Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.233.567ON56454323300.0
Suva_7.173.567ON56954821660.0
Smik_7.173.567ON56554521470.0
YGL244W (RTF1)3.567ON55854421450.0
TDEL0D063503.567ON56554815190.0
KNAG0I002303.567ON57155915060.0
NDAI0I032403.567ON56354714980.0
KAFR0J028803.567ON55554714590.0
ZYRO0E09526g3.567ON56054114470.0
TPHA0A060003.567ON54953714280.0
CAGL0H07711g3.567ON56655114110.0
SAKL0F00814g3.567ON57448413520.0
Kpol_507.103.567ON46146313261e-179
AFR266W3.567ON56255013201e-177
Kwal_47.192653.567ON56753913131e-176
NCAS0E002603.567ON55831611311e-148
Ecym_25973.567ON56231811051e-144
KLTH0G00726g3.567ON56131610891e-142
KLLA0A00737g3.567ON58231510361e-134
TBLA0E002203.567ON57031710251e-132
Skud_14.1112.16ON58297742.0
Suva_14.1172.16ON581109714.6
Kpol_1054.581.530ON40162689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.23
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   902   0.0  
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   838   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   831   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   830   0.0  
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   589   0.0  
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   584   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   581   0.0  
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   566   0.0  
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   561   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   554   0.0  
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   548   0.0  
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   525   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   515   e-179
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   513   e-177
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   510   e-176
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   440   e-148
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   430   e-144
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   424   e-142
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   403   e-134
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   399   e-132
Skud_14.111 Chr14 complement(211532..213280) [1749 bp, 582 aa] {...    33   2.0  
Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {...    32   4.6  
Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON} (1443...    31   9.0  

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/543 (83%), Positives = 453/543 (83%)

Query: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPYSVGNAGYGSEGEEAN 81
           QVLTSTSAKRAKNNDQSVSKKRRIEVDSA            YNPYSVGNAGYGSEGEEAN
Sbjct: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDDYNPYSVGNAGYGSEGEEAN 81

Query: 82  PFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK 141
           PFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK
Sbjct: 82  PFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK 141

Query: 142 DKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXXXXXXXX 201
           DKED           HATGHSDIKASKLSQLKKQRARKNRQYS                 
Sbjct: 142 DKEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDNEDEEDDEDEYREDNY 201

Query: 202 XXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGRSFVA 261
                          PFDRKDLYDKR                   ISDYNKLRIGRSFVA
Sbjct: 202 KNEEESEYEDDEEYNPFDRKDLYDKREEEVEWAEEGEDELDREPEISDYNKLRIGRSFVA 261

Query: 262 KFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGVT 321
           KFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGVT
Sbjct: 262 KFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGVT 321

Query: 322 QGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLTD 381
           QGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLTD
Sbjct: 322 QGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLTD 381

Query: 382 KTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMS 441
           KTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMS
Sbjct: 382 KTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMS 441

Query: 442 IYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRTK 501
           IYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRTK
Sbjct: 442 IYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRTK 501

Query: 502 VYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGELDIKFD 561
           VYYQEIQKEENAKAKEIAQQEKLQ                QFRRLGGLERMIGELDIKFD
Sbjct: 502 VYYQEIQKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQFRRLGGLERMIGELDIKFD 561

Query: 562 FKF 564
           FKF
Sbjct: 562 FKF 564

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/548 (77%), Positives = 443/548 (80%), Gaps = 5/548 (0%)

Query: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPYSVGNAGYGSEGEE-- 79
           QVLTSTSAKRAKNNDQS+SKKRRIEV SA            YNPYSVGN GYGSE EE  
Sbjct: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDDYNPYSVGNTGYGSEEEEEV 81

Query: 80  -ANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQ 138
             NPFPLEGK+KDE+DREHLESLPEMERETLLFERSQIMQKYQERKLFRARG+DMKEQQQ
Sbjct: 82  EPNPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQ 141

Query: 139 R--AKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXXX 196
           R  A+D ED           HATGHSDIKASKLSQLKKQRARKNRQYS            
Sbjct: 142 RKRARDDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDSEDEQDDQEEY 201

