFLTSVCT+ F++EE++ II +LT LC++ S+  E+W SDFN 
Sbjct: 299  ESEPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDFNT 358

Query: 371  FVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQTFESLLYLLQC 430
            FVSKETGLAASYN+RDQA EFFTSL NPQLSLIF VVS +I+ +T N+ T ESLLYLLQC
Sbjct: 359  FVSKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHSTCNYSTLESLLYLLQC 418

Query: 431  ILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPDIK 490
            ILLNDDEI+ +NI+QSLQ L+  L+N L S EI EL LAR IL IP++LDKFID LPDIK
Sbjct: 419  ILLNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDALPDIK 478

Query: 491  SVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQIIN 550
             +TS FLAKSL+LALK D+ELIKSA LIAF YYCYFAELDSVLGP++C+E QEKVI+IIN
Sbjct: 479  PLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKVIRIIN 538

Query: 551  EISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQS 610
            ++S+DAEEDTNG +MEVL+QVISYN K P+S+KE+LQAE HLVFTISS+DPANVQVVVQS
Sbjct: 539  QVSSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQVVVQS 598

Query: 611  QECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKRP 670
            QECLEKLLD+INMDNYKNYIELCLPSFINVL++N+ NNY+YSPLLSLVLEFI VFLKK+P
Sbjct: 599  QECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVFLKKKP 658

Query: 671  NDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMKIL 730
            NDG+LPDEINQYLFEPLAKVL +STEDETLQLATEAFSYLIFNTDT+ M+ RLMDIMK+L
Sbjct: 659  NDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMDIMKVL 718

Query: 731  ERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLLS 790
            ERLLSLEVSDSAAMNVG LVVAIFTRFSKE+QPL+GRIL+AVVVRL+K QNIST+QNLLS
Sbjct: 719  ERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTEQNLLS 778

Query: 791  VLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKESIVALSKFFF 850
            VLCFLTCND KQTVDFLSSF+ID+ +AL+LVM KW+EAFEVIRGE++IKE+IVALS  FF
Sbjct: 779  VLCFLTCNDPKQTVDFLSSFQIDNTDALTLVMRKWIEAFEVIRGEKRIKENIVALSNLFF 838

Query: 851  LNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQAKQL 910
            LND RL K++VNG++IPYEGDLIITRSMAKKMPD+YVQVPLYTKIIKLF+SEL FQ+KQ 
Sbjct: 839  LNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSELSFQSKQP 898

Query: 911  DPEQLVASSI-QESANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXXXXXXXXXITGL 969
            +PEQL+ S I QE  NAN              LDY+KLKEYI              ITGL
Sbjct: 899  NPEQLITSDIKQEVVNANKDDDNDDWEDVDDVLDYDKLKEYIDDDVDEEADDDSDDITGL 958

Query: 970  TDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
             DVKESVVQ+LV FF+EVA+K+VS FH IYETLSDSERK LSEALL
Sbjct: 959  MDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL 1004

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (REAL)
          Length = 1004

 Score = 1445 bits (3740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/1006 (72%), Positives = 837/1006 (83%), Gaps = 3/1006 (0%)

Query: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXX 70
            M+I++L+ +AQSAD  TRE AE QLLQWCDS+ASQMFT                      
Sbjct: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60

Query: 71   XRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130
             RKLITMYWSPGFESYRSTS V+V VK+FIRE LLKLCLNDNENT+I NGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120

Query: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190
            VDFPDQWPQLL+VIYD IS QHSLNAM LLNEIYDDVVSEEMFFEGGIGLET +IIFKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180

Query: 191  VAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250
              +TS+                QMSSHNG+ EESRK F+SQC+STSLQRLGQLLT+ F +
Sbjct: 181  ATDTSTLVAKFAALKLFKACLLQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240

Query: 251  EDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYP 310
            E+V+SQLKLKSIIYENLV IKNDFSK HF+  LQ  FK+V ++DL NI+ +DTN  G+  
Sbjct: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTN--GNSI 298

Query: 311  ESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNE 370
            E E+  + VHD S+YIVEFLTSVCT+ F  EE+ +II +LTTLC+V S+  ELWISDFN 
Sbjct: 299  EYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNT 358

Query: 371  FVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQTFESLLYLLQC 430
            FVSKETGLAASYN+RDQ+ EF  SLSNP LSLIF V+SK+I+ NT ++Q  ESLLYLLQ 
Sbjct: 359  FVSKETGLAASYNVRDQSSEFLISLSNPLLSLIFSVISKDIERNTYDNQILESLLYLLQS 418

Query: 431  ILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPDIK 490
            +LLNDDEI+ QN+++SLQ L+   QN L S E+ ELTLAR ILVIPK+LDKFIDVLPDIK
Sbjct: 419  VLLNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIK 478

Query: 491  SVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQIIN 550
            S+TS+FL KSLDLALK D ELIKSAALIAF YYCYFAELDSVLGP +C+E+Q KVIQIIN
Sbjct: 479  SLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIIN 538

Query: 551  EISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQS 610
            +I++D+EEDTNG IMEVL+QVISYN KG  SK+E+LQAE HLVFTISSKDPANVQVVVQS
Sbjct: 539  DINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQS 598

Query: 611  QECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKRP 670
            QECLEKLLD+INMDNYKNYIELCLPSFINVL++N  NNY+YSPLLSLVLEFI VFLKK+P
Sbjct: 599  QECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKP 658

Query: 671  NDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMKIL 730
             DG+LPDEI QYLFEPLAKVLVYS+E+ETLQLATE+FSYLIFNTDTQ M+ RLMDIMK+L
Sbjct: 659  IDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVL 718

Query: 731  ERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLLS 790
            ERLLSLEVSDSAAMNVG LVV IFT+FSK++QPLVGRIL+AV+VRLVKAQNISTQQNLLS
Sbjct: 719  ERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLS 778

Query: 791  VLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKESIVALSKFFF 850
            VLCFLTCND++QTV+FLS+FRIDDK ALSLVM KWMEAFEVIRGE++IKE+IVALS  FF
Sbjct: 779  VLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFF 838

Query: 851  LNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQAKQL 910
            L+D RL K+MVNGD+IPYE D+IITRSMAK+MPD+YVQVPLYTKIIKLF+SELGFQ KQ 
Sbjct: 839  LDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQP 898

Query: 911  DPEQLVASSIQ-ESANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXXXXXXXXXITGL 969
            DP+QL+ S++Q ++AN NN             LDYEKLKEYI              ITGL
Sbjct: 899  DPKQLITSNMQHDAANLNNDEDNDDWEDVDDVLDYEKLKEYINDDVDGEDEDDSEDITGL 958

Query: 970  TDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
             DVKESVVQILV FF+EVATK+VS F+ IYETLSDS+RK LSEALL
Sbjct: 959  MDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score = 1378 bits (3566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 725/1010 (71%), Positives = 827/1010 (81%), Gaps = 7/1010 (0%)

Query: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXX 70
            MDI+ LI  AQSADNHTRE AEAQLLQWCDSDASQ+FT                      
Sbjct: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60

Query: 71   XRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130
             RKLITMYWSPGFESYRSTSNVD+ VKE IREALL LCLN NENT+IKNGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISA 120

Query: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190
            VDFPDQWPQLL+VIYD IS+ HS+NAM LLNEIYDDVVSEEMFFEGGIGLET EIIFKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180

Query: 191  VAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250
              E S+                QMSSH+ H +ESR +F++QC+STSLQ LGQLLTL+  N
Sbjct: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCLSTSLQTLGQLLTLDLVN 240

Query: 251  EDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYP 310
            EDV  Q K +SIIYENLVFIKN+FSKKHF ++ Q  FKLVAI+DLKNI+ ++ ND     
Sbjct: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGP--T 298

Query: 311  ESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNE 370
            E+E+ ++TV  CSVYIVEFLT+VC+I FTIEE+ +II +LT LC+V SD ++LWI DFN 
Sbjct: 299  ENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNY 358

Query: 371  FVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQTFESLLYLLQC 430
            FVSKETGLAASYN+RDQ  EFFTSLS+P LSL+F +VS++I  NTSNHQT ESLLYLLQC
Sbjct: 359  FVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLLQC 418

Query: 431  ILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPDIK 490
            ILLNDDEI+ QNI QS Q+L+  L++ L SSE++E+TLAR+IL+IPK+LDKFIDVLPDIK
Sbjct: 419  ILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIK 478

Query: 491  SVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQIIN 550
            S+TS FL  SLDLALK  QEL++SA LIAF YYCYFAELDSVLGP+ CTE+Q+ +IQIIN
Sbjct: 479  SLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVQQNIIQIIN 538

Query: 551  EISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQS 610
            EIS+DAEEDTNGTIMEVLN+VIS N+KGP+  +EVLQAE HLVF+ISSKDPANVQVVVQS
Sbjct: 539  EISDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQS 598

Query: 611  QECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKRP 670
            QECLEKLLD+I M NY +YIELCLPSFINVL AN  NNYKY+PLLSLVLEFI VFLKK+P
Sbjct: 599  QECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKP 658

Query: 671  NDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMKIL 730
            +  +LP EI+Q+LFEPLAKVL YSTEDETLQLATEAFSYLIFNTDTQ M+ RLMDIMK+L
Sbjct: 659  SSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVL 718

Query: 731  ERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLLS 790
            ERLLSLEVSDSAAMNVGSLVV IFTRFS E+QPLV RILQAVV+RLVKAQNISTQQNL S
Sbjct: 719  ERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFS 778

Query: 791  VLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKESIVALSKFFF 850
            VLCFLTCND KQTVDFL SF+ID+ +ALSLVM KWME+FEV+RGER+IKE+I+AL K F 
Sbjct: 779  VLCFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFL 838

Query: 851  LNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQAKQL 910
            L+D RLHKLMVNGD+IPY+GDLIITRSMAKKMPDKYVQVPLYTKIIKLF+SELGFQ KQ 
Sbjct: 839  LDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQP 898

Query: 911  DPEQLVASSIQE-----SANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXXXXXXXXX 965
            +PEQL+ + I +       + +N             LDYEKLK+YI              
Sbjct: 899  NPEQLITTDIAKDAANNDNDDDNDADNDDWEDVDDVLDYEKLKDYIGDDVDGGEEDDSED 958

Query: 966  ITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
            ITGL DVKESVVQILV FF+EVA+K+VS FH IYE+LS++ERK LSEALL
Sbjct: 959  ITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1012

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1024 (49%), Positives = 701/1024 (68%), Gaps = 31/1024 (3%)

Query: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXX 70
            MDI QLI QAQS+D  TRE AE QL   CD +ASQ+FT                      
Sbjct: 1    MDIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLT 60

Query: 71   XRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130
             RK ITMYWSPGF+SYR+TS +    KE+IR +LL+LCL+D ++T+IKN ASYCIVQISA
Sbjct: 61   IRKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISA 120

Query: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190
            VDFPDQWPQLLS IY  I + HSLNA+ LLNEIYDDV+SEEMFFEG IG+ET +IIF++L
Sbjct: 121  VDFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLL 180

Query: 191  VAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTL-NFD 249
                ++                QMS  +   + +RK+FV +CI  +L+ LGQLL L    
Sbjct: 181  TNNNANLKAKIAGTKLFNACLLQMSVVDSSSKHNRKEFVKECIFKALEVLGQLLELYPVS 240

Query: 250  NEDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDY 309
            N+ +I  L L++ IYEN+V I N+FS+K F +  +  +KL + RDL+  S    N    +
Sbjct: 241  NDSLI--LNLRTKIYENVVLISNEFSRKLFTQAFKGLYKLQSFRDLEACS----NQFNAF 294

Query: 310  PES-----ENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELW 364
             E+      + ++++++C +++++FLTS+    FT++EI++I+ +LT LC + SD  E W
Sbjct: 295  LENLSQADNDILESMNECVIHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTLEQW 354

Query: 365  ISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTS---NHQTF 421
              DFN+FVSKETGL AS+ IRDQA EF + LSNP  S  F  +   +  + +   N    
Sbjct: 355  SEDFNDFVSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGDVNDNLR 414

Query: 422  ESLLYLLQCILLND-DEISSQNINQS--LQNLLGILQNALTSSEIHELTLARVILVIPKL 478
            ESLLYLLQ +L N+ D     NI  S  L+    + +N L  +      L+R+IL+ PKL
Sbjct: 415  ESLLYLLQTLLTNEEDNDHDINIEPSVILKQFSSVFENGLQKT----FLLSRIILLTPKL 470

Query: 479  LDKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLC 538
            L+KF+D L D+K +T  +L ++LDLAL+   E+IKS+++IAF YY YFAEL SVLGP+LC
Sbjct: 471  LEKFMDQLQDVKQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGPELC 530

Query: 539  TELQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISS 598
            + +QE  ++II+E+S +AEEDTNG +ME LNQ+IS N     S  E+LQ E +LV +ISS
Sbjct: 531  SIVQENTLKIISELSKEAEEDTNGLLMETLNQIISCNVHENLSP-EILQTEFNLVLSISS 589

