Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.243.566ON39139120950.0
YGL243W (TAD1)3.566ON40039015630.0
Smik_7.183.566ON38538415510.0
Suva_7.183.566ON38538415160.0
Kpol_380.73.566ON3853859811e-131
ZYRO0E09504g3.566ON3773839701e-129
KAFR0J028703.566ON3843859621e-128
SAKL0F00836g3.566ON3833899451e-125
NDAI0I032303.566ON3863879451e-125
TDEL0D063403.566ON4023969411e-124
NCAS0E002703.566ON3883909221e-122
Kwal_47.192633.566ON3833918881e-117
KLTH0G00748g3.566ON3853908701e-114
TPHA0G036403.566ON3963918571e-112
KNAG0I002403.566ON3913848531e-111
TBLA0E002303.566ON3943948431e-110
Ecym_25963.566ON3873858301e-108
KLLA0A00759g3.566ON3803828171e-106
CAGL0H07733g3.566ON3853917931e-102
AFR267W3.566ON3853847723e-99
Smik_1.108singletonON61571206e-08
CAGL0G02013g5.659ON144100760.30
AFR546W3.509ON1005116780.44
KLLA0A10945gna 1ON40187712.4
YHR042W (NCP1)5.292ON69190722.7
YOR165W (SEY1)6.56ON77680704.7
TBLA0I002502.500ON41999685.9
Suva_15.2305.292ON69193687.3
TPHA0A010208.619ON114289687.6
Skud_15.3748.619ON114988688.4
ZYRO0B02596g7.361ON2138157679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.24
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   811   0.0  
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   606   0.0  
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   602   0.0  
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   588   0.0  
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   382   e-131
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   378   e-129
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   375   e-128
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   368   e-125
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   368   e-125
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   367   e-124
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   359   e-122
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   346   e-117
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   339   e-114
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   334   e-112
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   333   e-111
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   329   e-110
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   324   e-108
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   319   e-106
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   310   e-102
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   301   3e-99
Smik_1.108 Chr1 complement(176076..176135,176139..176261) [183 b...    51   6e-08
CAGL0G02013g Chr7 (179215..179649) [435 bp, 144 aa] {ON} highly ...    34   0.30 
AFR546W Chr6 (1416019..1419036) [3018 bp, 1005 aa] {ON} Syntenic...    35   0.44 
KLLA0A10945g Chr1 complement(948881..950086) [1206 bp, 401 aa] {...    32   2.4  
YHR042W Chr8 (190543..192618) [2076 bp, 691 aa] {ON}  NCP1NADP-c...    32   2.7  
YOR165W Chr15 (644566..646896) [2331 bp, 776 aa] {ON}  SEY1Dynam...    32   4.7  
TBLA0I00250 Chr9 complement(34530..35789) [1260 bp, 419 aa] {ON}...    31   5.9  
Suva_15.230 Chr15 (397889..399964) [2076 bp, 691 aa] {ON} YHR042...    31   7.3  
TPHA0A01020 Chr1 (198478..201906) [3429 bp, 1142 aa] {ON} Anc_8....    31   7.6  
Skud_15.374 Chr15 complement(669087..672536) [3450 bp, 1149 aa] ...    31   8.4  
ZYRO0B02596g Chr2 (207379..213795) [6417 bp, 2138 aa] {ON} highl...    30   9.4  

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/391 (100%), Positives = 391/391 (100%)

Query: 1   MAKLLIMSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGAN 60
           MAKLLIMSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGAN
Sbjct: 1   MAKLLIMSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGAN 60

Query: 61  NVEVLSVATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFI 120
           NVEVLSVATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFI
Sbjct: 61  NVEVLSVATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFI 120

Query: 121 ESNNEIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPK 180
           ESNNEIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPK
Sbjct: 121 ESNNEIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPK 180

Query: 181 VKTILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVY 240
           VKTILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVY
Sbjct: 181 VKTILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVY 240

Query: 241 LKYIVIPDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKL 300
           LKYIVIPDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKL
Sbjct: 241 LKYIVIPDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKL 300

Query: 301 FVNDSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFK 360
           FVNDSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFK
Sbjct: 301 FVNDSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFK 360

Query: 361 SQQKERNRLITTAKNALSPDGWISTRIDDVS 391
           SQQKERNRLITTAKNALSPDGWISTRIDDVS
Sbjct: 361 SQQKERNRLITTAKNALSPDGWISTRIDDVS 391

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/390 (72%), Positives = 340/390 (87%), Gaps = 1/390 (0%)

Query: 1   MAKLLIMSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGAN 60
           +  LL M S+++L EEIS +VI EYSKLKS C+P  RP+GI+EWTILAGV  INR GGAN
Sbjct: 11  IVNLLTMPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGAN 70

Query: 61  NVEVLSVATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFI 120
            +E+LS+ATGVKALPDSELQRS GK+LHDCHAEILALRGANTVLL  I++Y+P++G  FI
Sbjct: 71  KIEILSIATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFI 130

Query: 121 ESNNEIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPK 180
           + N+EIP RFNLK++WELALYISRLPCGDASM FLND+CKN +DFIKIED+D FQYVD  
Sbjct: 131 QHNDEIPARFNLKENWELALYISRLPCGDASMSFLNDNCKN-DDFIKIEDSDEFQYVDRS 189

Query: 181 VKTILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVY 240
           VKTILRGRLNF++++VVRTKPGRYDSNITLSKSCSDKL MKQ SS+LN LNYELFE+PV+
Sbjct: 190 VKTILRGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVF 249

Query: 241 LKYIVIPDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKL 300
           LKYIVIP++ED+TKH LE+SFH RLP   ++++FLNC  PFYDD+ DE D+P  MCS+KL
Sbjct: 250 LKYIVIPNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKL 309

Query: 301 FVNDSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFK 360
           F++D STEEAI NG++NGFYTKSSKPLRKHCQSQVSRFAQWELF++IRP+++ +SYL FK
Sbjct: 310 FMDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFK 369