Query: 197 XXXXXXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIG 256
                               PFDRK +YDKR                   ISD+NKLRIG
Sbjct: 202 REDDYKNDEGSEYGDDEEYNPFDRKGVYDKREEEVEWAEEEEDELDRDPEISDFNKLRIG 261

Query: 257 RSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQ 316
           RSFVAKFCFYPGFEDVVKGCYGRVN+GTDKRTGKTSYRMVRIER+FLQKPY+MGKF+TNQ
Sbjct: 262 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQ 321

Query: 317 YFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVN 376
           YFGVTQGKDRKVFQMNYFSDG F DDEY+RYFKALD SHMVKPSLH+LSNKTKEV+DFVN
Sbjct: 322 YFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVN 381

Query: 377 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 436
           TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF
Sbjct: 382 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 441

Query: 437 EKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRL 496
           EKRMS+YEKHHENDQSDIKTLGELTSKNRKLN+SNIRNAEHVKKED SNFDSKSDPFSRL
Sbjct: 442 EKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRL 501

Query: 497 KTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGEL 556
           KTRTKVYYQEIQKEENAKAKE+AQQEKLQ                QFRRLGGLERMIGEL
Sbjct: 502 KTRTKVYYQEIQKEENAKAKEMAQQEKLQEDRESKERREKELLLAQFRRLGGLERMIGEL 561

Query: 557 DIKFDFKF 564
           DIKFDFKF
Sbjct: 562 DIKFDFKF 569

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/545 (77%), Positives = 441/545 (80%), Gaps = 3/545 (0%)

Query: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXX-YNPYSVGNAGYGSEG-EE 79
           QVLT+TSAKRAKNNDQS+SKKRRIEV +A             YNPYSVGNA YGSE  EE
Sbjct: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNPYSVGNASYGSEEVEE 81

Query: 80  ANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 139
            NPFPLEGK+K+E+DREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR
Sbjct: 82  PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 141

Query: 140 AKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXXXXXX 199
           AK+ ED           HATGHSDIKASKLSQLKKQRARKNR YS               
Sbjct: 142 AKNDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEGEVDDEDEYRED 201

Query: 200 XXXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGRSF 259
                            PFDR DLYDKR                   ISD+NK+RIGRSF
Sbjct: 202 DYKDDEGSEYGDDEEYNPFDRGDLYDKREEEVEWAEEEDELDREPE-ISDFNKVRIGRSF 260

Query: 260 VAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFG 319
           VAKFCFYPGFEDVVKGCYGRVN+GTDKRTGKTSYRMVRIERVFLQKPY+MGKFYTNQYFG
Sbjct: 261 VAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFG 320

Query: 320 VTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPL 379
           VTQGKDRKVFQMNYFSDG FADDEY+RY +ALDNS +VKPSLHSL+NKTKEVMDFVNTPL
Sbjct: 321 VTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPL 380

Query: 380 TDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKR 439
           TDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKR
Sbjct: 381 TDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKR 440

Query: 440 MSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTR 499
           MS+YEKHHENDQSDIK LGELTSKNRKLNMSNIRNAEHVKKED +NFDSKSDPFSRLKTR
Sbjct: 441 MSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTR 500

Query: 500 TKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGELDIK 559
           TKVYYQEIQKEENAKAKEIAQQEKLQ                QFRRLGGLERMIGELDIK
Sbjct: 501 TKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIK 560

Query: 560 FDFKF 564
           FDFKF
Sbjct: 561 FDFKF 565

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/544 (77%), Positives = 440/544 (80%), Gaps = 8/544 (1%)

Query: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPYSVGNAGYGSEGEE-A 80
           QVLT+TSAKRAKNNDQS+SKKRRIEV S             YNPYSVGNA YGSE EE A
Sbjct: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDD----YNPYSVGNADYGSEEEEEA 77

Query: 81  NPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA 140
           NPFPLEGK+KDE+DREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA
Sbjct: 78  NPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA 137

Query: 141 KDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXXXXXXX 200
           K+ ED           HATGHSDIKASKLSQLKKQRARKNR YS                
Sbjct: 138 KNDEDSRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEDEDDEEDYREEDY 197

Query: 201 XXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGRSFV 260
                           PFDR+D YDKR                   ISD+NKLRIGRSFV
Sbjct: 198 KDDEGSEYGDDEEYN-PFDRRDTYDKREEVEWAEEEDEQDREPE--ISDFNKLRIGRSFV 254

Query: 261 AKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGV 320
           AKFCFYPGFED VKGCYGRVN+GTDKRTGKTSYRMVRIERVFLQKPY+MGKFYTNQYFGV
Sbjct: 255 AKFCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGV 314

Query: 321 TQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLT 380
           TQGKDRKVFQMNYFSDG FA+DEY+RY +ALDNS M+KPSLHSLSNKTKEVMDFVNTPLT
Sbjct: 315 TQGKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLT 374

Query: 381 DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM 440
           DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM
Sbjct: 375 DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM 434

Query: 441 SIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRT 500
           S+YEKHHENDQSDIK LGELTSKNRKLNMSNIRNAEHVKKED++NFDSKSDPFSRLKTRT
Sbjct: 435 SVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRLKTRT 494

Query: 501 KVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGELDIKF 560
           KVYYQEIQKEENAKAKEIAQQEKLQ                QFRRLGGLERM+GELDIKF
Sbjct: 495 KVYYQEIQKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLERMVGELDIKF 554

Query: 561 DFKF 564
           D KF
Sbjct: 555 DLKF 558

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/548 (57%), Positives = 377/548 (68%), Gaps = 15/548 (2%)

Query: 23  VLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXX-YNPYSV-------GNAGYG 74
           VLT TSAKR K +D + SK+R+I V+ A             YNP +V             
Sbjct: 23  VLT-TSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEEDDYNPAAVQTESGRYSEEDEE 81

Query: 75  SEGEEANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMK 134
            E EE NPFPLEGK+KD+NDR HLE LPEMERETLLFERSQIMQKY +R+LFR RGR+MK
Sbjct: 82  DEEEEENPFPLEGKYKDDNDRAHLEGLPEMERETLLFERSQIMQKYHDRRLFRERGRNMK 141

Query: 135 EQQQRAKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXX 194
           EQQ+  + +E            HATGHSD+KASKLSQL+KQR +K   +           
Sbjct: 142 EQQKNRQLREGNKTRSSARTT-HATGHSDLKASKLSQLRKQREQKG--HRANRDRDFEEE 198

Query: 195 XXXXXXXXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLR 254
                                 P++RK   D R                   I+D+NK++
Sbjct: 199 EEEEEDRYEGSEYEDEDEEDYDPYNRKSHRDARKGRRSGMGRDQLDREAD--ITDFNKIK 256

Query: 255 IGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYT 314
           IGRSFVAKFCFYPGF DVVKG YGRVN+G DKR+G+T YRMV+IE+VF QKPY+MG F+T
Sbjct: 257 IGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFFQKPYNMGNFFT 316

Query: 315 NQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDF 374
           NQYFGVTQGKDRKVFQMN+FSDG+F   EY RY +ALD  H+ KPS++SL NK KE+  F
Sbjct: 317 NQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLDNKAKEMNAF 376

Query: 375 VNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLR 434
           V+ PLTDK TD++VR+RM FNKKLSG+NAVLEKTVL+EKL+YA+ET N++DIAKYS+QLR
Sbjct: 377 VSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRDIAKYSSQLR 436

Query: 435 NFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFS 494
           N  KRMS YEKHHE DQS IK LG LTSKNRK+NM  IRNAEH+KKED  NFD+KSDPFS
Sbjct: 437 NLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKED-VNFDAKSDPFS 495

Query: 495 RLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIG 554
           RLKTRTKVYYQEIQKEEN +A++IA+Q++L                  F+RLGGLER+IG
Sbjct: 496 RLKTRTKVYYQEIQKEENERAQDIARQKQLDESEEAIARREKELLSSDFKRLGGLERVIG 555

Query: 555 ELDIKFDF 562
           ++ + F F
Sbjct: 556 QMQLPFTF 563

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/559 (54%), Positives = 378/559 (67%), Gaps = 29/559 (5%)

Query: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDS-----AXXXXXXXXXXXXYNPYSVGNAGYG-- 74
           +VLTST +KR+K +D + SKKRRI   S                  YNP+ VGN   G  
Sbjct: 22  RVLTSTVSKRSKQSDATASKKRRIYEGSEEEVYDDEADDVDEEEDDYNPHEVGNYDTGDD 81