Query: 599  KDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLV 658
            KDPANVQV V++Q+CLE LL+ +N + Y +Y+++CLPSFI+ ++A+  N Y+Y+P+LSL+
Sbjct: 590  KDPANVQVTVEAQDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLSLI 649

Query: 659  LEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQT 718
            LEF+ +F+KK+P DG+LP  I+ + F+ L  +L  STEDETLQLAT+AFSY+++NT+   
Sbjct: 650  LEFLTIFMKKKPVDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEPSA 709

Query: 719  MQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVK 778
            M  +L DI+ +L+RLLS+ VSD+AAMNVG+LVV +F++FS E+QPL+  IL+A V RL++
Sbjct: 710  MVPKLQDIINVLDRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQPLIPTILRAAVGRLIQ 769

Query: 779  AQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKI 838
            AQNISTQQNL+S+LCFLTC+D KQ +D L +F   D    + VM+KW E+FE IRGE+KI
Sbjct: 770  AQNISTQQNLVSLLCFLTCSDPKQVIDLLYNFD-SDHSTFTKVMNKWFESFETIRGEKKI 828

Query: 839  KESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKL 898
            KE+IVALSK +F  D RL KL+VNGD+IPY+GDLIITRSMAKKMPDKY Q+P +TKI+KL
Sbjct: 829  KENIVALSKLYFTGDERLGKLIVNGDLIPYDGDLIITRSMAKKMPDKYTQIPAFTKIVKL 888

Query: 899  FISELGFQAKQLDPEQLVASSIQESANANNXXXXXXX------XXXXXXLDYEKLKEYIX 952
            F +ELGFQ KQ D + L+ S I+    +NN                   LDYEKL+E++ 
Sbjct: 889  FTTELGFQNKQPDSKILLESDIKNVDTSNNKTSEEAAGDDDEWEDVDDVLDYEKLREFVD 948

Query: 953  XXXXXX-XXXXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLS 1011
                          ITGL  +KE++ ++LV FF++VA ++++ FH IY TLS++E++ L+
Sbjct: 949  DEDPADFGENDSDEITGLDTLKETIPELLVEFFKDVAARDLNGFHNIYNTLSENEKRILT 1008

Query: 1012 EALL 1015
            E L+
Sbjct: 1009 ENLV 1012

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1013

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1020 (49%), Positives = 689/1020 (67%), Gaps = 22/1020 (2%)

Query: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXX 70
            MDINQLI+QAQS+DN  R+ AE+QLLQ CD++A+Q+FT                      
Sbjct: 1    MDINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLS 60

Query: 71   XRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130
             RKLITMYWSPGFESYR+TS ++ + KE+IRE+LL +CL+D ++++I   A+YC+VQISA
Sbjct: 61   LRKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISA 120

Query: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190
            VDFPDQWPQLL ++YD IS+ HSLNAM LLNEIYDDVVSEEMFFEG IG+ET +IIF+VL
Sbjct: 121  VDFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVL 180

Query: 191  VAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTL---- 246
                                  QMS  +      RK    +CI  S+Q LGQLL      
Sbjct: 181  SNNEGKIEAKIAATKLFNACILQMSVLDPSSSLKRKKLAEECIPKSIQVLGQLLEYYTID 240

Query: 247  -NFDNEDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKN-ISLIDTN 304
               D++ + S L+L+S IYEN+V IKN+  K+ F   L   FK   ++DL +  +L +T 
Sbjct: 241  TTVDSKMLTSILELRSKIYENVVLIKNELPKRLFQRNLMASFKFQTLKDLSSSCTLYETY 300

Query: 305  --DDGDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASE 362
              ++ +   S+N    + +CS+++++FLT+ C++ F   E+S I+  LT LC + +D+ E
Sbjct: 301  CLNNIEVVNSDNLHDALSECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVLCCLDNDSQE 360

Query: 363  LWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQ----LSLIFGVVSKNIDLNTSNH 418
               +DFN FVSKETGL  SY IRDQA EF  SLS+P     L  I       ++  + N 
Sbjct: 361  ELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFISTMNQPSRND 420

Query: 419  QTFESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKL 478
            +  ES+LYLLQ ++ N+D++++ N N  L+ L  +      +  +H    +R+IL+IPK+
Sbjct: 421  RILESILYLLQSLMTNEDDVTNINPNILLEPLSSLFDYETENPFLH----SRLILLIPKI 476

Query: 479  LDKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLC 538
            L+KF+D +P++K VT  FL KSL  +L+ +  L K +ALI + YY YFAEL SVLG  +C
Sbjct: 477  LEKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAELPSVLGRDVC 536

Query: 539  TELQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISS 598
            T++QE ++ +I ++ +++EEDT+G ++EVLN VI  N +   + + +L+ E ++V +ISS
Sbjct: 537  TQVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPED-IAVQGILETEFYMVLSISS 595

Query: 599  KDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLV 658
            KDPAN+QV + S+ECLEKLL+ +N   Y +YI++CLPSFINV+  +    YKYSPLLSL+
Sbjct: 596  KDPANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYKYSPLLSLI 655

Query: 659  LEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQT 718
            LEF+ VF+KK+P DG LP  I +++F+PL  VL +STEDETLQLAT+AFSYL++NTD+  
Sbjct: 656  LEFVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYLLYNTDSTL 715

Query: 719  MQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVK 778
            M   L +I+ +L+RLLS+ VSD+AAMNVG+L+V IF++FS E+Q L+  IL+A V +LV+
Sbjct: 716  MIPHLEEIVAVLDRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTILRAAVTKLVQ 775

Query: 779  AQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEA-LSLVMSKWMEAFEVIRGERK 837
            A+NISTQQNL+S+LCFLTC D  QT++FL  + +D+  +  + VM+KW EAFEVIRGE+K
Sbjct: 776  AKNISTQQNLISLLCFLTCTDPLQTIEFL--YGLDETHSTFAAVMNKWFEAFEVIRGEKK 833

Query: 838  IKESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIK 897
            IKE+I+ALSK +F  DPRL  L+VNGD+IPYEGDLIITRSMAK MPDKY Q+P YTKIIK
Sbjct: 834  IKENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYTQIPAYTKIIK 893

Query: 898  LFISELGFQAKQL-DPEQLVASSIQESANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXX 956
            LF+SEL FQ +Q  +P  L A                        LDY+KLKEY+     
Sbjct: 894  LFVSELSFQTQQTGEPTVLNADLKGIEKEEEEVGDDDEWEDVDDVLDYDKLKEYVDDEDP 953

Query: 957  XX-XXXXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
                      ITGL DVKE+V ++L+ FF+EV +K+ ++FH IY TLSD+ +K LSE LL
Sbjct: 954  AEFGEDDKDEITGLADVKETVTELLLEFFKEVTSKDTNNFHAIYNTLSDNGKKILSENLL 1013

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
            YGL241W
          Length = 1012

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/1023 (45%), Positives = 677/1023 (66%), Gaps = 33/1023 (3%)

Query: 12   DINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXXX 71
            DI+QLI QAQS DN  RE AE QLLQ CDS+AS +F                        
Sbjct: 4    DISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFALLSL 63

Query: 72   RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAV 131
            RKLIT YWSPGFESYR+TS +D+  K  +R  L++L L+DN++++IK+ ASYC+ QISAV
Sbjct: 64   RKLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQISAV 123

Query: 132  DFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL- 190
            DFPDQWP+LLS++Y  I++ +SL+A+ LLNEIYDD+VSEEMFFEG IGLET  I++++L 
Sbjct: 124  DFPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQLLE 183

Query: 191  VAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250
              +  S                QM++ + +  E RK  +S+ I  +L  L  +L ++  +
Sbjct: 184  SGDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSESIPRALGLLSNILEMS--H 241

Query: 251  EDVIS-QLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDY 309
             D+ +  L     IYE LV IKN+  KK F+ + +D +K +    L  +SL+        
Sbjct: 242  RDISTDSLTFIGKIYEILVLIKNELPKKFFSAQTRDAYKRIT---LNTLSLLQNKYASMT 298

Query: 310  PESENFVKTVHDCSVYIVEFLTSVC-TISFTIEEISVIIGALTTLCKVGSDASELWISDF 368
              +E  +++  +C+++ +EFLTS+    +FT EE ++I+ +L  LC +     E W++DF
Sbjct: 299  EPAETELESFSECAIHTLEFLTSLSYNTNFTEEERTIILNSLLVLCSLDPVTKETWLADF 358

Query: 369  NEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSK------NIDLNTSNHQTFE 422
            N FVSKETGL  SY IRDQ+ EF TSL +    LI   + +      +    + +    E
Sbjct: 359  NHFVSKETGLLPSYTIRDQSFEFLTSLIDQNFQLILKSIFQYFFTLISSSSPSVDPSQLE 418

Query: 423  SLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHE-LTLARVILVIPKLLDK 481
            +  YLLQ IL NDD+I + N N+ + ++L +L + LT+  +H+ L ++R+IL +PK+L+K
Sbjct: 419  TTFYLLQSILSNDDDIENVN-NEEITSVLRVLPSLLTN--VHDSLMVSRIILALPKILEK 475

Query: 482  FIDVLPDIKSVTSRFLAKSLDLALKCDQE-LIKSAALIAFPYYCYFAELDSVLGPQLCTE 540
            F+D LPD+K++   FL +S +LAL+   + +IKS+ LI+F  YCYFAEL SVLGP+LC  
Sbjct: 476  FMDDLPDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELPSVLGPELCAS 535

Query: 541  LQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKD 600
            +Q+ ++ ++ ++SN++E+DTNG + EVLN +I  NS    + +E+LQ E  L+F+ISSKD
Sbjct: 536  IQKSILTLMKQVSNESEDDTNGLLTEVLNNIIECNSTN--TSQEILQTEFSLLFSISSKD 593

Query: 601  PANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLE 660
            P+NVQ+VV+SQE LEKLL ++    Y  YI++ LP FIN+++AN   +Y+YSPLLSLVLE
Sbjct: 594  PSNVQIVVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYRYSPLLSLVLE 653

Query: 661  FIAVFLKKRPNDG-YLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTM 719
            FI +F+KK+P+D   LP+ I   LF+PL  +L  STEDETLQL T+AF+Y+I+NTD++ +
Sbjct: 654  FITIFMKKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTYIIYNTDSEKV 713

Query: 720  QTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKA 779
               L  ++ IL+RLLSL+V+D+AAMNVG+L+V IFT+FS ++  L+  IL A V RL+  
Sbjct: 714  MPYLETVVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTILNAAVNRLIDC 773

Query: 780  QNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIK 839
            +NISTQQNL+S+LCFL  ++T++TVDFL  F +  +  +  V+ KW E+FE+IRGE+KIK
Sbjct: 774  KNISTQQNLVSLLCFLFYSNTQETVDFL--FNLPQQNIVRDVLIKWFESFEIIRGEKKIK 831

Query: 840  ESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLF 899
            E+I+AL K + L+D +L  + VNGD+IPYEGDLIITRS AK +PDKY Q+ ++ KIIKLF
Sbjct: 832  ENIIALGKLYCLHDEKLFSIKVNGDIIPYEGDLIITRSRAKSLPDKYTQITIFEKIIKLF 891

Query: 900  ISELGFQAKQLDPEQLVASSIQESANANNXXXXXXXXXXXXXLDYEKLKEYI-------X 952
            I+ELGFQ KQ   E L+ +  + +A  ++             LDY+KLKEY+        
Sbjct: 892  IAELGFQNKQPAIENLMTN--ETTALGDSNENDDEWEDVDDVLDYDKLKEYVNDEDELDG 949

Query: 953  XXXXXXXXXXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSE 1012
                         ITGL DV ++V ++++ FF++V +KNV++F  IY+TLS++E+  L++
Sbjct: 950  EDSREYGEGDEEEITGLGDVSQTVTELIIGFFKDVTSKNVNNFQSIYDTLSENEKMILTQ 1009

Query: 1013 ALL 1015
             L+
Sbjct: 1010 YLV 1012

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1018

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1017 (44%), Positives = 647/1017 (63%), Gaps = 19/1017 (1%)

Query: 12   DINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXXX 71
            D  QLI +AQSAD+  R  AEAQLL+  D DAS +F                        
Sbjct: 8    DSQQLIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALVSL 67

Query: 72   RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAV 131
            RKLITMYWSPGFESYRS SN+  + KE +R+ LLKLCLND E +++ + A+YC+VQISAV
Sbjct: 68   RKLITMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQISAV 127

Query: 132  DFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLV 191
            DFPDQWP+LL+V+YDGI  +HSL+AM LL EIYDDV+SEEMFFE GIGLET  I+F+++ 
Sbjct: 128  DFPDQWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQIVR 187

Query: 192  AETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDNE 251
               ++                Q+ + + +    RK+   +C   +L   G+ L  +   E
Sbjct: 188  DPNTNLEAKLAGFNLFHACLQQILTVDLNSAPKRKEMTVECAKEALTVWGEHLQSHSITE 247