Query: 361 SQQKERNRLITTAKNALSPDGWISTRIDDV 390
           S+QK+R++LI   KN LSPDGWI TR DDV
Sbjct: 370 SRQKKRSQLIIAIKNILSPDGWIPTRTDDV 399

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/384 (72%), Positives = 333/384 (86%)

Query: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66
           M S++EL + IS +VI EYSKLK +C+P TRPTG+KEWT+LAG+V INR    NN++VLS
Sbjct: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60

Query: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEI 126
           +ATGVKA+PDSEL+RSGGK+LHDCHAEILALRG NTVLL HIK+Y+PANGSDFI+SN+E 
Sbjct: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120

Query: 127 PIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILR 186
           P RF LKD+WELALYIS+LPCGDAS+DFLND+CKN+ DF KIED+D FQYV+  VKTILR
Sbjct: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180

Query: 187 GRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVI 246
           G LNF++K+VVRTKPGRYDSNITLSKSCSDKL MK++SSILN+LNYELF QPV+LKY+VI
Sbjct: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240

Query: 247 PDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSS 306
           P +E++ KH+L++SFH+RLP   H+  F++C+T FYDD+  E D+PS MCSIKLF+ND +
Sbjct: 241 PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT 300

Query: 307 TEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQKER 366
            EEAI NG+KNGFYTKSSKPLRKHCQS VSRFAQWELF+QIRP+++ MSYL FKS QK R
Sbjct: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360

Query: 367 NRLITTAKNALSPDGWISTRIDDV 390
            RLI   K+ LSPDGWI T+IDDV
Sbjct: 361 TRLIIAIKDILSPDGWIPTKIDDV 384

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/384 (75%), Positives = 335/384 (87%)

Query: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66
           M +K+ELAE+IS KVIGEYSKLK+VC+P TRP+GI+EWTILAGV  INR+  A+N++VLS
Sbjct: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60

Query: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEI 126
           +ATGVK+LPDSELQRS GKLLHDCHAEILALRGANTV L HIKD+D  NG D IESNNEI
Sbjct: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI 120

Query: 127 PIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILR 186
           P +F LKD WELALYIS+LPCGDASMDFLND+C++++DF++I+D+D FQYVDP VKTILR
Sbjct: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILR 180

Query: 187 GRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVI 246
           GRLNF KKSVVRTKPGRYDSNITLSKSCSDKL M+Q SSILNSLN  LF QPV+L+YIVI
Sbjct: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVI 240

Query: 247 PDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSS 306
           P++++KT+H LE+SFHNRLP   H+ EFLNCHTPFYDD+ DEN +PS MCS KLF+NDS+
Sbjct: 241 PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST 300

Query: 307 TEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQKER 366
            EEAI NGMKNGFYTK  KPLRKHC+S +SRFAQWELF QI+P++K  SYL FK+QQ ER
Sbjct: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER 360

Query: 367 NRLITTAKNALSPDGWISTRIDDV 390
           N+LIT  K ALSPDGWI T+ DDV
Sbjct: 361 NQLITLIKGALSPDGWIPTKTDDV 384

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  382 bits (981), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 268/385 (69%), Gaps = 15/385 (3%)

Query: 13  LAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATGVK 72
           L ++ISN +  EYSKLKS  KP TR   +KEWT+LA +V I  S   N +  ++++TGVK
Sbjct: 6   LGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAI--SNDENEIIPITISTGVK 63

Query: 73  ALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEIPIR--- 129
           A P+ EL+RS GK+LHDCH+EIL+LR  NT LL+ ++     + S FI     +P +   
Sbjct: 64  ATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGDKSKFI-----LPAKADG 118

Query: 130 -FNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGR 188
            +N  +++++ALYIS+LPCGDASMD LN+  ++NE    IEDNDA+Q++DPK+KT++RGR
Sbjct: 119 KYNWNENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRGR 178

Query: 189 LNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPD 248
           LN+ KK+VVRTKPGRYDSN+TLSKSCSDKL MKQ  SILNSLN++LFE P++L Y++IP 
Sbjct: 179 LNYSKKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPT 238

Query: 249 IEDKTKHILERSFHNRLPCDGHKV---EFLNCHTPFYDDRTDENDIPSSMCSIKLFV-ND 304
           ++D+    L + F  RL   G  +    FL C   F DD+T+    P+ + SIK+ +  +
Sbjct: 239 LKDELLLKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILLPRE 298

Query: 305 SSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQK 364
              E++I NG++NG YTK +KPL+K+CQS +S+++QW+LF+ ++ +  + SY+ +K  Q 
Sbjct: 299 HQIEQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKKSQT 358

Query: 365 ERNRLITTAKNALSPDGWISTRIDD 389
            R  L    K+ LSPDGWIST  DD
Sbjct: 359 LREDLKDIIKSKLSPDGWISTFQDD 383

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  378 bits (970), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 192/383 (50%), Positives = 266/383 (69%), Gaps = 19/383 (4%)

Query: 13  LAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATGVK 72
           L   I+ KV+  Y KL S CKP TR  G+KEWT+LAG+V I++    +++ ++S+ATGVK
Sbjct: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKN--SDLRLISIATGVK 63

Query: 73  ALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIK--DYDPANGSDFIESNNEIPIRF 130
           ALPD+ L RSGGK++HDCHAEILALR  N V+L  I   + +  N  D +E  +E  + F
Sbjct: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQL-F 122

Query: 131 NLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGRLN 190
           + KD+WELA+YIS LPCGDASMD L   C++ E  I+++D+D  Q+VDP V +I+RGR N
Sbjct: 123 HFKDNWELAIYISTLPCGDASMDLL---CQD-ESIIEMQDDDPIQFVDPAVTSIVRGRFN 178

Query: 191 FHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPDIE 250
           + ++ VVRTKPGR+DS ITL KSCSDKL  +Q+ SILN + ++L  +PVYLKY+V P+  
Sbjct: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT 238