Query: 75  -SEGEEANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDM 133
            +E EE NPFPL+GK+KDE DRE+LESLPE+ERET+LF+RSQ M+KYQERKLFR R R  
Sbjct: 82  EAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKRQQ 141

Query: 134 KEQQQRAKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARK-NRQYSXXXXXXXX 192
           + +  R+  +             H+TGHSD+KASKLSQLK+QR +K NRQ S        
Sbjct: 142 EAKPTRSSGR-----------TAHSTGHSDLKASKLSQLKRQRDKKLNRQRSDDEYEEDE 190

Query: 193 XXXXXXXXX-------XXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXX 245
                                          P   K  YD+                   
Sbjct: 191 EEEEEDDYNGYGDDLNEDAEYQEDEDEEDYNPLAIKSKYDELEEEEDDDVKWAEDNDRVS 250

Query: 246 XISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQK 305
            ++D+NKLRIGRSFVAKFCFYPGF D+V GCYGRVN+G DKR+G+T YRMV+IE+VFLQK
Sbjct: 251 ELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQK 310

Query: 306 PYSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLS 365
           PY+MGKFYTNQYFGVTQGKDRKVFQMN+FSDG F  +EY RY ++L+ +++ +PS H LS
Sbjct: 311 PYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILS 370

Query: 366 NKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKD 425
           NK+KE++ F+  PLT+K TDE+VR+RM FNKKLSGTNAVLEKTVLR KLQYA+E+NNE+D
Sbjct: 371 NKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERD 430

Query: 426 IAKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNS- 484
           +AKYSAQLRNFEKRM+ YEKHHEND +  K LG LTSKNRK+NM   +N +H KKED++ 
Sbjct: 431 VAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAG 490

Query: 485 -NFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQF 543
              DSKSDPFSRLKTRTK+YYQE+QKEEN KAK +AQQ++++                QF
Sbjct: 491 PTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQF 550

Query: 544 RRLGGLERMIGELDIKFDF 562
           RRLGGLE MI ++++ FD 
Sbjct: 551 RRLGGLENMISKINVNFDI 569

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/547 (55%), Positives = 372/547 (68%), Gaps = 17/547 (3%)

Query: 24  LTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPYSVGNAGYGSEGEEANPF 83
           L +TS KRAKN+DQ  SK+++IEVDS             YNPY  GN     E +E NPF
Sbjct: 24  LLTTSGKRAKNHDQVGSKRKKIEVDSEAEEEEEDD----YNPYG-GNQSEEEEIDEPNPF 78

Query: 84  PLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKDK 143
           PLE K+KDE+DREHLESLPEMERETLLFERSQ+M+KYQERKLFR R R++KEQQ+R + +
Sbjct: 79  PLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERNELE 138

Query: 144 EDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARK------NRQYSXXXXXXXXXXXXX 197
           E+           HATGHSD+KASKLSQLKKQR RK      N                 
Sbjct: 139 EEGKKTRSSTRATHATGHSDLKASKLSQLKKQRERKTRDQDYNDVEDEDDLDDYAPDDNY 198

Query: 198 XXXXXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGR 257
                              P+  +  YD                     + D+NK+++GR
Sbjct: 199 KHEDSEYEEEGEEDEEDYNPYATRKSYD---MDKDEVEWAEEQTDREAELDDFNKVKVGR 255

Query: 258 SFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQY 317
           SF+AK+CFYPGF D++KGCYGRVN+GTD+RTG +SYRMV+IE+VFL+ PY MG F+TNQY
Sbjct: 256 SFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQY 315

Query: 318 FGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNT 377
            GVTQG DRKV QMN FSDG F   E+ RY +AL+NSH+ KPS+H L  K+KE+  FV+ 
Sbjct: 316 LGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSE 375

Query: 378 PLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFE 437
           PLT K TD +VR+RM FNKKLSGTNAVLEKTVL++KL+YA+E NNE+D+AKYS+QLRN E
Sbjct: 376 PLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLE 435