Query: 252  DVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYPE 311
              + QL++K  IYE+L  +KN+ SKK   + L   FK + + DL+    +  +    + E
Sbjct: 248  HSL-QLQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKVYLSISQGFVE 306

Query: 312  SENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNEF 371
                +  +++C+++I+EFLT+ C  +    E+  II AL  LC + +D   LW+ DFN +
Sbjct: 307  GYR-LDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLEDFNSY 365

Query: 372  VSKETGLAASYNIRDQACEFFTSLSNPQLSLIF-GVVSKNIDLNTSNHQTF--ESLLYLL 428
            +S E+GL ASY++RDQA E  TS+     SL+   ++ K   LN    +    ES L+L+
Sbjct: 366  ISMESGLTASYSVRDQASELLTSMDGRNYSLVCQHILYKVSHLNEWKQEWKFQESFLFLV 425

Query: 429  QCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPD 488
            Q   LN+   S   IN+ ++ +L  L + L S ++     +R+IL++PK+L+K++D+L D
Sbjct: 426  QAAALNESLPSGNFINE-IREVLSFLGSMLCSEDVVSFVSSRIILLLPKILEKYMDLLDD 484

Query: 489  IKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQI 548
            ++ +TS  L KS +LAL  + ++IK++ LIAF Y   FAEL SVLG ++C   Q++V+ +
Sbjct: 485  VRILTSHLLTKSAELALATNDDIIKASVLIAFTYCSNFAELSSVLGQEVCEITQKRVLGL 544

Query: 549  INEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVV 608
            I  IS DAE+DT+G +MEVLN VI  N+ G     E++Q E  LV  IS+KDPAN+Q+VV
Sbjct: 545  IARISEDAEDDTDGVLMEVLNNVIDCNTPG-VPNNEIVQTEFSLVLKISAKDPANIQIVV 603

Query: 609  QSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKK 668
            +SQECLEKLL+++++D+YKNY+E  LPSF+  +  + +  Y YSPLLSLVL+F+  FLKK
Sbjct: 604  ESQECLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQFLTTFLKK 663

Query: 669  RPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMK 728
             P D  LP  +    FEPL ++L+ S +DET+QLATEAFSY ++NTD   +   L  I+ 
Sbjct: 664  -PTDYQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVAPHLEAIVA 722

Query: 729  ILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNL 788
            IL+RLLS +VSD+AAM VGSL+V +FTRFS E++ ++  IL+A   RL++A+++ST QNL
Sbjct: 723  ILDRLLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLIQAKHLSTSQNL 782

Query: 789  LSVLCFLTCNDTKQTVDFLSSFRIDDKE--ALSLVMSKWMEAFEVIRGERKIKESIVALS 846
            LSV CFLT  D +QTVDFL    +D+ E  AL  ++S W+E+FE IRGER+ KE+++AL 
Sbjct: 783  LSVFCFLTSVDPRQTVDFLFGLHLDNTEHNALYSIVSIWLESFESIRGERRTKENVIALI 842

Query: 847  KFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQ 906
            K + L+D RL ++ VN ++IPYEG+ IITRSMAKKMPD+Y QV +YTKIIKLF++EL FQ
Sbjct: 843  KLYLLHDKRLMEMQVNDEIIPYEGEQIITRSMAKKMPDRYSQVSVYTKIIKLFVAELNFQ 902

Query: 907  AKQLDPEQLVASSIQESANA----NNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXXXXXX 962
             KQ DPE+ + S + +  N     N+             L+YEKL+EY+           
Sbjct: 903  DKQPDPERFITSDMAKEGNNGNSDNDTDSDGEWEDVEDVLNYEKLQEYVDESDQDGEGSD 962

Query: 963  XXXITGLTDVKE----SVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
                   + + E    SV  ILVSFF+EVA  N   F  IY +L++ E+K LSE L+
Sbjct: 963  SDDFFA-SAIDEYSNASVRDILVSFFKEVAANNTGGFRDIYNSLTEVEKKILSENLV 1018

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1009

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1022 (43%), Positives = 649/1022 (63%), Gaps = 30/1022 (2%)

Query: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMF-TXXXXXXXXXXXXXXXXXXXXX 69
            M++++LI   QS DN  R  AE+ L+   D DAS +  +                     
Sbjct: 1    MNMDELIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALNSAEKPLTERQFALL 60

Query: 70   XXRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQIS 129
              RKLIT YWSP FESYR+T+ +D+  K+++R++LL+L LND+++T+IK  ASYCIVQIS
Sbjct: 61   SMRKLITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQIS 120

Query: 130  AVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKV 189
            AVDFPD+WP+LL  +Y  I+  HSL+A+ LLNEIYDDV+SEEMFFEGGIGLET +IIF++
Sbjct: 121  AVDFPDEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQL 180

Query: 190  LVAETSSXXXXXXXXXXXXXXXXQMSSHNGHY-EESRKDFVSQCISTSLQRLGQLLTLNF 248
            L ++ S+                QMS+ + H  +E RK+ V  C+   L  L  LL    
Sbjct: 181  LSSDASTIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLEGLA 240

Query: 249  DNEDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGD 308
            D    +  L+LK  IY++L FIKN F  + F  +  ++FK+ A+RDL  + +     + D
Sbjct: 241  DINSALP-LQLKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDLVALQI-----NQD 294

Query: 309  YPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDF 368
                +  V+  ++C+++++E ++S+    +  E+   I+ AL +L ++ ++  E W +DF
Sbjct: 295  SFADDTVVEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLDANTKESWTTDF 354

Query: 369  NEFVSKETGLAASYNIRDQACEFFTSLSNPQ--------LSLIFGVVSKNIDLNTSNHQT 420
            N+FVSKETGLAAS+ IRDQ  ++  + +  Q        L L+  ++S N D       T
Sbjct: 355  NDFVSKETGLAASFTIRDQVADYLGTPTGAQSQTMFENILQLVSDILSSNAD-----PTT 409

Query: 421  FESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLD 480
             ES L+LLQ +L  D + S  +    +Q +  ++     ++    +  +R+IL IPK+LD
Sbjct: 410  IESSLFLLQSVLAEDTDFSVSSPQTLVQLISALIGPQTINTHNDSILRSRIILTIPKILD 469

Query: 481  KFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTE 540
             F+D LP+IK +T   L K+L  AL    ELI  + LIAF YY YFAEL SVLG + C E
Sbjct: 470  VFMDSLPNIKQLTKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPSVLGSESCRE 529

Query: 541  LQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKD 600
            LQE V+ I+N ++++AEEDTNG ++EVLN VIS N      K  +LQ E+  + +ISSKD
Sbjct: 530  LQEAVLGIVNHVASEAEEDTNGLLIEVLNHVISCNVASTDFK--LLQKELTAMLSISSKD 587

Query: 601  PANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLE 660
            P+N++V V+SQECLEKLLD+IN + Y  +I +CLPSF+N++  N    YKY+PLLSL+LE
Sbjct: 588  PSNIEVSVESQECLEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYNPLLSLILE 647

Query: 661  FIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQ 720
            F+ +F+KK+P +G LP   ++ +   L  +L  S EDETLQLAT AFS+L+ NTD   + 
Sbjct: 648  FVRIFMKKKPTNGMLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLNNTDPTIVI 707

Query: 721  TRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQ 780
              L  ++K+L+RLLS+ VSD+AA NVG+L+V +F ++SKE+  L+  IL++ + RL+ A+
Sbjct: 708  QHLTVVIKVLKRLLSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESAIYRLIDAK 767

Query: 781  NISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEAL-SLVMSKWMEAFEVIRGERKIK 839
            N++TQ+NL+S++C++TC D  Q V+FL  F   ++  + SL+ +KW E FE++RGERKIK
Sbjct: 768  NVTTQENLISLICYVTCCDPLQMVNFLFKFSESERRDIPSLMFNKWFETFEIVRGERKIK 827

Query: 840  ESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLF 899
            ++I+ALSK FFL+D RL  + VNGD++PYEGD IITRSMAK+MPD+Y Q+ +Y+KI+K+F
Sbjct: 828  DNIIALSKIFFLSDFRLTYVKVNGDLLPYEGDRIITRSMAKEMPDRYTQIDVYSKIVKVF 887

Query: 900  ISELGFQAKQLDPEQLVASSIQESAN--ANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXX 957
            ++EL F+ KQ D E+L+ S I+ S    A               LDYEKLKE++      
Sbjct: 888  VTELQFRNKQPDAERLITSDIKHSDELAAAEGNDDDGWEDVDDVLDYEKLKEFVDDDDDR 947

Query: 958  XXXXX----XXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEA 1013
                        ITG+  V +S  Q+L +FF+E  T NV+ F  +Y  LS+SER  LS+ 
Sbjct: 948  EDSVGLGNDADEITGIDAVPQSATQLLTAFFKEAMTNNVNGFQEMYNALSESERTILSQC 1007

Query: 1014 LL 1015
            LL
Sbjct: 1008 LL 1009

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
            complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1004 (44%), Positives = 643/1004 (64%), Gaps = 18/1004 (1%)

Query: 12   DINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXXX 71
            DI+QLI  AQS DN  RE AE++LL  CD DA  +F                        
Sbjct: 3    DIHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALLTL 62

Query: 72   RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAV 131
            RKLITMYWSPGFESYR  S ++ ++K   R++LLK+CL+D+++T+IKN ++YC+VQISAV
Sbjct: 63   RKLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQISAV 122

Query: 132  DFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLV 191
            DFPDQWP LL+ +Y  I  +HSL+A+ LLNEIYDDV+SEEMFFE GIG ET  IIF VL 
Sbjct: 123  DFPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSVLT 182

Query: 192  AETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDNE 251
               +                 QMS  +      RK  V++CIS  L     LL    +  
Sbjct: 183  DNNTGIAAKIASSKLFHSCLLQMSVLDPQSVHKRKQLVTECISQILTIWSGLLQKQ-NVT 241

Query: 252  DVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYPE 311
            ++ S+ +L+S IYE+L  IK++F +K F+++  + F+ + I DL NI+    N+      
Sbjct: 242  EMSSEFELRSKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDL-NIAAKCYNNVLSSEN 300

Query: 312  SENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNEF 371
            S+  +  +++  ++I+EFLT++    F+ E+I  I  +  TL  +  +  E W +DFN F
Sbjct: 301  SDTEMIHINEFVIHIIEFLTAISDFKFSPEDIGTISKSFVTLSCIDRNTEESWTADFNSF 360

Query: 372  VSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNID--LNT-SNHQTFESLLYLL 428
            +SKETGL AS+ IRDQ  +F ++++    S  + ++    +  +N+ S+ +T ES+LYLL
Sbjct: 361  ISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNSDWRTQESVLYLL 420

Query: 429  QCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPD 488
            QCI  ++ EI+ +++  + Q L+  + N +++       L R IL IPKLL+KF++ LPD
Sbjct: 421  QCIATSETEIN-ESLQCNTQILVTAIGNIISNPPTQSFVLMRSILTIPKLLEKFMETLPD 479

Query: 489  IKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQI 548
            +K  T + L+ SLD+AL    EL++S+ LIAF YY  FAEL+SVLG   C   QEKV+++
Sbjct: 480  VKEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACRVEQEKVLKL 539

Query: 549  INEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVV 608
            I  +SND+EEDTNG ++EVLN VI  NS   +  + +L+ E   + TIS KDP+N+Q++V
Sbjct: 540  IQNLSNDSEEDTNGVLVEVLNNVIDCNSPQ-HLDETILEVEFDFLLTISVKDPSNIQLIV 598

Query: 609  QSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKK 668
            ++QECLEKL++ ++++ Y  Y    LP  INV+N  ++  Y YSPLLSL LEFI + ++ 
Sbjct: 599  EAQECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALEFINILMRN 658

Query: 669  RPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMK 728
            RP+D  LP  I + LF PL  +L+ S EDETLQLATEAFS+L+FN+ T  +   L +I+ 
Sbjct: 659  RPDDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIFPYLEEIIN 718

Query: 729  ILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNL 788
            +L RLLS+++SD+AAMNVGSLVV IFT+FS++VQ L+  IL+A   + + A+NIST QNL
Sbjct: 719  VLSRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAKNISTSQNL 778

Query: 789  LSVLCFLTCNDTKQTVDFLSSFRID--DKEALSLVMSKWMEAFEVIRGERKIKESIVALS 846
            +SV C L C D  +T+DFL +  I    + +L LV++KW+E+FE+IRGE+KIKE+I+ALS
Sbjct: 779  VSVFCLLVCTDPARTIDFLYNLEIGTPPQSSLPLVLTKWLESFEIIRGEKKIKENILALS 838

Query: 847  KFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQ 906
            K +FL D R+  + VNGD+IPY GDLIITRSMAK MPDKY +V +Y KI+KLF++ELGFQ
Sbjct: 839  KIYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKLFVAELGFQ 898

Query: 907  AKQLDPEQLVASSI-------QESANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXXX 959
             K+ DP  LV S +       Q+   A+              LDYEKL+EYI        
Sbjct: 899  TKEQDPSDLVDSKLKQELGIPQQMGAAHGDDDDDDWEDVDDVLDYEKLQEYIDDDDEEEY 958