Query: 251 DKTKHILERSFHNR---LPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVN-DSS 306
           D    +L +SF++R   LP    KV  L C   F  D+    + PS+M SIKL+   +S+
Sbjct: 239 D----LLHQSFYDRIKVLPNVPLKV--LQCSYQFEHDKHSSEEEPSAMSSIKLYSTPEST 292

Query: 307 TEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQKER 366
            E+A+ NG+KNGFYTK +KPLR++C+  VSR+AQW+LF+ +RP+  + +YL FK+  ++R
Sbjct: 293 VEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDR 352

Query: 367 NRLITTAKNALSPDGWISTRIDD 389
           N LI   +  LSP GWIST  DD
Sbjct: 353 NALIQDCRKLLSPKGWISTSRDD 375

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  375 bits (962), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 190/385 (49%), Positives = 263/385 (68%), Gaps = 11/385 (2%)

Query: 11  NELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATG 70
           + L +EI+  V  EY +LK+  KP TR  G KEWT+LA VV IN +    ++++++++TG
Sbjct: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62

Query: 71  VKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEIPIRF 130
           VKA+P++ L RS G++LHDCHAEILALRG N VLLK+++D      S F++ + +   +F
Sbjct: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGG-KF 121

Query: 131 NLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGRLN 190
             K  W+LALY+SRLPCGDASMD L D+   +E  I++ ++D  QY+DP    ILRGR+N
Sbjct: 122 RWKSKWKLALYVSRLPCGDASMDHLEDA---SELDIEMSEDDRLQYIDPGKSKILRGRMN 178

Query: 191 FHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPDIE 250
           F +K  VRTKPGR DS+ITLSKSCSDKL +KQI+S LNSL +EL E PVYLKY+VIP++ 
Sbjct: 179 FKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN 238

Query: 251 DKTKHILERSFHNRLPCDG----HKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSS 306
           D  K  L R FH RL C       + +FL     F DD+T ++ +PS+   IK+F +   
Sbjct: 239 DTDKKALIRCFHTRL-CSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEH 297

Query: 307 T-EEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPK-HKSMSYLHFKSQQK 364
           T E+AI NG+KNGFYTK  KPLR+ C+S +SR++QW L++ ++      +SYL FK++Q+
Sbjct: 298 TIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQE 357

Query: 365 ERNRLITTAKNALSPDGWISTRIDD 389
           +R  L+  AK  LS   WI+T  DD
Sbjct: 358 QRRDLVENAKICLSHGSWIATLKDD 382

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  368 bits (945), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 197/389 (50%), Positives = 263/389 (67%), Gaps = 16/389 (4%)

Query: 9   SKNELAEEISNKVIGE-YSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSV 67
           S  E  E+ S+K+I E Y++LK +CKP  R  GIKEWT+LAG++ IN     N + ++S+
Sbjct: 2   SYEEFVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINER--KNTMRLVSL 59

Query: 68  ATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGS--DFIESNNE 125
            TGVKA P+ EL+RS GK++HDCHAEILALRG NTVLL  + +         D +E   +
Sbjct: 60  GTGVKATPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVD 119

Query: 126 IPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTIL 185
             + F + D W  ALYIS+LPCGD+SMD L +   N+     IE+ DA QY++    T+L
Sbjct: 120 -GLSFKVPDHWSFALYISKLPCGDSSMDTLEEEDLNS---FNIENTDACQYLEQNNHTLL 175

Query: 186 RGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIV 245
           RGR N+ KK  VRTKPGR DS ITLSKSCSDKLS++Q++S+LNS+N+ELF+ P+YLKYI+
Sbjct: 176 RGRFNYQKKGFVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYII 235

Query: 246 IPDIEDKTKHILERSFHNRLPCDG---HKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFV 302
           IP++++     LERSF  RL C+    + + FL+    F DD+  ++  PSSM SI L V
Sbjct: 236 IPNLDEHALVGLERSFE-RL-CNHPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISLNV 293

Query: 303 NDSSTE--EAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFK 360
           +++  E  EAI NG+KNGFY K+ KPLRK+C+S VSR +QW+L+  I    +  +YL FK
Sbjct: 294 HNNGEEFQEAILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQFK 353

Query: 361 SQQKERNRLITTAKNALSPDGWISTRIDD 389
           S Q ERN L   AK  LSPDGWI T +DD
Sbjct: 354 STQVERNILKNEAKLCLSPDGWIPTGVDD 382

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  368 bits (945), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 266/387 (68%), Gaps = 8/387 (2%)

Query: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66
           M+ +++LA+ I++ +  +Y  LKS  KP  R  GIKEWT+ AG+V IN     N++ V+S
Sbjct: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTD--TNDLRVIS 58

Query: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEI 126
           +ATGVKALP+ EL+RSGGK+LHD HAEI+ALRG NTV+L+ I        +D +  + + 
Sbjct: 59  LATGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDS 118

Query: 127 PIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILR 186
              ++ K + ++ALYIS+LPCGD SM  L +     E+ + I+D D+ QY++   KTILR
Sbjct: 119 EY-YSFKSNLKIALYISQLPCGDISMRMLKERDIAPEE-LAIKDEDSIQYINQDNKTILR 176

Query: 187 GRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVI 246
           GRLNF+KK  VRTKPGR DS +T SKSCSDKL MKQ +SILN L ++L EQPVYL Y+++
Sbjct: 177 GRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIV 236

Query: 247 PDIEDKTKHILERSFHNRLP-CDG--HKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVN 303
           P +  + K  ++  F+ +   C G  H+V +L+    F D R   +  PS++ +IK+F+ 
Sbjct: 237 PGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296

Query: 304 D-SSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQ 362
             +S E+ I NG+KNG YTK +KPLRK+C++ VSRF+QW++F++I PK+  MSYL FK  
Sbjct: 297 QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQS 356

Query: 363 QKERNRLITTAKNALSPDGWISTRIDD 389
           Q ER +LI   ++ +SPDGWIST+ DD
Sbjct: 357 QHERRKLIDYTRSKMSPDGWISTQEDD 383