Query: 438 KRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLK 497
           KRMS+YEKHHENDQ  +  LG LTSKNRK+NM  IRNAEH+KKED+   DSKSDPFSRLK
Sbjct: 436 KRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHG-LDSKSDPFSRLK 494

Query: 498 TRTKVYYQEIQKEENAKAKEIAQ--QEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGE 555
           TRTK+YYQE+QKEEN KA+ +A+  Q++LQ                +F+RLGGLE +I  
Sbjct: 495 TRTKIYYQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGGLENLIQN 554

Query: 556 LDIKFDF 562
           LDI   F
Sbjct: 555 LDINVTF 561

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/547 (55%), Positives = 382/547 (69%), Gaps = 22/547 (4%)

Query: 23  VLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPYSVGNAGYGSEGEEAN- 81
           VLT TS +  ++ D S +KKRRIE DS             YNP ++ + G G+  E  + 
Sbjct: 22  VLT-TSKRTKQSGDSSANKKRRIESDSDEDEDD-------YNPAAI-DGGDGAYNENDDE 72

Query: 82  ------PFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKE 135
                 PFPLEGK+K+E DR++LESLPEMERET+L++RSQ M+KY+ER+ F+ R +++K 
Sbjct: 73  EEYEENPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKR 132

Query: 136 QQQRAKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXX 195
           Q++R +D E            HATGH+D+KASKLSQLKKQR +KN+              
Sbjct: 133 QKERNEDDE-ALKTRSSGRATHATGHTDLKASKLSQLKKQREKKNKSRQYSDYEEEEEED 191

Query: 196 XXXXXXXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRI 255
                                P++RK  Y                      ++D+NKLRI
Sbjct: 192 EEEFEDEYREGSEYEEEEDYNPYERKTAY---KDEEDEEVEWAEDTDRDTELNDFNKLRI 248

Query: 256 GRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTN 315
           GRSFVAKFCFYP F ++VKGCYGRVN+G DKRTG+TSYRMV+IER+FLQKPYSMGKF+TN
Sbjct: 249 GRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTN 308

Query: 316 QYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFV 375
           QYFGVTQGKDRKVFQM++FSDG     EY RY ++L++SH+ KP++++L +K+KE++ FV
Sbjct: 309 QYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFV 368

Query: 376 NTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRN 435
           + PLT+K T+E+VR+RM FNKKLSGTNAVLEKTVL+EKLQYA+ETNNE+D+AKYSAQLRN
Sbjct: 369 SEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRN 428

Query: 436 FEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSR 495
           FEKRM++YEKHHENDQ+  K LG LTSKN+K+NM  +RNAEHVKKED      KSDPFSR
Sbjct: 429 FEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP--IDKSDPFSR 486

Query: 496 LKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGE 555
           LKTRTK+YYQEIQKEEN +AK +AQQ+K++                QFRRLGGLE+MI  
Sbjct: 487 LKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISG 546

Query: 556 LDIKFDF 562
           L+I+FD 
Sbjct: 547 LNIEFDL 553

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/541 (54%), Positives = 371/541 (68%), Gaps = 11/541 (2%)

Query: 24  LTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPYSVGNAGYG----SEGEE 79
           + ++SAKR+  +D++ SKKRRIE                YNP + G AG G     E EE
Sbjct: 23  VLASSAKRSGKSDRASSKKRRIE--VEGGEDDEDEDEDDYNPAASG-AGTGDYDDEEEEE 79

Query: 80  ANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 139
            NPFPLEGK+KDE DR++L  LPEMERET+LFERSQIMQKYQ+RK+FR RG+++KEQQQR
Sbjct: 80  ENPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQR 139

Query: 140 AKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXXXXXX 199
           +K +E+            ATGHSDIKASKLSQL+KQR +K++                  
Sbjct: 140 SKQQEEGKKTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDDY 199

Query: 200 XXXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGRSF 259
                            P+ R+  +++                    ++D+NK +IGRSF
Sbjct: 200 GYEDKKYSDEEDEEEYDPYSRRSRFEE---DEDEVQWAEEALDREANVADFNKAKIGRSF 256

Query: 260 VAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFG 319
           VA FCFYPGF D+V+G YGRVN+GTDKR+G+T YRMV+IE+VFLQKPY+MGKF TNQYFG
Sbjct: 257 VANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFG 316