Query: 960  XX--XXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYET 1001
                    ITG+ +V ++  ++L+ FF+E A+K+++ F  IY T
Sbjct: 959  VGGPESQEITGIEEVTQTTKELLIEFFKEAASKDINSFQEIYNT 1002

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241w KAP114
          Length = 1021

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1030 (42%), Positives = 645/1030 (62%), Gaps = 47/1030 (4%)

Query: 16   LIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXXXRKLI 75
            LI QAQS DN  RE AE QLL  CD++A ++F                        RK I
Sbjct: 9    LIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLSLRKFI 68

Query: 76   TMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAVDFPD 135
            TMYWSPGFESYR TSNV +  KE IR+ LLKL L+D ++ +++N +SYC+VQISAVDFPD
Sbjct: 69   TMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISAVDFPD 128

Query: 136  QWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLVAETS 195
            +WPQLLS +Y+ I++ HSLNAM LLNEIYDDV+SEEMFFEGGIG ET +IIF +L     
Sbjct: 129  EWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLLTNAQV 188

Query: 196  SXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLL----TLNFDNE 251
                             QMS  + +  + RK  VS+C+  +LQ +  LL     +  D  
Sbjct: 189  RLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQALQTIKLLLEQCEIIQSDLT 248

Query: 252  DVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYPE 311
             +   L+ K  +Y+++  IK +F +K F E +  +   +A+RDL  ++       G Y E
Sbjct: 249  SINETLEFKDNLYDDINSIKENFPRKFFPEDVNLYVTNIAVRDLDQLA-------GLYQE 301

Query: 312  S--ENF----VKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWI 365
            S  +NF    +    +C +++++FL +  +     E IS I+ A  TLC+  +   + W 
Sbjct: 302  SFKDNFDEQSMSIFENCVIHLLDFLANPIS-PLNNELISNILTASITLCEQSALTKDSWE 360

Query: 366  SDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLS----LIFGVVSKNIDLNTSNHQT- 420
            SDFNEF SKETGL+AS+ IRD+  E   +   PQL     LI G +S N     S+H + 
Sbjct: 361  SDFNEFASKETGLSASFTIRDEVAELVNAFEIPQLETSFELIVGYLSNN-----SSHLSA 415

Query: 421  --FESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTS-SEIHELTLARVILVIPK 477
               ES LYLLQC++  +D+ S+ ++   + +L+  +++ L+  + + +++  R++L+IPK
Sbjct: 416  DKIESALYLLQCLMNVEDDFSNTSL---VPSLIEFIKSMLSQQNNLDQMSQIRLLLLIPK 472

Query: 478  LLDKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQL 537
             L KF+D+LP++K +T+  L + L +A   +  LI  +ALI+F Y+  +AE+ SVLG   
Sbjct: 473  TLAKFMDILPNVKQLTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQ 532

Query: 538  CTELQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTIS 597
               +Q K + +I EIS ++ EDTNG +MEVLN VI  N K   +  E+ + E  L+  IS
Sbjct: 533  TLLVQNKTLHLIQEISEESTEDTNGLLMEVLNCVIDCNDKN-VANMELFKFEFKLILVIS 591

Query: 598  SKDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSL 657
             KDPAN+QV ++SQECLEKLL ++N ++Y +++++C+PSFIN++ +++  NY YSPLLSL
Sbjct: 592  GKDPANIQVSIESQECLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSL 651

Query: 658  VLEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQ 717
            VLEFI VF+K +P +  LP  +++Y+F+PL   L+ STE+E LQ+ATEAFSY+I N+   
Sbjct: 652  VLEFITVFMKNKPQEALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKD 711

Query: 718  TMQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLV 777
             +  +L  I+ IL+RLLS  +SDSAAMNVG+L++A+ T +S+ + PL+  I+ A V +LV
Sbjct: 712  VITPKLETIVNILDRLLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLV 771

Query: 778  KAQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKE----ALSLVMSKWMEAFEVIR 833
             + NI+TQQNL+++LCFL C+D KQTVDFL    I + +    AL +++ KW++ F V+R
Sbjct: 772  VSNNITTQQNLVTLLCFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVR 831

Query: 834  GERKIKESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYT 893
            GE +IKE+IVALS+ F L D R++++ VNG++IPY+GDLIITRSMAK MPD+Y  V    
Sbjct: 832  GENRIKENIVALSQLFLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPE 891

Query: 894  KIIKLFISELGFQAKQLDPEQLVAS------SIQESANANNXXXXXXXXXXXXXLDYEKL 947
            KI+K+F+ ELGFQ +  +PE+L+ +       ++ +  +NN             +DYEKL
Sbjct: 892  KIVKMFLGELGFQGRNKNPEELLTTDDMKGMGLKPNQQSNNDEGDDDWEDVDDVVDYEKL 951

Query: 948  KEYIXXXXXXXXXXXX--XXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDS 1005
            +EYI                ITG   + +S+ ++L  FF   A KNV+ F  IY  LS+ 
Sbjct: 952  QEYIDDEDDLDDNSVGELETITGQQHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLSEE 1011

Query: 1006 ERKTLSEALL 1015
            ERK +SE +L
Sbjct: 1012 ERKCISELIL 1021

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] {ON}
            similar to uniprot|P53067 Saccharomyces cerevisiae
            YGL241W
          Length = 1009

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1010 (43%), Positives = 620/1010 (61%), Gaps = 9/1010 (0%)

Query: 12   DINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXXX 71
            D   LI++AQS  ++ R+ +E +LLQ CD D+SQ+F                        
Sbjct: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALLTL 62

Query: 72   RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAV 131
            RKL+TMYW+PGFES+R TS V ++ +  IR+ LL+LCL++++ ++I+NGASY +VQISAV
Sbjct: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122

Query: 132  DFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLV 191
            DFPDQWP+LL+++Y+ I + HSL AM LLNEIYDDV+SEEMFFE GIG ET +I+F V+ 
Sbjct: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHVMN 182

Query: 192  AETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDNE 251
            +  ++                QMS+ NG     RK+   +     LQ     LT      
Sbjct: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242

Query: 252  DVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYPE 311
                QL   + IY+ L  +KN+FSKK  A  +   F+ + +RDL+N S I      +   
Sbjct: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVEN--S 300

Query: 312  SENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNEF 371
            S++ +  +++ +V I+EFL+S+C + FT EE+  ++  L+ LC +  D  + W +DFN F
Sbjct: 301  SQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSF 360

Query: 372  VSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDL--NTSNHQTFESLLYLLQ 429
            VSKETGL AS+ IRDQA E  +S  +   + +  ++   I    + S+   F   L  L 
Sbjct: 361  VSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFNESLLYLL 420

Query: 430  CILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPDI 489
               L  +E +S     ++  +   LQ+ L  S        R+IL+IPKLL+K +D  P++
Sbjct: 421  -QSLLLNEANSLEFMDAVTRIFTKLQSILEKSLSCVFVNCRIILLIPKLLEKIMDSFPNV 479

Query: 490  KSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQII 549
            + +   FL  SLD AL  D ELIKSA LI+F YY YFAEL SVLGP  C ++Q+K +++I
Sbjct: 480  RDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLI 539

Query: 550  NEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQ 609
             ++  +AE+DT+G +MEVL+ VI  NS+       ++Q E HLVFTISSKDP+N+Q  ++
Sbjct: 540  AQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIE 599

Query: 610  SQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKR 669
             QECL KLL ++++  +  + E+C P  +NV+  +  ++++YSPLLSL L+ + V +K++
Sbjct: 600  LQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTLQVLGVLMKRK 659

Query: 670  PNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMKI 729
            P D  L   I   +FEPL  +L  S ++E LQ ATEA  YLI+NT+ + +   L  I+ I
Sbjct: 660  PLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNI 719

Query: 730  LERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLL 789
            L+ LLS  V D AA +VGSL V IF++FS E+Q L+  ILQA   RL +A NI+T QNLL
Sbjct: 720  LDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLL 779

Query: 790  SVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKESIVALSKFF 849
            SV CF+T  D +QTVDFL +  I ++  L+LVMSKW+E+F+V+RGE++ KE+I+ LSK F
Sbjct: 780  SVFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLF 839

Query: 850  FLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQAKQ 909
            FLND RL+ + VNGD+IPYE D+IITRSMAK+MPD+Y QV +Y KIIKLF SEL FQ K 
Sbjct: 840  FLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKH 899

Query: 910  LDPEQLVASSIQESANANNXXXXXXXXXXXXX---LDYEKLKEYIXXXXXXXXXXXXXXI 966
             DP+ L+A +     N                   L+YE+L+ Y+               
Sbjct: 900  QDPQLLMAGTYGIETNTEENQDDDDNDDWEDVEGPLEYERLQHYVEEDETDDRGEELDEQ 959

Query: 967  TGLTDV-KESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
                ++   SV Q+LV FF+EVA KN+S F  IYE LSD+E++ LSE LL
Sbjct: 960  CLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1029 (42%), Positives = 649/1029 (63%), Gaps = 34/1029 (3%)

Query: 12   DINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXXX 71
            D++ LI  AQSADN+ RE AE++LLQ CD +AS +F                        
Sbjct: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62

Query: 72   RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAV 131
            +KLITMYWSPGF+SYR TSNV  + KEF+R++LLKLCLN  ++++IK+ +SYCIVQISA+
Sbjct: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122

Query: 132  DFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLV 191
            DFPD WP LL VIY+ I + HS+ AM LLNEIYDDV+SEEMFFEGG+G ET + IF +  
Sbjct: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAIFT 182

Query: 192  AETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDNE 251
            +  ++                QMS  +      RKDFVSQCI+  L  L  +L  + D  
Sbjct: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCITKLLDILLTILP-HLDVN 241

Query: 252  DVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNIS-----LIDTNDD 306
                 L+LK+  YE L  IK +F KK F   L  +FK ++++DL+ I       ID++  
Sbjct: 242  QSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDAS 301

Query: 307  GDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWIS 366
            G        ++ +++  V++++F++S+    F   +++ I+ +L  LC + ++  E W S
Sbjct: 302  GSQ------LQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWES 355

Query: 367  DFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQTF---ES 423
            DFN F+SKE GL A+Y IRDQ  +FF+ L  P  S+ +G++ + ++ +  N+  +   ES
Sbjct: 356  DFNTFISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQES 415

Query: 424  LLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFI 483
            LLY LQ I+ +++E +S+ +  + +N+L  L   L     + +  +R +L+ PK L+KF+
Sbjct: 416  LLYTLQSIISSEEEFNSELLGYT-ENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFM 474

Query: 484  DVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQE 543
            +    +K +T   L+ SL+L+L    E++KS+ LIAF YY  +A+L SVLG   C  +Q+
Sbjct: 475  ESYTAVKPMTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQQ 534

Query: 544  KVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPAN 603
             +++II +I+NDAEEDT    +E ++ VI  NS G  S  EV   E +++  IS KDP N
Sbjct: 535  GLLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSD-EVRDNEFNILLEISFKDPGN 593

Query: 604  VQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIA 663
            +Q+ V+SQECLEKLLD +++  Y  Y E  +P  I ++  +   NY YSPLLSL L+F+ 
Sbjct: 594  IQLSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLM 653

Query: 664  VFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRL 723
             F+KK+P D  LP EI++ +F P+ +VL+ S E+ET+QLATEAFS+L+FN+D   MQT L
Sbjct: 654  TFMKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVL 713

Query: 724  MDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNIS 783
             +I+ +L +LLSL +SD+AAMNVG+L++ IF++FS+++Q L+  ILQA   + V A+NI 
Sbjct: 714  ENIVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNII 773

Query: 784  TQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKE---ALSLVMSKWMEAFEVIRGERKIKE 840
            T QNLL V CFL C+D +QTVDFL +  ++D++    L+LV+ KW+E F++IRGE++IKE
Sbjct: 774  TSQNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKE 833

Query: 841  SIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFI 900
            +I+ALSK + L D R+  ++VNGD+IPY GD IITRSMAK +PD++ Q+P+Y KI+KLF+
Sbjct: 834  NIIALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFL 893

Query: 901  SELGFQAKQLDPEQLVASSIQESANANNXXXXXX--------XXXXXXXLDYEKLKEYI- 951
             EL  Q+K +    L +  IQ+ A A                       LDYEKL+EY+ 
Sbjct: 894  GELASQSKNISDANLHSIDIQKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVD 953

Query: 952  ---XXXXXXXXXXXXXXITG--LTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSE 1006
                              TG  + D+ +SV +++++FF+EV +KN++ F  IY +LS+ E
Sbjct: 954  DDDDELANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDE 1013

Query: 1007 RKTLSEALL 1015
            +K L+ AL+
Sbjct: 1014 KKLLANALV 1022

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1024 (41%), Positives = 642/1024 (62%), Gaps = 34/1024 (3%)

Query: 10   DMDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXX 69
            D ++ QL+IQAQSAD   RE AE+ LLQ+   +   MF                      
Sbjct: 2    DRNVAQLVIQAQSADKKEREAAESSLLQFSAQEPESMF-LSLIDIACNSYPLTSRQFSLL 60