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  367 bits (941), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 197/396 (49%), Positives = 265/396 (66%), Gaps = 16/396 (4%)

Query: 7   MSSKN---ELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVE 63
           M ++N    L + I+     EY KL S CKP  R  G KEWT+L+G+V I+       + 
Sbjct: 1   MQTRNWSDRLGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLR 60

Query: 64  VLSVATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDY--DPANGSDFIE 121
           ++S+ TGVKALPD+ L+RS G+++HDCHAEILALRG NTVLL+H+     +    +D IE
Sbjct: 61  LVSIGTGVKALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIE 120

Query: 122 SNNE-IPIRFNLKDDWELALYISRLPCGDASMDFL---NDSCKNNEDFIKIEDNDAFQYV 177
                + I   LK  W+LALYIS LPCGDASM  L   N++  N +  +  E+N   Q++
Sbjct: 121 RTTAGVCI---LKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWI 177

Query: 178 DPKVKTILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQ 237
           D K+++ILRGR N+ +  VVRTKPGRYDS IT SKSCSDKL +KQ++SILNSL + L  Q
Sbjct: 178 DQKIRSILRGRFNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQ 237

Query: 238 PVYLKYIVIPDIEDKTKHILERSFHNRLPCDGHK-VEFLNCHTPFYDDRTDENDIPSSMC 296
           PV+L Y+VIP++       +  SF +RL     K +E L C+ PF+D+++ +++ PSSM 
Sbjct: 238 PVFLDYLVIPNLAVDRCQGVHHSFQDRLGRLPQKSLELLECNVPFFDNKSSKSEEPSSMS 297

Query: 297 SIKLFVN---DSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKS 353
           S+KLF++      TE+AI NG+KNGFYTK +KPLRK+C+S VSR AQW+++  IRP  K 
Sbjct: 298 SVKLFLDLPERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQ 357

Query: 354 MSYLHFKSQQKERNRLITTAKNALSPDGWISTRIDD 389
            +YL FK+   ERNR+I   K  LSPDGWISTR DD
Sbjct: 358 QTYLEFKAGLSERNRIIQEVKKVLSPDGWISTRNDD 393

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  359 bits (922), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 187/390 (47%), Positives = 262/390 (67%), Gaps = 8/390 (2%)

Query: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66
           M  +  L + ++  V  EY+KLK   KP  R  G+KEWT+LA  ++++ + G  N++++S
Sbjct: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG--NLKMIS 58

Query: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDP-ANGSDFIESNNE 125
           ++TGVKALPD EL RSGGK++HDCHAEILALRG NTVLLK I + +     SD +E ++ 
Sbjct: 59  LSTGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDA 118

Query: 126 IPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTIL 185
              +++L+  W+L LYISRLPCGDASM  L++S   +     I+D+D FQY+DP + TIL
Sbjct: 119 NG-KYHLRAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTIL 177

Query: 186 RGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIV 245
           RGRLNF +  VVRTKPGR DS  TLSKSCSDKL ++Q++SILN + + L + PV++ Y++
Sbjct: 178 RGRLNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLL 237

Query: 246 IPDIEDKTKHILERSFHNRLPC---DGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFV 302
           IP +    K+ L  SF NRL C   +   +++L     F +D+    + PSSM SIKLF+
Sbjct: 238 IPQLNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFL 297

Query: 303 NDSST-EEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKS 361
               T EEA+ NG+KNG YTK +KPLRK+C+S VSR+AQW ++++I P + + SYL FK 
Sbjct: 298 TQGETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKR 357

Query: 362 QQKERNRLITTAKNALSPDGWISTRIDDVS 391
            Q  R  LI      LS +GW+ T+ DD +
Sbjct: 358 SQTARLELIKYTNEILSSEGWLPTQPDDFA 387

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  346 bits (888), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 253/391 (64%), Gaps = 14/391 (3%)

Query: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66
           M   ++LA++IS+     Y KLK   KP  R  G+KEW +LA V+ I   G    + ++S
Sbjct: 1   MDQPHDLADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAI---GPDQGLRLVS 57

Query: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIK---DYDPANGSDFIESN 123
           +ATGVK+ P+ EL+RS G++LHDCHAEILALRG N VLLK I+   D   A   D +  +
Sbjct: 58  LATGVKSTPNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPS 117

Query: 124 NEIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKT 183
           ++   +F L DDW  ALYISR+PCGDASMD L      +E  ++  ++ + QYV+P  +T
Sbjct: 118 SDEDGKFKLGDDWSFALYISRIPCGDASMDLLQ-----SESDMEFSEDTSCQYVNPCNRT 172

Query: 184 ILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKY 243
           ILRGR N++K+  VRTKPGR DS++TLSKSCSDKL  +Q+ SILN++ ++L E P++LKY
Sbjct: 173 ILRGRFNYNKRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKY 232

Query: 244 IVIPDIEDKTKHILERSFHNRL-PCDGHK-VEFLNCHTPFYDDRTDENDIPSSMCSIKLF 301
           IV+P + +  +   E +F +RL    G K VE L C   F DD+ + N +PSS+  I L 
Sbjct: 233 IVVPKVSNTARRGFESAFKDRLREFPGIKSVELLECPKQFPDDKFELNQVPSSVSGILLN 292

Query: 302 VNDSSTE-EAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFK 360
            ND   E ++I NG+K+G Y +  KPLRK+C++ +SR AQW LF++++      SY  FK
Sbjct: 293 TNDGQPEQQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFK 352

Query: 361 SQQKERNRLITTAKNALSPDGWISTRIDDVS 391
            +Q  RN L    +++LS DGWIST  DD +
Sbjct: 353 GEQVARNVLKNKVRSSLSSDGWISTGPDDFA 383

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  339 bits (870), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/390 (47%), Positives = 244/390 (62%), Gaps = 14/390 (3%)

Query: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66
           M    E+A++I+      Y KLK   KP  R  G KEW +LA VV INR+    ++ ++S
Sbjct: 1   MEVNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINRAN--EDLRLVS 58