Query: 70   XXRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQIS 129
              R+L+TMYWS GFESY     V  + K  +RE+LL+L L+D+++ + KN +SYC+VQIS
Sbjct: 61   FLRRLVTMYWSAGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQIS 120

Query: 130  AVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKV 189
            AVDFPD+WP LL  IY+ I   +SL+AM LL EI+DDVVSEEMFF+GGIG +T +I+ +V
Sbjct: 121  AVDFPDEWPDLLIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQV 180

Query: 190  LVAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFD 249
            L + TSS                Q+ S        RK  +++ I   L    QLL     
Sbjct: 181  LTSSTSSVESKSAALDLYHACVLQLQSPQATSTIERKHAIAEHIKQMLGLFIQLLQFYQS 240

Query: 250  NEDVI--SQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLI-----D 302
            ++D I  + LKLK+ IYENL  +K++FSK+ F E+ ++  K + ++DL  IS I     +
Sbjct: 241  SQDEIQPTLLKLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISNIYYRSLN 300

Query: 303  TNDDGDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASE 362
              DD D       + ++ +C+++I+ FL+S+  + F+  E  V++ +LT +C +    + 
Sbjct: 301  NTDDKD-------IDSLDECAIHIIVFLSSLHELVFSPTETPVLLDSLTKVCCLTDTQTS 353

Query: 363  LWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQTF- 421
             W + FN FV+KETGLAASY+ RD++ +FF++L+    + +   +++N+  +      + 
Sbjct: 354  DWDNYFNIFVTKETGLAASYSARDESFQFFSNLTGTNYTNLLAFLTQNVHASGIEDWKYQ 413

Query: 422  ESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDK 481
            ESL+YL++  + ND+EI+  N  Q +   L      L S E +E    RVIL++PK+L+K
Sbjct: 414  ESLMYLMEAAVNNDEEIT--NDFQPVLQTLDAFSELLASCETNEFVKVRVILILPKILEK 471

Query: 482  FIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTEL 541
            F+D L DIK +  +FL ++  L     ++++K A+LI+F YY  FAELDSVLG +   +L
Sbjct: 472  FMDSLEDIKLLVKKFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQL 531

Query: 542  QEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQA----EVHLVFTIS 597
            +E V++IINEI  DAE+DT   ++E LNQ+I     G  S  EV+ +    E+ L+  IS
Sbjct: 532  KEAVLKIINEIYEDAEDDTPALLLETLNQII-----GSTSNAEVIASVRFDELQLILKIS 586

Query: 598  SKDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSL 657
            +KDP+N+QVV+++QECL+ LL +I+++ Y  Y E+ +PSF+NVL  ++ + ++YSP+LSL
Sbjct: 587  AKDPSNIQVVLEAQECLQNLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSL 646

Query: 658  VLEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQ 717
             LE + VF+KK+P +G LP  I  ++F+PL++ LV S +DE LQL T+ +S+LI N++  
Sbjct: 647  SLELLTVFMKKKPTNGTLPPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENS 706

Query: 718  TMQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLV 777
             +   L  I+ +LE+LLS+  SDSAAMNVGSL++AIF + S ++Q  +  IL+A   RLV
Sbjct: 707  QIAPHLNTILSVLEKLLSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLV 766

Query: 778  KAQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDK--EALSLVMSKWMEAFEVIRGE 835
            +  NI+T +NL+ V C+LT  +  QTVDFLSS  +D +   AL L++ KW+E+FE+IRGE
Sbjct: 767  QVHNIATAENLIFVFCYLTSTNPNQTVDFLSSLVLDSEGNSALKLILPKWLESFEIIRGE 826

Query: 836  RKIKESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKI 895
            ++IKE+I+ALSK FFLND R+  ++VNGD IPY+GDL+ITRSM+K MP+KY Q+  Y KI
Sbjct: 827  KRIKENILALSKLFFLNDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKI 886

Query: 896  IKLFISELGFQAKQLDPEQLVASSIQ----ESANANNXXXXXXXXXXXXXLDYEKLKEYI 951
            +KLF++EL FQ  Q   E+ +   ++    ++  A N             L+YEKL+EY+
Sbjct: 887  VKLFVAELSFQGNQPGLEKYIPHDLKKYDDQAIKAANDANDDDWEDVDDVLEYEKLQEYV 946

Query: 952  XXXXXXXXXXXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLS 1011
                          I G+ ++ +S  ++L+ FFRE A KNVS F  IY  L+D+E++ L+
Sbjct: 947  DDESDLEDDEEGDVI-GVQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEKRVLT 1005

Query: 1012 EALL 1015
            E L+
Sbjct: 1006 ENLV 1009

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1018 (42%), Positives = 634/1018 (62%), Gaps = 21/1018 (2%)

Query: 10   DMDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXX 69
            ++DI+ LI QAQS +   RE AE  LL+WC+ DA   F                      
Sbjct: 2    NIDIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSLL 61

Query: 70   XXRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQIS 129
              RKLITMYWSPGFESY  TSN++  VK  +R  +L+L L+ N++++I+   SYCIVQ+S
Sbjct: 62   ALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVS 121

Query: 130  AVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKV 189
            AVDFPD WP+LL  +Y  I   HSL A+ +LNEIYDD++SEEMFFE GIGLET  +IF +
Sbjct: 122  AVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNI 181

Query: 190  LVAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFD 249
            L  +T+                 QMS  +      R + V   +   + +  Q+L    +
Sbjct: 182  LDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLE 241

Query: 250  N------EDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDT 303
            +      E+ I + K +  IYE L F+ ++FSKK       + F+  +++DL   S +  
Sbjct: 242  DALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYI 301

Query: 304  ND-DGDYPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASE 362
            N   GD        K +    ++I E+L+++   ++  EE+ +I+ ++  LC + +   E
Sbjct: 302  NMISGDNIAFNALNKYI----IHIFEYLSNISRANYEREELILILESIYKLCCLDNLIVE 357

Query: 363  LWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNID--LNTSNHQT 420
             W S+FNEFVSKE GL ASY++RDQ  +F  SLS+   ++IF     N++  L   + + 
Sbjct: 358  TWNSNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQ 417

Query: 421  FESLLYLLQCILLNDDEI-SSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLL 479
             ES+LY+ Q +L+ND++I +  N+N  ++NLL  L         + +  +R+IL+IPK+L
Sbjct: 418  LESMLYIFQSLLINDEDILNVANLN--IENLLSSLAKNFHHYITNTILFSRLILLIPKIL 475

Query: 480  DKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCT 539
            +KF+D + +IK +T  FL +SL + L     LIKS+ L+    YC FAEL +VLG + C 
Sbjct: 476  EKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQ 535

Query: 540  ELQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSK-KEVLQAEVHLVFTISS 598
            E+Q+  ++II +I +D+E+DT G IMEV+N +I  N   P  K  E+ Q E +L+ +I+S
Sbjct: 536  EVQQITLKIILQILDDSEDDTYGMIMEVINNLIDCNL--PNDKLGEIPQQEFNLILSITS 593

Query: 599  KDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLV 658
            +DP+NVQ+ V+SQECL+KLL+ +N   Y +YIE+C PS + VL  +    YKYS LLSL 
Sbjct: 594  RDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLA 653

Query: 659  LEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQT 718
            LEFI +F+KK+PNDGYLP EI +++F PL  VL+ S EDETLQL+++AFSYLI+NTD   
Sbjct: 654  LEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIV 713

Query: 719  MQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVK 778
            M   L  I+++++RLLSL+V+DSAAMN GSLVV +FT F  E++P + +IL     RL++
Sbjct: 714  MVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQ 773

Query: 779  AQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKI 838
            A+NIST QNL+SV+C+L C++T+ T++ LS    +  + L LV++KW+  FE+IRGER+I
Sbjct: 774  AKNISTIQNLISVICYLICSNTEDTINLLSRLGTEG-DILKLVLNKWISNFEIIRGERRI 832

Query: 839  KESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKL 898
            K++I+AL+K + LN+  +  +MV+ ++IPY+GD IITRSMAK+MPD+Y Q+P+Y+KIIKL
Sbjct: 833  KQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKL 892

Query: 899  FISELGFQAKQLDPEQLVASSIQESANANNXXXXXXXXXXXXXLDYEKLKEYI-XXXXXX 957
            FI EL  Q KQ +    +  +++   + N              LDYEKL+EY+       
Sbjct: 893  FIQELSEQMKQPEHNLKIEETVETIGDGNAAAADDDWEDVEDVLDYEKLQEYVDDEDDEL 952

Query: 958  XXXXXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
                    I G  D++  V ++L+   +E A+KNVSDF  IY TLS+ E++ LSE L+
Sbjct: 953  HFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
            similar to Ashbya gossypii AFR269W
          Length = 1019

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1023 (39%), Positives = 610/1023 (59%), Gaps = 36/1023 (3%)

Query: 8    TTDMDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXX 67
            TT MD+++LI+ AQS     RE AE  LL  C SD   +F                    
Sbjct: 10   TTKMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFC 69

Query: 68   XXXXRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQ 127
                RKLITMYW+ GFESY     V+   KE +RE LLKL L D++N++I + +SYCIVQ
Sbjct: 70   LVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQ 129

Query: 128  ISAVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIF 187
            I+AVDFPD+WP LL  +YD I+  +S NA+ LL+EI+DDVVSEEMFF+GGIG +T +I+F
Sbjct: 130  IAAVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVF 189

Query: 188  KVLVAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLN 247
             +L   +SS                Q+ S +    +  +  ++Q ++ +L    QLL  N
Sbjct: 190  SLLSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLG-N 248

Query: 248  FDNEDVISQL-KLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDD 306
             +  D  ++L  LK+  YENL  +K  F KK F + L+  FK VA++DL  +        
Sbjct: 249  HNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTL-------- 300

Query: 307  GDYPES------ENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDA 360
            G Y         E  +++V + ++ I+ FL+S+        E++ ++ +L  LC +    
Sbjct: 301  GKYYSQILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQ 360

Query: 361  SELWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIF-GVVSKNIDLNTSNHQ 419
            ++   +D N FVSKETG++  Y IRD+  +F + +       IF  ++ +   +   + +
Sbjct: 361  ADDLTNDLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWE 420

Query: 420  TFESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLL 479
              ES+LYLLQ    N +E    +  Q L  LL  LQN L S  IH L  +R+ + I K+L
Sbjct: 421  KQESMLYLLQSCQGNTEEFEVNS--QGLVELLLRLQNILESQNIHCLVWSRLSITIAKIL 478

Query: 480  DKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCT 539
            +KF+  L +IK +   F+ K+L +A       +K+ +LI++  Y  F  L SVLG + C 
Sbjct: 479  EKFVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCE 538

Query: 540  ELQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQA-EVHLVFTISS 598
            +L+ +V+ IIN+I  + ++DT G ++EVL+ VI+ N   P S  + L+A E+  V  +S+
Sbjct: 539  KLERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASN---PESTNKSLKASELEFVLKLST 595

Query: 599  KDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLV 658
             DP +VQVVV++Q+CL  LL  +  D+Y  Y ELC+PSF++VL A+  + + Y+PL+SL 
Sbjct: 596  SDPYSVQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLS 655

Query: 659  LEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQT 718
            LE + VFLKK P+DG+LP  + +Y+FEPL  +++ S +DE LQL+TEAF++L+ N+    
Sbjct: 656  LELLTVFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDD 715

Query: 719  MQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVK 778
            + + L   + ILERLL+ + S SA+  VGSL++++ T+F+ ++Q ++ ++L+A   RLV+
Sbjct: 716  ISSHLQTAIMILERLLASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQ 775

Query: 779  AQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRI--DDKEALSLVMSKWMEAFEVIRGER 836
              NI T +NL+ V C LT  D KQTVDFLSS  +  D   AL L++ KW+++FE+IRGE+
Sbjct: 776  VNNIHTVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEK 835

Query: 837  KIKESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKII 896
            KIKE+IVALSK FFLND R+  ++VNGD+IPY+GDLIITRSMAK +PDKY ++  Y KII
Sbjct: 836  KIKENIVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKII 895

Query: 897  KLFISELGFQAKQLDPEQLVASSIQE--------SANANNXXXXXXXXXXXXXLDYEKLK 948
            KL ++EL FQ  Q DP++ ++S  ++         +N+ N             L+YEKL+
Sbjct: 896  KLMVTELMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNADHDDDWEDIDDVLEYEKLQ 955

Query: 949  EYIXXXXXXXXXXXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERK 1008
            EYI                 + +++E+  ++L  FF+E   K++S F  IY  L++ E++
Sbjct: 956  EYIEGSDIDDDDDDL---LIMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKR 1012

Query: 1009 TLS 1011
             LS
Sbjct: 1013 CLS 1015

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1012 (37%), Positives = 591/1012 (58%), Gaps = 20/1012 (1%)

Query: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXX 70
            MD+ QL++ AQSA    RE AE  LL+ C +D + +                        
Sbjct: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78

Query: 71   XRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130
             RKLITMYW+ GFESY     V    KE +R+ALL++ ++  ++++I + ++YC+VQI+A
Sbjct: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138

Query: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190
             DFPD+WP LL  +Y+ I+ + SL A+ LL+EI+DDVVSEEMFF+GG+G +T  IIF++L
Sbjct: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198

Query: 191  VAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250
              +                   Q+++     E   +  V   +  +L+   QLL      
Sbjct: 199  -GDDGPVALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHVHEALELFAQLLEHCRSL 257

Query: 251  EDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTND--DGD 308
            E     L+ ++  YENLV IK    K+ F   L++      +RDL  +         +GD
Sbjct: 258  EPHADLLQFQAHTYENLVLIKTQLPKRFFPGALREALLDAVLRDLVLLGAYYEQHLAEGD 317

Query: 309  YPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDF 368
                E  +K V + ++++V FL+SV       E + +++G+L  L  + +  +E W  D+
Sbjct: 318  ----EELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDY 373

Query: 369  NEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNI-DLNTSNHQTFESLLYL 427
            N F+SKETGL +SY  RD+  ++ + L          V+ + +  + +   ++ ESLL+L
Sbjct: 374  NSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFL 433

Query: 428  LQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLP 487
            LQ   LN +    Q   Q++  LL   Q  L S ++H L   RV + +P+LL+K++D LP
Sbjct: 434  LQSCQLNSE--GPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLP 491

Query: 488  DIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQ 547
            ++K +   F+  + +  +  + +L+ ++ALIAF YY  F +  SVLG Q   EL++ V+ 
Sbjct: 492  NVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLS 551

Query: 548  IINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVV 607
             I  I +  +EDT G ++EVL+ V   N +     +E+   E+ LV  +++ DP+N+QVV
Sbjct: 552  TIKNILDGIDEDTPGFLLEVLSGVTGCNKES--RNRELKLYELQLVQNVATADPSNIQVV 609

Query: 608  VQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLK 667
            V++QECL+ LL   + +NY  Y ELC+PSF+ VL A+  + Y Y+PL+SL LE + VF++
Sbjct: 610  VEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSLELLVVFMR 668

Query: 668  KRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIM 727
            K+P D  LP  +  Y+F+PL+ +L+ + +DE LQL+TEAF+ L+ ++ T  +  R+  I+
Sbjct: 669  KKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDLLGRIPVII 728

Query: 728  KILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQN 787
             ILE+LLS   S SAA+N G+L++A+ T+F+ ++Q ++ +IL+A   RLV+ +N+ T +N
Sbjct: 729  TILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAEN 788

Query: 788  LLSVLCFLTCNDTKQTVDFLSSFRIDD--KEALSLVMSKWMEAFEVIRGERKIKESIVAL 845
            LL V C+LT  D +QTVDFLSS  ID+  + AL  ++ +W+EAFEV+RGE KIKE+I++L
Sbjct: 789  LLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSL 848

Query: 846  SKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGF 905
            SK FFL DPR+  + VNGD+IP++GD+IITRSMAKKMPDKY Q+    KI+KLF++EL F
Sbjct: 849  SKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAF 908

Query: 906  QAKQLDPEQLV--ASSIQESANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXXXXXXX 963
            Q  Q DP +     S   +  ++               LDYEKL+EY             
Sbjct: 909  QQNQPDPGRYPKDGSGPADPHDSEGDSADEDWEDVDDILDYEKLQEY---ADDSDIDDTG 965

Query: 964  XXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
              +   ++++E    +L  FF+E   +N S F  IY  L++ E+K+LS  ++
Sbjct: 966  DSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/1016 (36%), Positives = 597/1016 (58%), Gaps = 22/1016 (2%)

Query: 13   INQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXXXR 72
            + + I  AQS D  TRE  EA + + C  D S                           R
Sbjct: 5    LEEAIASAQSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSLLSLR 64

Query: 73   KLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAVD 132
            KLITMYWS GFESYR    V+   KE IR +LL+L L+D ++TRI+ G+SYCIVQI+AVD
Sbjct: 65   KLITMYWSAGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQIAAVD 124

Query: 133  FPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLVA 192
            FPD+WP L+ ++Y+ I R HS++A+++LNEI+DDVVSEEMFF  G+G +T ++I  +L  
Sbjct: 125  FPDEWPGLIEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISNILND 184

Query: 193  ETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDNED 252
               S                Q+ S         +  ++  I  S + L  LL    + +D
Sbjct: 185  PGCSILAKHSAAKLYQACLLQLQSPAASSTPELRSALTNHIQESTKMLLNLLQAYSNIQD 244

Query: 253  -VISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYPE 311
              I  L+L   + + L  I+  F KK  ++ +      V I +   ++ +  ++  +   
Sbjct: 245  EAIDLLRLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVLIENFTRVAALSNDNTEEEKS 304

Query: 312  SENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNEF 371
            SE     +++  + +V  L ++         +S ++        +G++  E W SDFN F
Sbjct: 305  SE-----INEVGIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEEAWESDFNHF 359

Query: 372  VSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGV-VSKNIDLNTSNHQTFESLLYLLQC 430
            VSKE GLA+SY IRD+  +F   +S  +   IF + VS    ++    +  E++ YL+Q 
Sbjct: 360  VSKEVGLASSYYIRDECSQFLQEISGARYQSIFEILVSALSKVDPLEWRLKEAVFYLIQS 419

Query: 431  ILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPDIK 490
            + +N+DE++  N N+   +LL  L+  +    +      R IL +PK+++KF+D L ++K
Sbjct: 420  LCINEDEVTVFNNNEVF-DLLNELRQNMEGQNLQLHVRTRAILALPKVVEKFMDRLENVK 478

Query: 491  SVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQIIN 550
             +    L  +L+ A + +   +K++ALIAF  Y  FAELDSVLG +   E +  V+ +I 
Sbjct: 479  DIVKELLFATLNGACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEARCLVLNLIQ 538

Query: 551  EISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVL--QAEVHLVFTISSKDPANVQVVV 608
            ++  D+E+DT   ++E LN  ++  S    + K+ L  Q  ++LV  IS+KDP+N+QVV+
Sbjct: 539  DVLEDSEDDTPAVLLEALNPALAKQSN---TTKDTLFYQQALNLVLKISAKDPSNLQVVL 595

Query: 609  QSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKK 668
            ++Q+C+  LL   + ++Y    + C+P F+N+L     NNY Y+P++SL LE + VF+KK
Sbjct: 596  EAQDCISALLSGESTESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLELLTVFMKK 655

Query: 669  RPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMK 728
            +P+DG+LP  I+ Y+FEPL+ +L+ S++DE LQ+A++A +YL+ N+    ++  L  ++ 
Sbjct: 656  KPSDGFLPSNISSYVFEPLSDILINSSDDEILQVASDALTYLMSNSQASDLEPLLPTVLS 715

Query: 729  ILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNL 788
            ILE+LLS+  SDS AMNVGSLVV    ++S ++Q +  +IL+A   R V A+N++T +NL
Sbjct: 716  ILEKLLSVNTSDSGAMNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAKNVATTENL 775

Query: 789  LSVLCFLTCNDTKQTVDFLSSFRIDDKEALSL--VMSKWMEAFEVIRGERKIKESIVALS 846
            + V C+LT  +  + ++FLSSF I++KE  SL  V+ KW+E+FEV+RGER+IKE+IVALS
Sbjct: 776  VFVFCYLTSINPAEAINFLSSFTINEKEGNSLNYVLPKWLESFEVLRGERRIKENIVALS 835

Query: 847  KFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQ 906
            K FF +DPR+  ++VNGD +PY+GD+I+TRSMAKKMP +Y ++  + KI+KLF++EL FQ
Sbjct: 836  KIFFQSDPRVGSVIVNGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKLFVAELEFQ 895

Query: 907  AKQLDPEQLVASSIQE-------SANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXXX 959
            + Q   ++ +  + ++       + NA +             L+Y++L++++        
Sbjct: 896  SSQPSLDKFLPVNARKFDTSSSFNNNAEDEQDDGEWEDVDDVLEYDQLQQFVVEDGERND 955

Query: 960  XXXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
                  +  + D+++S  ++L+ FF+E A KN+++   +YE LS+ E+K LSE L+
Sbjct: 956  SDDEDSLANIQDIQQSTKELLIDFFKEAAAKNINNLRDLYENLSEHEKKILSENLM 1011

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/1017 (37%), Positives = 590/1017 (58%), Gaps = 25/1017 (2%)

Query: 13   INQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXXXR 72
            + + I+ AQS +   RE +E  L   C  + S   T                       R
Sbjct: 16   LKEAIVGAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLLSLR 75

Query: 73   KLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAVD 132
            KLITMYWS GFESYR    +  + K  IRE+LL L L+D+++TR+KN +SYCIVQI+AVD
Sbjct: 76   KLITMYWSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIAAVD 135

Query: 133  FPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLVA 192
            FPD+WP L+  I+D I ++ SL+A+++LNEI+DDVVSEEMFF  GIG +T ++IF++L  
Sbjct: 136  FPDEWPTLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRILSN 195

Query: 193  ETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDNED 252
              SS                Q+ S      +  K  +S  I  S+  L ++L  +   + 
Sbjct: 196  SDSSTQAKTASAKLYQACLLQLQSPMATSTQDYKYALSNHIQESVLLLIKVLKEHHIAKG 255

Query: 253  V-ISQLKLKSIIYENLVFIKNDFSKKHFA-EKLQDHFKLVAIRDLKNIS--LIDTNDDGD 308
            +  S L L+ ++   L  IK  FSKK F  E  Q+  + +   + + I+   ID   D D
Sbjct: 256  INTSALNLQQVLLSCLNTIKTGFSKKLFTIESAQELIEFL-FENFRKIAELCIDVTIDPD 314

Query: 309  YPESENFVKTVHDCSVY--IVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWIS 366
               + N V  +   S++  +++ LT     +F +E  S +I  +     +  + +E W +
Sbjct: 315  MKLAANEVG-IQMVSLFATLMDTLTENQNWNFIVE--SFVIAGM-----ISDEDAECWDN 366

Query: 367  DFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTS-NHQTFESLL 425
            DFN F SKETGL+ S+ +RD+  +F   LS    + +F  ++  +  N S N +  ES+L
Sbjct: 367  DFNVFASKETGLSTSFTVRDECEQFMQGLSGFAYNSVFNALTSALIYNESPNWKVQESIL 426

Query: 426  YLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDV 485
            + +Q +  N+D+  S N  ++ Q+LL  L+  L   + H L   R ++ +PK++++F++ 
Sbjct: 427  FFIQALCGNEDDEVSFNFEKT-QSLLNTLRQILELEDSHILVKTRSLIALPKVIERFMET 485

Query: 486  LPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKV 545
            L  +K++    L  S  LA +     +K   LI+F YY  FAELDSVLGP    E Q  V
Sbjct: 486  LESVKALVKDSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSV 545

Query: 546  IQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQ 605
              II E+  +AEEDT   ++E L   +S N K   +     Q  + L+  ISSK P+N+Q
Sbjct: 546  SAIIQELLEEAEEDTPSILLEALAPTLSSNHKTTETIS-FYQLALQLILKISSKHPSNIQ 604

Query: 606  VVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVF 665
            V +++Q+CL  LL   + + Y  Y + C+P F NVLN   EN + Y+P++ L LE + VF
Sbjct: 605  VGLEAQDCLSNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVF 664

Query: 666  LKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMD 725
            +K++P DG LP +I  Y+F PL+ +L+ S++DE +QL ++A  YLI N++   +   L  
Sbjct: 665  IKRKPRDGCLPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNV 724

Query: 726  IMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQ 785
            ++  LE+LLS E SDS A++VG+LVV +  +FSK++Q +  RIL+A   + + A N+ T 
Sbjct: 725  VLCDLEKLLSAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTT 784

Query: 786  QNLLSVLCFLTCNDTKQTVDFLSSFRIDDKE--ALSLVMSKWMEAFEVIRGERKIKESIV 843
            +NL +V C+L   +  + ++FLSSF ID +E   L  V+SKW+E+FEV+RGE++IKE+I+
Sbjct: 785  ENLANVFCYLVSLNPAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIM 844

Query: 844  ALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISEL 903
            ALSK FF  D R+ K+ VNGD IPY GD+IITRSMAK MP+KY ++  Y KI+KLF++EL
Sbjct: 845  ALSKLFFQADSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAEL 904

Query: 904  GFQAKQLDPEQLVASSIQES-----ANANNXXXXXXXXXXXXXLDYEKLKEYIXXXXXXX 958
             FQ  Q D E+ +  S +++     ANA               L+YE+L+ ++       
Sbjct: 905  DFQTSQTDLEKYIPMSAKKTECSTIANAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSS 964

Query: 959  XXXXXXXITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015
                   I G+ +V++S  ++L+SFF+E A++N++DF  IY+ LS++E++ LSE L+
Sbjct: 965  DRDEEDVIPGIKNVQQSTRELLISFFKEAASQNINDFKTIYDNLSENEKRILSENLV 1021