Query: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHI---KDYDPANGSDFIESN 123
           +ATGVKA P+ +L+RS G++LHDCHAEILALRG N VLLK I   KD       D + S+
Sbjct: 59  LATGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSS 118

Query: 124 NEIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKT 183
           ++    + L ++W  ALYISR PCGDASM  L D     E  I   D+D  QYVD   KT
Sbjct: 119 SDNSGIYRLNEEWSFALYISRAPCGDASMGLLYD-----EGCISFTDDDRCQYVDDNNKT 173

Query: 184 ILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKY 243
           I+RGR N+ KK  VRTKPGR DS +TLSKSC+DKL  KQ+ SILNSL ++L E PV+L+Y
Sbjct: 174 IIRGRFNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEY 233

Query: 244 IVIPDIEDKTKHILERSFHNRL--PCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLF 301
           IVIP +    +   ER+F  R+       KV+ L+C   F DD+T EN  PS M SI L 
Sbjct: 234 IVIPQLPRVAEADFERAFDTRIKDSVPMEKVQILSCSQRFDDDKTYENQPPSLMSSILLN 293

Query: 302 VNDS--STEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHF 359
           + +   + +++I NG+K G + K   PL+K+C++ VSR +QW LF+QI+    S +Y  F
Sbjct: 294 IIEGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREF 353

Query: 360 KSQQKERNRLITTAKNALSPDGWISTRIDD 389
           KSQQ +RN L    + ALS DGW+ T  DD
Sbjct: 354 KSQQTDRNALKERIRLALSKDGWVGTESDD 383

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  334 bits (857), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 183/391 (46%), Positives = 253/391 (64%), Gaps = 17/391 (4%)

Query: 9   SKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVA 68
           S N +AE++S  V GEYSKL+   KP  +   + EWT+LAG++ IN   G    E +++ 
Sbjct: 12  SDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETG--EFETIAIT 69

Query: 69  TGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANG-SDFIESNNEIP 127
           TGVKA PD++L RS GK++HDCHAEILALR  N  LL  I      +G S F++      
Sbjct: 70  TGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNS 129

Query: 128 IRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRG 187
             +N K  W+LALYIS+LPCGDASMD L       E   +I D++  QY+DPK KT +RG
Sbjct: 130 YEWNKK--WDLALYISKLPCGDASMDDLMKVGDTAE--FEITDDNPLQYIDPKNKTTIRG 185

Query: 188 RLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIP 247
           RLN+ K+ V+RTKPGRYDS ITLSKSC+DKL MKQ+  IL+S    L + P++L+YI+IP
Sbjct: 186 RLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIP 245

Query: 248 DIEDKTKHILERSFHNRLPCDGHKVE---FLNCHTPFYDDRTDENDI--PSSMCSIKLFV 302
            I  K + IL+ +F +RL      V+   F++C   F DD  D   +  P+ + SIK+F+
Sbjct: 246 RISGK-ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFM 304

Query: 303 -NDSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQI---RPKHKSMSYLH 358
            N+   E++I NG+KNGFY+K  KPLRK+C+  +SR+++W L +QI   R +  ++SYL 
Sbjct: 305 DNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLE 364

Query: 359 FKSQQKERNRLITTAKNALSPDGWISTRIDD 389
           FKS   +R  L    ++ LSPDGWI+T+ DD
Sbjct: 365 FKSTLTKRMTLQQEVRSLLSPDGWITTKKDD 395

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  333 bits (853), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 172/384 (44%), Positives = 247/384 (64%), Gaps = 8/384 (2%)

Query: 13  LAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATGVK 72
           L  EI++ V  EY +L +  KPA R  G KEWTIL+G+V +    G   + ++S+ TGVK
Sbjct: 5   LGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQ-LRLISLTTGVK 63

Query: 73  ALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEIPIRFNL 132
           A P+ +L+RS G++LHDCHAEILALRG N VLL+ ++     +  D I    +   +F L
Sbjct: 64  ATPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTNKFRL 123

Query: 133 KDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGRLNFH 192
             +++LAL+ISRLPCGD SM+ L +     +D   I+D+D  QY+DP  +++LRGR N+ 
Sbjct: 124 NPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFNYA 183

Query: 193 KKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPDIEDK 252
           KK  VRTKPGR DS IT SKSCSDKL   Q +SILN+  + L E+ VY+ Y+++P+I   
Sbjct: 184 KKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNISAS 243

Query: 253 TKHILERSFHNRLPCDG---HKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSST-E 308
            ++ LER F  RL       HK++ L+C   F DD+ DE++ PSS+  +KL++ +  T E
Sbjct: 244 DRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEGETLE 303

Query: 309 EAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPK--HKSMSYLHFKSQQKER 366
           +A+ +G++NGF+TK SKPLR +C++ VSR +QW LF  + P+  +K  SY  FKS+   R
Sbjct: 304 QAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSKLVPR 363

Query: 367 NRLITTAKNALS-PDGWISTRIDD 389
             LIT  ++ L+    WI T  DD
Sbjct: 364 AELITRTRSLLTNGQPWIPTCSDD 387

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  329 bits (843), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/394 (45%), Positives = 255/394 (64%), Gaps = 16/394 (4%)

Query: 10  KNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVAT 69
           K EL ++I+  +  EY+KLK   KP  +  GIKEWTI++G+V ++ +   N ++V+S+AT
Sbjct: 3   KRELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVS-NKDTNIIKVISLAT 61

Query: 70  GVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHI--KDYDPANGSDFI-ESNNEI 126
           GVKA PDSEL+RS G ++HDCHAEILA+RG NT LL+ I  K+ D  N  D I +  N  
Sbjct: 62  GVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSK 121

Query: 127 PIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILR 186
             +++  D+++L LYIS+LPCGD+SM+  N    N+   I+ ++ND  QYVDP ++TILR
Sbjct: 122 CKKYSWNDEYDLGLYISKLPCGDSSMEEENSLESNS--LIQFQENDLTQYVDPTIRTILR 179

Query: 187 GRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVI 246
           GR+N++K   VRTKPGR DS IT SKSCSDK+ +KQ+ S+LNSLN EL E P+Y+KY+V 
Sbjct: 180 GRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVC 239

Query: 247 PDIEDKTKHILERSFHN----RLPCDG----HKVEFLNCHTPFYDDRTDENDIPSSMCSI 298
           PDI+ +   +L++SF+     +L        H + F+     F D +T++   PS    +
Sbjct: 240 PDIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVV 299

Query: 299 KLF-VNDS-STEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSY 356
           K+F  ND    E++I NG+K G YTK SKPL K+  + VSR  QW +F+ I P+ +  SY
Sbjct: 300 KIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSY 359

Query: 357 LHFKSQQKERNRLITTAKNALSPDGWISTRIDDV 390
           L FK  Q +R       +  LS DGWIST  DD+
Sbjct: 360 LTFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  324 bits (830), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 177/385 (45%), Positives = 244/385 (63%), Gaps = 15/385 (3%)

Query: 13  LAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATGVK 72
           LAE +S  VI +Y  LK   KP+ +  GIKEWT+LAG+V I+ +   N + ++SVATGVK
Sbjct: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDEN--TNELRLISVATGVK 65

Query: 73  ALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIK--DYDPANGSDFIESNNEI-PIR 129
           ALP+ EL+RS G++LHD HAEILALR  N VLLK +     +P    D +E  N   P R
Sbjct: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYR 125

Query: 130 FNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGRL 189
             ++  W++ALYISR PCGD SMD L +   ++ ++++   +D  QY++P ++T LRGR 
Sbjct: 126 --MRKRWKIALYISRPPCGDCSMDILGE---DDTNYMQFSFDDCCQYINPGIRTTLRGRF 180

Query: 190 NFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPD- 248
           N+  K V RTKPGR DS ITLSKSCSDKL+ KQ+ SILNS N++L E PV+L Y+V+P  
Sbjct: 181 NYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQH 240

Query: 249 IEDKTKHILERSFHNRLPC--DGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVN--D 304
             +K      R+FH RL    + H +E + C   F  D+ +E+  P  +  + + +   +
Sbjct: 241 HREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPME 300

Query: 305 SSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQK 364
              EE I NG+ NGFY K+++PLRK+C+S +SR + W LF Q+     S SYL FKS+Q 
Sbjct: 301 MDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQT 360

Query: 365 ERNRLITTAKNALSPDGWISTRIDD 389
            RN+L    +  LS DGWI T  DD
Sbjct: 361 SRNQLKEQVRLHLSSDGWIPTSADD 385

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  319 bits (817), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 171/382 (44%), Positives = 232/382 (60%), Gaps = 12/382 (3%)

Query: 13  LAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATGVK 72
           +A+ I+  VI  Y KL    KP  R  G+ EWT+L+G+V  +     +  E +S+ TGVK
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELN--DRYEPISLGTGVK 61

Query: 73  ALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEIPIRFNL 132
           A P+ ELQRS G+++HDCHAE++ LR  N +LLK I D      S  IE + +    + +
Sbjct: 62  ATPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNGQKSFLIEKSAD---GYKV 118

Query: 133 KDDWELALYISRLPCGDASMDFLN----DSCKNNEDFIKIEDNDAFQYVDPKVKTILRGR 188
           KD W+ A+YISR+PCGDASM+ L       C+N +    I  N   QYV P++ TI+RGR
Sbjct: 119 KDVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFING--QYVHPEIDTIIRGR 176

Query: 189 LNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPD 248
            N+  + VVRTKPGR DS ITLSKSCSDKL+MKQ+ SI N+L + L + PVYL++IV+P 
Sbjct: 177 ANYKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLPK 236

Query: 249 IEDKTKHILERSFHNRLPCDGH-KVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSST 307
                +  LE +F  RL        +FL C+  F  DRT+ +  PS    + L+ ++ + 
Sbjct: 237 QYQYEQVQLEDTFWLRLKNQQFLPFKFLFCNETFSADRTNLSQQPSLSSCVSLYGSNEAV 296

Query: 308 EEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQKERN 367
            E I NG+KNGFY K  KPLRK CQS +SR AQW  F++I+       Y  FKS   +RN
Sbjct: 297 SEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKSSVVDRN 356

Query: 368 RLITTAKNALSPDGWISTRIDD 389
            +I+ AK  LS  GWIST  D+
Sbjct: 357 HIISKAKATLSASGWISTCRDN 378

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  310 bits (793), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/391 (44%), Positives = 248/391 (63%), Gaps = 18/391 (4%)

Query: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66
           MS +++   +I+  V+ EY KL +  +P TR  G KE TI+A V+  +     +++  L+
Sbjct: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSI--LT 58

Query: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESN--N 124
           + TGVK+ P+ EL RS GK+LHDCHAEILALRG N +LL+HIK        + IESN  +
Sbjct: 59  ITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIK-----RSMEGIESNLIH 113

Query: 125 EIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTI 184
             P  F   ++ EL L+IS+LPCG+ SM  L +    +E+ +  E++D  QY+ P++KTI
Sbjct: 114 NTPNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTI 173

Query: 185 LRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYI 244
           LRGR NF+K++ VRTKPGR DS  T SKSCSDKL ++  +S+LNSL   +   P+Y+   
Sbjct: 174 LRGRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNY 233

Query: 245 VIPDIEDKTKHILERSFHNRLPCDGH----KVEFLNCHTPFYDDRTDENDIPSSMCSIKL 300
           VIP+I   +  I E + +   P D H    ++     H  F DD + E   PSSM ++K+
Sbjct: 234 VIPNI--NSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETP-PSSMSALKI 290

Query: 301 FVNDSS-TEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHF 359
             ND+   EE I NG+KNG+YTK+SKPLRK+C+S+VSR++ W LF  +  + K ++YL F
Sbjct: 291 LFNDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEF 350