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
           uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
           Karyopherin, responsible for nuclear import of Spt15p,
           histones H2A and H2B, and Nap1p; amino terminus shows
           similarity to those of other importins, particularly
           Cse1p; localization is primarily nuclear
          Length = 952

 Score =  303 bits (777), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 251/923 (27%), Positives = 435/923 (47%), Gaps = 82/923 (8%)

Query: 11  MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXXXXXXXXXX 70
           M I  L+   QS     RE AE  LL+ C +D    F                       
Sbjct: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60

Query: 71  XRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130
            RK  TMYWS GF S+     V  + K+ +R  LL L  N++   ++ +  +YCIVQI A
Sbjct: 61  LRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120

Query: 131 VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190
           VDFPD+WP LL  + + I   HS NA+ LL E+  D+++ EMFF+   G   A+I+  VL
Sbjct: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSG---AKIVNTVL 177

Query: 191 VAETSSXXXXXXXXXXXXXXXXQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250
           +A                    Q+  H              CIS  L+ +   +T    +
Sbjct: 178 LALNDDTLRLQAKSKLL-----QLYHH--------------CIS-QLRNVSMFVTSELMS 217

Query: 251 EDVISQLK-LKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDY 309
           E +I  LK +   I + L    N+   +    K +    L  + DL N S++ +N D  Y
Sbjct: 218 EWLIPHLKAMNDCIDKLLESYGNNMESEVIGLKGELFMALSKLFDL-NQSILGSNGDLSY 276

Query: 310 ----------PESENFVKTVHDCSVYIVEFLTSVC--TISFTIEEISVIIGALT------ 351
                       + ++ + + +     +E + S C  T+ +     S +I   T      
Sbjct: 277 RLRITLDAIKSNANSYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTE 336

Query: 352 ---TLCKVGSDASELWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIF-GVV 407
               LC +  D  +L  SDFNEF+SKETGL+ASYN RD+  ++ +S S+     I   V+
Sbjct: 337 DFIKLCLLPEDYFKL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVL 394

Query: 408 SKNIDLNTSNHQTFESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELT 467
            K + + ++  Q  E+ L+L Q +  N+   +S N+ +  Q+ L +    L         
Sbjct: 395 QKCLQVTSNEAQYQEACLFLFQELCSNE---TSMNVPR-YQDFLSLAVMILDDDACPTFV 450

Query: 468 LARVILVIPKLLDKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFA 527
            +R IL IPK  +  ++ LP+IK +  +FL K+++  +  + + + ++ +I+F YY  FA
Sbjct: 451 KSRTILTIPKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFA 510

Query: 528 ELDSVLGPQLCTELQEKVIQIINEISNDAEEDTNGTIMEVLNQVIS--YNSKGPYSKKEV 585
           EL S+L  Q    LQ+ +++ I  +  D+EED+ G ++E +++++   +  +  ++K+E+
Sbjct: 511 ELGSILDYQTSMILQQSLLKAIKTLYVDSEEDSLGLLLEAMHEIVKTWHFQQDLHTKQEI 570

Query: 586 LQAEVHLVFTISSKDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNAND 645
           L   +     +SS +P+NV++V +S   L  LL DIN  +Y    E C PSFI  ++   
Sbjct: 571 LNLLL----KLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFL 626

Query: 646 ENNYKYSPLLSLVLEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATE 705
           ++   YSPL+ L LEF++VFLK  P   ++ DE+ +Y+  P+ + +    ++   + A +
Sbjct: 627 QSQQTYSPLVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQ 686

Query: 706 AFSYLIFNTDTQTMQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLV 765
           AF YL  N++ +  +  + D+  +   +   E S    ++V  +++             +
Sbjct: 687 AFVYLACNSNPKFWKDSMFDLCSL---VFDPERSLYKTIDVAPIMLLSLRVTQPHENRFI 743

Query: 766 GRILQAVVVRLVKAQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDDKEAL-SLVMSK 824
           G+I++  + +LV    +    + + + C +   D +  + ++ S  I  +E++ + ++ +
Sbjct: 744 GQIMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRE 803

Query: 825 WMEAFEVIRGERKIKESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPD 884
             + FE  R +  +KE  ++LS+ FF ND RL                  TRS      D
Sbjct: 804 LFDCFEENRSKNMLKEVALSLSELFFSNDQRL------------------TRSSYHDESD 845

Query: 885 KYVQVPLYTKIIKLFISELGFQA 907
             V+ P    I+K+F  EL  Q 
Sbjct: 846 GVVR-PFKEYIVKMFADELTRQT 867

>Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {ON}
           similar to Ashbya gossypii AFR273W
          Length = 955

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 122/254 (48%), Gaps = 24/254 (9%)

Query: 561 NGTIMEVLNQVI--SYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQSQECLEKLL 618
           N  +M+ +++++  S +S  PY+   +L+  + ++ TI +K+P+N +    + E L  ++
Sbjct: 569 NEFLMKAVHRILLTSEDSIKPYAAN-ILKQLIEII-TIIAKNPSNPRFTHYTFESLSVVI 626

Query: 619 DDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKRPNDGYLPDE 678
              N DN  + IE  +P F+N+L A+D   +     +  V + IA  +++ P++  +P+ 
Sbjct: 627 K-FNHDNLASIIEAIMPIFLNIL-ADDIQEF-----MPYVFQIIAYCVEQLPSNMGIPEA 679

Query: 679 INQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFN--TDTQTMQTRLMDIMKILERLLSL 736
           I Q L++PL    V+      L+    A + L+ +      +    L+ ++ I +RL++ 
Sbjct: 680 IAQ-LYQPLLSPTVWD-----LKGCVPAVTRLLKDIIKHDPSAYPNLIPVLGIFQRLIAS 733

Query: 737 EVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLLSVLCFLT 796
           +  D+    +   ++  +   SK    L   + Q  V+ L + Q   T++ +   + FL 
Sbjct: 734 KAYDTHGFELLEYIIT-YIPLSK----LQDYLKQIAVLLLQRLQGSRTEKYVKKFIVFLG 788

Query: 797 CNDTKQTVDFLSSF 810
               K   DF+  F
Sbjct: 789 VLSNKFDSDFVVRF 802

>Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]
           {ON} YGL238W (CSE1) - (putative) kinetochore protein
           [contig 344] FULL
          Length = 959

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 119/257 (46%), Gaps = 30/257 (11%)

Query: 561 NGTIMEVLNQVI--SYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQSQECLEKL- 617
           N  IM+ + +V+  S +   P++ + + Q  +  + +I SK+P+N +    S  C E L 
Sbjct: 569 NEFIMKTVYRVLMTSEDLSAPFATETIQQ--LLSIISIISKNPSNPRF---SHYCFESLG 623

Query: 618 -LDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKRPNDGYLP 676
            +   N  +   +++L +P F+ +L+ + +    Y+      L+ IA  +++ P    LP
Sbjct: 624 VVLKYNKQDLSKFLDLIMPQFMEILSEDLQEFIPYT------LQLIAYCIEQLPAASSLP 677

Query: 677 DEINQYLFEPLAKVLVYSTEDETLQLATEAFSYL---IFNTDTQTMQTRLMDIMKILERL 733
             ++Q L +P+    V+      L+    A + L   I   D  +    L+ ++ + +RL
Sbjct: 678 PSVSQ-LCQPIVSSSVWE-----LKGNIPAVTRLLKDIIRVDP-SAYPDLVPVLGVFQRL 730

Query: 734 LSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLLSVLC 793
           ++ +  D     +   ++        +VQP + +I    V+ L + QN  T++ +   + 
Sbjct: 731 IASKTYDDNGFELLEFIMTYMP--VDKVQPYMKQI---AVLLLQRLQNSRTEKYVKKFVV 785

Query: 794 FLTCNDTKQTVDFLSSF 810
           FL+    K+  DF+ SF
Sbjct: 786 FLSAVAHKRGSDFVVSF 802

>KLLA0B05665g Chr2 (510167..512752) [2586 bp, 861 aa] {ON} highly
           similar to uniprot|Q06142 Saccharomyces cerevisiae
           YLR347C KAP95 Karyopherin beta forms a dimeric complex
           with Srp1p (Kap60p) that mediates nuclear import of
           cargo proteins via a nuclear localization signal (NLS)
           interacts with nucleoporins to guide transport across
           the nuclear pore complex
          Length = 861

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 87  RSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAVDFP-DQWPQLLSVIY 145
           R ++ VD + +  I++  L+  L D E TR+ N ++  I  I+ ++ P +QWP+L+ ++ 
Sbjct: 83  RWSTQVDAESRHHIKQFALQ-ALVDPE-TRVANASAQLIAAIAEIELPLNQWPELMKIMV 140

Query: 146 DGISRQHSLN 155
           D  +++   N
Sbjct: 141 DNTAQEQPEN 150

>TBLA0G01350 Chr7 complement(361561..364158) [2598 bp, 865 aa] {ON}
           Anc_4.180 YLR347C
          Length = 865

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 85  SYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAVDFP-DQWPQLLSV 143
           S R  +NVD+  K  I++  L   +++  + R+ N  +  I  I+ ++ P ++WP+LL +
Sbjct: 83  SLRWINNVDMNSKLQIKQNALMALVSNVTSARVSNAVAQLIAAIANIELPRNEWPELLKI 142

Query: 144 IYDGISRQHSLN 155
           + D  S     N
Sbjct: 143 MVDNTSSTQQEN 154

>KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8.624
           YPL125W
          Length = 1041

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 57/147 (38%), Gaps = 18/147 (12%)

Query: 1   MPYCDVTTTDMDINQLIIQA---QSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXX 57
           M Y +V   ++++ Q++ QA   Q A +  +++AE QL  W                   
Sbjct: 1   MSYNNVELNELNVVQMLEQAGNPQHAGSEIQKLAEQQLKAWEIKPGFHHL---------- 50

Query: 58  XXXXXXXXXXXXXXRKLITMYWSPGFESYRSTSNVDVKVKE---FIREALLKLCLNDNEN 114
                         R L  + +  G + Y  ++ V    KE    IR  L +L    N  
Sbjct: 51  LQSVYLDLSNPLQVRWLAVIQFKNGIDKYWRSTRVHAISKEEKSLIRSRLFELIDEQNNQ 110

Query: 115 TRIKNGASYCIVQISAVDFPDQWPQLL 141
             I+N  +    +IS +DFP +WP L 
Sbjct: 111 LTIQNAQAAS--KISRLDFPGEWPNLF 135

>TPHA0N01280 Chr14 complement(277121..279994) [2874 bp, 957 aa] {ON}
           Anc_3.561 YGL238W
          Length = 957

 Score = 35.4 bits (80), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 96/219 (43%), Gaps = 19/219 (8%)

Query: 596 ISSKDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLL 655
           I SK+P+N +    + E +  +L         N IE+ +P F+N+L  + +    Y    
Sbjct: 604 IISKNPSNPRFTHYAFESIGAILYHAPAQLIPNLIEIMMPVFMNILTQDIQEFIPY---- 659

Query: 656 SLVLEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTD 715
             V + IA  ++K      +PD + Q L +P+    V+  +     + T     +I   D
Sbjct: 660 --VFQLIAFTIEKI---STVPDSVKQ-LSQPILNPTVWELKGNVPAI-TRLLKSMI-KAD 711

Query: 716 TQTMQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVR 775
               Q  L+ ++ + +RL++ +V D     +  +++      + +   LV  + Q  V+ 
Sbjct: 712 ASIFQD-LVPVLGVFQRLIASKVHDIYGFELLEVIM-----LNIDTTRLVPFLKQIAVLL 765

Query: 776 LVKAQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRIDD 814
           L + Q   T++ +  ++ FL     K   DF  SF IDD
Sbjct: 766 LQRLQTSKTEKYVKKLVVFLGMLAIKLGPDFPISF-IDD 803

>TPHA0H01010 Chr8 (213903..217121) [3219 bp, 1072 aa] {ON} Anc_5.111
           YGR218W
          Length = 1072

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 94  VKVKEFIREALLKLCLND---NENTRIKNGASYCIVQISAVDFPDQWPQLLSVIYDGISR 150
           + ++ FI   +L +C +D   N N  + N A+  +VQI   D+P +W   L  + D  S 
Sbjct: 88  INIRTFIVGMILSVCNDDSLFNSNRELINKANLVLVQIIKKDWPARWSNFLPELID--SS 145

Query: 151 QHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLVAETS 195
           ++S N      EI   V++EE+F      L  A++I K+ V+ TS
Sbjct: 146 KYSENICQNNLEIL-KVLAEEIFEYSSEKLTQAKVI-KLKVSMTS 188

>KLTH0G00858g Chr7 (59340..62219) [2880 bp, 959 aa] {ON} similar to
           uniprot|P33307 Saccharomyces cerevisiae YGL238W CSE1
           Nuclear envelope protein that mediates the nuclear
           export of importin alpha (Srp1p) homolog of metazoan CAS
           protein required for accurate chromosome segregation
          Length = 959

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 108/238 (45%), Gaps = 28/238 (11%)