Query: 360 KSQQ-KERNRLITTAKNALSPDGWISTRIDD 389
           K +   ER  LI + K++LS DGW+ST  DD
Sbjct: 351 KRRYCAERAELIRSIKSSLSSDGWLSTAEDD 381

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  301 bits (772), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 170/384 (44%), Positives = 226/384 (58%), Gaps = 15/384 (3%)

Query: 11  NELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATG 70
           ++LAE I  +VI +Y   K   KPA R  G  EWT+LAGVV+++R        ++S ATG
Sbjct: 4   DKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTA--ECRLVSAATG 61

Query: 71  VKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGS--DFIESNNEIPI 128
           VKALPD EL+RS G+++HD HAEILALRG N VLL+  K       +  D +E   +   
Sbjct: 62  VKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVE-QAKTQD 120

Query: 129 RFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGR 188
           RF L   W+ ALYIS+ PCGD SMD  +D        +    +D  QYV     T+LRGR
Sbjct: 121 RFRLASRWQAALYISKAPCGDCSMDMADDDADE----MTFSPDDPIQYVAEHNYTMLRGR 176

Query: 189 LNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPD 248
            N+ +K V RTKPGR DS ITLSKSCSDKL+ K + S+L+S+ +ELFE+PV+L Y+V+P 
Sbjct: 177 FNYSRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLPH 236

Query: 249 IEDKTKHILERSFHNRLP-CDG-HKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVN-DS 305
                    ER F  RL   +G H    L CHT F  DR      P+   S+ L +    
Sbjct: 237 TIATAG--FERCFAERLAGLEGTHMPRLLCCHTAFPGDRAAPQQPPALTASVYLNITAKK 294

Query: 306 STEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQKE 365
             E+A+ NG++NG Y +  + L  H ++ VSR A W +F Q+  +   +SY  FK QQ  
Sbjct: 295 HVEQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPPLSYAAFKRQQHA 353

Query: 366 RNRLITTAKNALSPDGWISTRIDD 389
           RNRL    ++ LSPDGW +TR+DD
Sbjct: 354 RNRLKRHVRHRLSPDGWPTTRVDD 377

>Smik_1.108 Chr1 complement(176076..176135,176139..176261) [183 bp,
           61 aa] {ON} YGL243W (REAL)
          Length = 61

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 85  KLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEIPIRFNLKDDWELALY 141
           KL    +  IL LRGAN VLL ++K   PAN +DF  SN+  P RF LK + ELAL+
Sbjct: 6   KLYTIVYPGILTLRGANKVLLNYVKGCKPANDNDFF-SNHGTPSRFKLKGNCELALF 61

>CAGL0G02013g Chr7 (179215..179649) [435 bp, 144 aa] {ON} highly
           similar to uniprot|P36154 Saccharomyces cerevisiae
           YKR074w
          Length = 144

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 76  DSELQ-RSGGKLLHDCHAEIL---ALRGANTVLLKHIKDYDPANGSDFIESNNEIPIRFN 131
           D +LQ ++ G LL DC A I    + R    V L  +K Y  A+GS  +     + I F+
Sbjct: 44  DYDLQNKTAGDLLRDCMARISTEGSFRPFRNVKLDTLKVYTHAHGSKTVN----LVINFD 99

Query: 132 LKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDN 171
             +DW L    +R  C     +    S  N ED++  + N
Sbjct: 100 HDEDWMLDTTSNRKLCEYGVENETEISLFNREDYVAYKAN 139

>AFR546W Chr6 (1416019..1419036) [3018 bp, 1005 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL201C (MCM6)
          Length = 1005

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 52/116 (44%), Gaps = 7/116 (6%)

Query: 131 NLKDDWELALYISRL--PCGDA-----SMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKT 183
           N K D ELA +I  L   C DA     +MD L    K    F  I   DA Q++  K K 
Sbjct: 721 NQKVDTELASHIVNLHMKCDDAIDPPFTMDQLRRYIKYARTFKPILTEDARQFLVEKYKE 780

Query: 184 ILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPV 239
           + +  +  + KS  R    + +S I LS++ +    + +I+    +  Y+L  Q +
Sbjct: 781 LRKNDIQGYSKSSYRITVRQLESMIRLSEAIARANCVDEITPAFVAEAYDLLRQSI 836

>KLLA0A10945g Chr1 complement(948881..950086) [1206 bp, 401 aa] {ON}
           weakly similar to uniprot|P23180 Saccharomyces
           cerevisiae YHL021C FMP12
          Length = 401

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 8/87 (9%)

Query: 302 VNDSSTEEAIFNGM-KNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFK 360
           +ND ST++ IFN + + GF    + P+      +VS     EL   IRP H       F 
Sbjct: 140 INDDSTKKIIFNEIYQYGFTLIDNVPVSLDATKEVS-----ELISIIRPTHYDTGVWDFT 194

Query: 361 SQQKERNRLITTAKNALSPDG--WIST 385
           S   +++   T+    +  DG  W  T
Sbjct: 195 SDLSKKDTAYTSLAIDMHTDGNYWYET 221

>YHR042W Chr8 (190543..192618) [2076 bp, 691 aa] {ON}
           NCP1NADP-cytochrome P450 reductase; involved in
           ergosterol biosynthesis; associated and coordinately
           regulated with Erg11p
          Length = 691

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

Query: 99  GANTVLLKHIKDYDPANGSDFIESNNEIPIRFNLKDDWELALYISRLPCGDASMDFLNDS 158
           G N  L KHI  Y   N  DF+  +        L   +E+ +  SRLP  +    ++ D 
Sbjct: 566 GNNVSLGKHILFYGSRNTDDFLYQDEWPEYAKKLDGSFEMVVAHSRLP--NTKKVYVQDK 623

Query: 159 CKNNEDFI-KIEDNDAFQYVDPKVKTILRG 187
            K+ ED + ++ +N AF YV    K + +G
Sbjct: 624 LKDYEDQVFEMINNGAFIYVCGDAKGMAKG 653