Query: 578 GPYSKKEVLQAEVHLVFTISSKDPANVQVVVQSQECLEKL--LDDINMDNYKNYIELCLP 635
            P++  E+ +  +H++ +I SK+P+N +    S  C E L  +   N  +   ++E+ +P
Sbjct: 588 APFAH-EIAKQLLHII-SIISKNPSNPRF---SHYCFESLGVVVKFNKQSMSEFMEMMMP 642

Query: 636 SFINVLNANDENNYKYSPLLSLVLEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYST 695
            F+ +L+ + +    YS      ++ IA  +++ P    LP  ++Q L +P+    V+  
Sbjct: 643 QFLEILSEDVQEFTPYS------IQIIAYCIEQLPAASSLPPSVSQ-LCQPILSPAVWE- 694

Query: 696 EDETLQLATEAFSYL---IFNTDTQTMQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVA 752
               L+    A + L   I   D  T    L+ ++ + +RL++ +  D     +   +V 
Sbjct: 695 ----LKGNIPALTRLLKDILRVDP-TAYPDLVPVLGVFQRLIASKTYDENGFELLEYIVT 749

Query: 753 IFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLLSVLCFLTCNDTKQTVDFLSSF 810
                   +  +V  + Q  V+ L + QN  T++ +   + FL+    K+  DF+  F
Sbjct: 750 YLP-----LDSIVPYVKQIAVLLLQRLQNSRTEKYVKKFVVFLSIVAYKRGSDFVVDF 802

>NCAS0E00290 Chr5 (43508..46384) [2877 bp, 958 aa] {ON} Anc_3.561
           YGL238W
          Length = 958

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 69/155 (44%), Gaps = 30/155 (19%)

Query: 533 LGPQLCTELQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHL 592
           + P+   E  E +++ +  +   AEE    T  E++NQ++S                   
Sbjct: 561 ISPEKLAE-NEFLMRAVFRVLQTAEETVQSTYPELINQLVS------------------- 600

Query: 593 VFTISSKDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYS 652
           + +I +K+P+N +    + EC+  +      +   + +E  +P+F+N+L+ + +    Y 
Sbjct: 601 IVSIIAKNPSNPRFTHYTFECIGVIFSYTEKNILLSLVESIMPTFLNILSEDIQEFIPY- 659

Query: 653 PLLSLVLEFIAVFLKKRPNDGYLPDEINQYLFEPL 687
                V + IA  +++ P    LPD + Q L  PL
Sbjct: 660 -----VFQLIAYSVEQMPT---LPDSVKQ-LSHPL 685

>TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1031

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 60/155 (38%), Gaps = 22/155 (14%)

Query: 6   VTTTDMDINQLIIQA---QSADNHTREVAEAQLLQWCDSDASQMFTXXXXXXXXXXXXXX 62
           VT +++++ + + QA   Q A +  ++ AE QL +W                        
Sbjct: 5   VTLSELNLVEALQQASNPQHAGSEVQKAAEQQLREWQQQPGFHFL----------LQSIY 54

Query: 63  XXXXXXXXXRKLITMYWSPGFESY-RSTS----NVDVKVKEFIREALLKLCLNDNENTRI 117
                    R L  + +  G E Y RST     N D K+   IR  L  L    N    I
Sbjct: 55  LNLSNSLQIRWLAVIQFKNGVEKYWRSTRINAINKDEKIS--IRGRLFDLIDEQNNQLSI 112

Query: 118 KNGASYCIVQISAVDFPDQWPQLLSVIYDGISRQH 152
           +N  +    +I+ +DFP +WP L   +   +S  H
Sbjct: 113 QNAQA--AAKIARLDFPVEWPNLFEQLEQLLSNDH 145

>TPHA0A04970 Chr1 (1123879..1127136) [3258 bp, 1085 aa] {ON}
           Anc_5.111 YGR218W
          Length = 1085

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 16/106 (15%)

Query: 73  KLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYC---IVQIS 129
           KLIT  W    +  R      V +++F+   ++ LC +DN     KN  + C   +VQI 
Sbjct: 73  KLITTKWKLLPQEQR------VGIRDFVVGMVISLCQDDNVFKNEKNLINKCDLTLVQIL 126

Query: 130 AVDFPDQWPQLLSVIYDGISRQHSL--NAMFLLNEIYDDVVSEEMF 173
             ++P  WP  +  +    S   ++  N M +L      ++SEE+F
Sbjct: 127 KQEWPQNWPNFIPELIGSSSSSVNVCENNMIILK-----LLSEEVF 167

>TDEL0D06290 Chr4 complement(1129171..1132044) [2874 bp, 957 aa]
           {ON} Anc_3.561 YGL238W
          Length = 957

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 42/218 (19%), Positives = 99/218 (45%), Gaps = 18/218 (8%)

Query: 593 VFTISSKDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYS 652
           +  + +K+P+N +    + E +  ++    + +  +  +  +P+F+ +L+ + +    Y 
Sbjct: 601 IINVIAKNPSNPRFSHYTFESIGSIMTSCPVSSLTSLADTIMPTFLTILSEDIQEFIPY- 659

Query: 653 PLLSLVLEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIF 712
                V +  A  ++K  +   +PD I Q L +P+   +++  +   +   T     LI 
Sbjct: 660 -----VFQITAYIVEKGES---VPDSIKQ-LAQPILSPVIWELKG-NVPAVTRLLKSLI- 708

Query: 713 NTDTQTMQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAV 772
            TD Q++ + L+ ++ + +RL++ +  D     +   +V     F+ ++  L   + Q  
Sbjct: 709 KTD-QSLFSDLIPVLGVFQRLIASKAYDVYGFELLETIV-----FNVDINLLKPYLKQVA 762

Query: 773 VVRLVKAQNISTQQNLLSVLCFLTCNDTKQTVDFLSSF 810
           V+ L + QN  T++ +   + FL    T    D + SF
Sbjct: 763 VLLLQRLQNSKTEKYVKKFVVFLGMVSTALGPDLVPSF 800

>CAGL0G03443g Chr7 complement(331868..335209) [3342 bp, 1113 aa]
           {ON} highly similar to uniprot|P40069 Saccharomyces
           cerevisiae YER110c KAP123 RAN-binding protein
          Length = 1113

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 15/99 (15%)

Query: 72  RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAV 131
           RKLI  +W+          ++DV  K  I+E +L+   ++ +   I++  +  I  I + 
Sbjct: 66  RKLIPKHWA----------SIDVATKNGIKETVLQYAFSEQKEI-IRHSNARVIAVIGSE 114

Query: 132 DFPD-QWPQLLSVIYDGISRQHSL---NAMFLLNEIYDD 166
           +  D QWP+L+  +    + + S     A+F+L  + +D
Sbjct: 115 EMSDNQWPELIPNLVQAAAGEDSKTRETAVFILLSLLED 153

>YGL238W Chr7 (49552..52434) [2883 bp, 960 aa] {ON}  CSE1Nuclear
           envelope protein that mediates the nuclear export of
           importin alpha (Srp1p), homolog of metazoan CAS protein,
           required for accurate chromosome segregation
          Length = 960

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 98  EFIREALLKLCLNDNENTRIKNGASYCIVQISAVDFPDQWPQLLS 142
           E I++ ++ L ++   N +++ G    I  I+  DFPD+WP LLS
Sbjct: 84  ELIKKEIVPLMISLPNNLQVQIGE--AISSIADSDFPDRWPTLLS 126

>SAKL0G15180g Chr7 (1306761..1310015) [3255 bp, 1084 aa] {ON} highly
           similar to uniprot|P30822 Saccharomyces cerevisiae
           YGR218W CRM1 Major karyopherin involved in export of
           proteins RNAs and ribosomal subunits from the nucleus
          Length = 1084

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 9/72 (12%)

Query: 73  KLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDN---ENTRIKNGASYCIVQIS 129
           KLIT  W    + +R      + ++ FI   ++ LC +DN       + N +   +VQI 
Sbjct: 73  KLITTRWKMLPQEHR------IGIRNFIVGMIITLCQDDNVFQTQKNLINKSDLTLVQIL 126

Query: 130 AVDFPDQWPQLL 141
             ++P  WP  +
Sbjct: 127 KQEWPQNWPDFI 138

>Kwal_27.9870 s27 complement(93662..96916) [3255 bp, 1084 aa] {ON}
           YGR218W (CRM1) - Chromosome region maintenance protein
           [contig 43] FULL
          Length = 1084

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 18/121 (14%)

Query: 73  KLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDN---ENTRIKNGASYCIVQIS 129
           KLI   W      +R      V ++ FI   ++ LC +DN       + N +   +VQI 
Sbjct: 73  KLINTKWKMLPPEHR------VGIRNFIVGMIISLCQDDNVFQSQKNLINKSDLTLVQIL 126

Query: 130 AVDFPDQWPQLLSVIYDGISRQHSLNA-------MFLLNEIYDDVVSEEMFFEGGIGLET 182
             ++P  WP  +  +    S Q S+N        + LL+E   D  +E+M     + L+T
Sbjct: 127 KQEWPQNWPDFIPELVQ--SAQSSVNVCENNMVILKLLSEEVFDFSAEQMTQAKALHLKT 184

Query: 183 A 183
           +
Sbjct: 185 S 185

>SAKL0F00968g Chr6 (84333..87218) [2886 bp, 961 aa] {ON} highly
           similar to uniprot|P33307 Saccharomyces cerevisiae
           YGL238W CSE1 Nuclear envelope protein that mediates the
           nuclear export of importin alpha (Srp1p) homolog of
           metazoan CAS protein required for accurate chromosome
           segregation
          Length = 961

 Score = 32.3 bits (72), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 101/221 (45%), Gaps = 21/221 (9%)

Query: 593 VFTISSKDPANVQVVVQSQECLEKLLDDINMDNYKNYI-ELCLPSFINVLNANDENNYKY 651
           + +I SK+P+N +    + E +  ++   N +N  N I E  +P F+ +L+ + +    Y
Sbjct: 601 IVSIISKNPSNPRFTHYTFESISAII-KFNHNNSLNEIFEAIMPVFLEILSEDIQEFIPY 659

Query: 652 SPLLSLVLEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLI 711
                 V + +A  +++ P +  LP  + Q L +PL    V+      L+    A + L+
Sbjct: 660 ------VFQVMAYCIEQLPTNSTLPASVKQ-LSQPLLSPSVWD-----LKGNIPAVTRLL 707

Query: 712 --FNTDTQTMQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRIL 769
             F     ++   L+ ++ + +RL++ +  D     +   ++ ++T  +  +QP +  I 
Sbjct: 708 KDFIKADPSVYPDLIPVLGVFQRLIASKTYDVHGFELLEYIM-VYTPLNN-LQPYLKEI- 764

Query: 770 QAVVVRLVKAQNISTQQNLLSVLCFLTCNDTKQTVDFLSSF 810
              V+ L + QN  T++ +   + FL     K   DF+  F
Sbjct: 765 --AVLLLQRLQNSRTERYVKKFVVFLGVLSYKLGSDFVIQF 803

>KLLA0E16061g Chr5 complement(1428731..1431991) [3261 bp, 1086 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218W CRM1 Major karyopherin involved in
           export of proteins RNAs and ribosomal subunits from the
           nucleus
          Length = 1086

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 20/108 (18%)

Query: 73  KLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKN---GASYCIVQIS 129
           KLIT  W    + +R      + ++ FI   ++ +C +D      KN    +   +VQI 
Sbjct: 73  KLITTKWKMLPQEHR------LGIRNFIVGMIISMCQDDQVFQTQKNLIHKSDLTLVQIL 126

Query: 130 AVDFPDQWPQLLSVIYDGISRQHSLNA----MFLLNEIYDDVVSEEMF 173
             D+P+ WP  +  +   +S Q S+N     M +L      ++SEE+F
Sbjct: 127 KQDWPENWPDFIPELV--LSSQASVNVCENNMVMLK-----LLSEEVF 167

>CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218w CRM1
          Length = 1087

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 59/130 (45%), Gaps = 19/130 (14%)

Query: 73  KLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDN---ENTRIKNGASYCIVQIS 129
           KLIT  W    + +R      + ++ FI   ++ +C +D        + N +   +VQI 
Sbjct: 73  KLITTKWKLLPQEHR------IGIRNFIVGMIISMCQDDTVFQTQKNLINKSDLTLVQIL 126

Query: 130 AVDFPDQWPQLLSVIYDGISR-----QHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETA- 183
             ++P  WP+ +  +    S      ++++  + LL+E   D  +E+M     + L+T+ 
Sbjct: 127 KQEWPQNWPEFIPELIGSSSASVNVCENNMVILKLLSEEVFDFSAEQMTQAKALHLKTSM 186

Query: 184 ----EIIFKV 189
               E IFK+
Sbjct: 187 SKEFEQIFKL 196

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,124,861
Number of extensions: 4071955
Number of successful extensions: 14923
Number of sequences better than 10.0: 111
Number of HSP's gapped: 15313
Number of HSP's successfully gapped: 114
Length of query: 1015
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 895
Effective length of database: 39,721,479
Effective search space: 35550723705
Effective search space used: 35550723705
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)