>YOR165W Chr15 (644566..646896) [2331 bp, 776 aa] {ON}
           SEY1Dynamin-like GTPase that mediates homotypic ER
           fusion; has a role in ER morphology; interacts
           physically and genetically with Yop1p and Rtn1p;
           functional ortholog of the human atlastin ATL1, defects
           in which cause a form of the human disease hereditary
           spastic paraplegia; homolog of Arabidopsis RHD3
          Length = 776

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 261 FHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSSTEEAIFNGMKNGFY 320
           +H+RLP DG  +   NC      +R  + D+P+    +  F  +  + EA+   +    Y
Sbjct: 263 YHHRLPLDGWTMYAENCWDQI--ERNKDLDLPTQQILVARFKTEEISNEALEEFISK--Y 318

Query: 321 TKSSKPLRKHCQSQVSRFAQ 340
            +S  PL+ +  S  S+  +
Sbjct: 319 DESIAPLKGNLGSLTSQLVK 338

>TBLA0I00250 Chr9 complement(34530..35789) [1260 bp, 419 aa] {ON}
           Anc_2.500 YHL004W
          Length = 419

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 7/99 (7%)

Query: 281 FYDDRTDENDIPSSMCSIKLFVNDSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQ 340
           F+DD +++ND+  +M   +L  ND ST  A      +  Y++SS          ++ F  
Sbjct: 118 FFDDFSNKNDLFRTMDEYELLTNDDSTTRA---QSIDNMYSQSS----VGVNDTLNNFPF 170

Query: 341 WELFRQIRPKHKSMSYLHFKSQQKERNRLITTAKNALSP 379
            E  +  +P  K   +L      +   RL  T KN  +P
Sbjct: 171 LEPSQYDKPYTKQELFLRQLKHSRSTARLGATIKNVYNP 209

>Suva_15.230 Chr15 (397889..399964) [2076 bp, 691 aa] {ON} YHR042W
           (REAL)
          Length = 691

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 99  GANTVLLKHIKDYDPANGSDFIESNNEIPIRFNLKDDWELALYISRLPCGDASMDFLNDS 158
           G N  L KH+  Y   +  DF+  +        L   +E+ +  SRLP  ++   ++ D 
Sbjct: 566 GNNVSLGKHLLFYGSRDTDDFLYQDEWPEYAKKLDGSFEMVVAHSRLP--NSKKVYVQDK 623

Query: 159 CKNNED-FIKIEDNDAFQYVDPKVKTILRGRLN 190
            K+ E+   ++ +N AF YV    K + +G LN
Sbjct: 624 LKDYENQVFEMINNGAFIYVCGDAKGMAKGVLN 656

>TPHA0A01020 Chr1 (198478..201906) [3429 bp, 1142 aa] {ON} Anc_8.619
           YOR207C
          Length = 1142

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 8/89 (8%)

Query: 115 NGSDFIESNN---EIPIRFNLKDDWELA-LYISRLPCGDASMDFLNDSCKNNEDFIKIE- 169
           NG  +++ N+   E+PI   LK    ++ L I +L CG+ S  + +    N E+ +K+  
Sbjct: 233 NGKIYLKHNSIAEEVPIAIILKACGIVSDLEIMQLVCGNDS-SYQDIFAINLEEAVKLNI 291

Query: 170 --DNDAFQYVDPKVKTILRGRLNFHKKSV 196
                A +Y+  KVKTI R +L+  ++ +
Sbjct: 292 STQQQALEYIGSKVKTIRRQKLSILQEGI 320

>Skud_15.374 Chr15 complement(669087..672536) [3450 bp, 1149 aa]
           {ON} YOR207C (REAL)
          Length = 1149

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 115 NGSDFIESNN---EIPIRFNLKDDWELA-LYISRLPCGDAS--MDFLNDSCKNNEDFIKI 168
           NG  +++ N+   EIPI   LK    L+ L I +L CG+ S   D    + + +      
Sbjct: 237 NGKIYLKHNSIAEEIPIAIVLKACGILSDLEIMQLVCGNDSSYQDIFAVNLEESSKLDIY 296

Query: 169 EDNDAFQYVDPKVKTILRGRLNFHKKSV 196
               A +Y+  KVKT+ R +L   ++ V
Sbjct: 297 TQQQALEYIGAKVKTMRRQKLTILQEGV 324

>ZYRO0B02596g Chr2 (207379..213795) [6417 bp, 2138 aa] {ON} highly
            similar to uniprot|Q12680 Saccharomyces cerevisiae
            YDL171C GLT1 NAD( )-dependent glutamate synthase (GOGAT)
            synthesizes glutamate from glutamine and
            alpha-ketoglutarate with Gln1p forms the secondary
            pathway for glutamate biosynthesis from ammonia
            expression regulated by nitrogen source
          Length = 2138

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 68/157 (43%), Gaps = 20/157 (12%)

Query: 82   SGGKLLHDCHAEILALR--GANTVL--LKHIKDYDPANGSDFI-----ESNNEIP----- 127
            SG   +  C  E  A+R  GA TV+  ++    ++   G   +     ES N        
Sbjct: 1417 SGTAFIAGCVGERFAVRNSGATTVVERIRGNNAFEYMTGGRAVILSQLESLNAFSGATGG 1476

Query: 128  IRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRG 187
            I + L  D+E   ++ ++  G   ++ L+D  +    F+K    + + Y   ++   + G
Sbjct: 1477 ICYCLTSDYED--FVGKINKGTVELEGLSDPVEIA--FVKNLIQEHYNYTKSELAERILG 1532

Query: 188  RLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQIS 224
            R N++ K+ V+  P  Y     L K   +K+  KQ++
Sbjct: 1533 RFNYYLKNFVKVIPSDYKK--VLLKEAEEKVKQKQLA 1567

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,471,261
Number of extensions: 2073985
Number of successful extensions: 6028
Number of sequences better than 10.0: 53
Number of HSP's gapped: 6171
Number of HSP's successfully gapped: 53
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)