Query: 320 VTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPL 379
           VTQGKDRKVFQM YFSDG+    E+ RY  AL+  H+  PS++SL NK KE+  FV+ PL
Sbjct: 317 VTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPL 376

Query: 380 TDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKR 439
           T++ T+++VR+RM FNKKLSG NAVLEKTVL+EKLQYA ET NE+DIAKYS+QLR+FEKR
Sbjct: 377 TEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKR 436

Query: 440 MSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTR 499
           MS YEK HEND+  I  L  LT+KNR++N+  ++NAE VKKED S FDSKSDPFSRLKTR
Sbjct: 437 MSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTS-FDSKSDPFSRLKTR 495

Query: 500 TKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGELDIK 559
           TK YYQEIQKEEN KAK  A+Q++L+                +FRRLGGL+++IG +D +
Sbjct: 496 TKFYYQEIQKEENEKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQ 555

Query: 560 F 560
           F
Sbjct: 556 F 556

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/537 (54%), Positives = 366/537 (68%), Gaps = 15/537 (2%)

Query: 23  VLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPYSVG-NAGYGSEGEEAN 81
           V+ S+++KR ++N+ SVSKKR I V               YNP S G      ++ EE  
Sbjct: 23  VVISSTSKRGRSNEDSVSKKRHINVGE--------DDEDDYNPASAGLGDDDDNDDEEEA 74

Query: 82  PFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK 141
           PFPLEGK++DE DR++LESLPEMERETLLFERSQ+MQKY++R LFR R R +K Q++ ++
Sbjct: 75  PFPLEGKYRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRESSE 134

Query: 142 DKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXXXXXXXX 201
           +++              TGHSD+K+SKLSQLKKQR RKN  +                  
Sbjct: 135 NRK----VRSSTRSSKVTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDEDEYEEEENIYE 190

Query: 202 XXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGRSFVA 261
                          P+ RK  Y +                    ++D+NK++IGRSFVA
Sbjct: 191 DKYEEGSEYEDESYDPYKRKSTYAE--ESEEEDVKWADDTDRESNVNDFNKIKIGRSFVA 248

Query: 262 KFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGVT 321
           K+CFYPGF D+VK CYGRVN+G +K T +  YRMV+IE+VFLQKPYSMG F+TNQYFGVT
Sbjct: 249 KYCFYPGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQKPYSMGNFFTNQYFGVT 308

Query: 322 QGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLTD 381
           QGKDRKVFQM +FSDG+   DEY RY +AL++S++  PS ++LSNK KEV +FVN P+T 
Sbjct: 309 QGKDRKVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKEVDEFVNEPMTV 368

Query: 382 KTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMS 441
           K TDEVVR+RM FNKKLSGTNAVLEKTVLREKL +AK+ N+E+DIAKYS+QLRN EKR+ 
Sbjct: 369 KLTDEVVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYSSQLRNLEKRLM 428

Query: 442 IYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRTK 501
            YEKHHENDQ   K LG+LTSKNRKLNM  I+  E+VK++ + +FD K+DPFSRLKTRTK
Sbjct: 429 TYEKHHENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDESFDIKTDPFSRLKTRTK 488

Query: 502 VYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGELDI 558
           VYYQEIQ+EEN KAKE+A+Q+K+Q                +FRRLGGLE ++  LDI
Sbjct: 489 VYYQEIQEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGGLESIVHNLDI 545

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/551 (55%), Positives = 375/551 (68%), Gaps = 17/551 (3%)

Query: 23  VLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPYSVGNAGYGSEGEEANP 82
           VLT+T+ KR K +  S  KKRRIEV  +            Y P  V +     E EE NP
Sbjct: 22  VLTTTN-KRTKGSSNSQVKKRRIEV-DSEDEEDDYNPDDGYEPVDVSDKE--EEEEEENP 77

Query: 83  FPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKD 142
           FPLEGK+KD  DR+HLESLPEMERET+LFERSQ+M+KYQERKLFR RGR++K  QQ+ + 
Sbjct: 78  FPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKIQA 135

Query: 143 KEDXXXXXXXXXXXHATGHSDIKASKLSQLK-----KQRARKNRQYSXXXXXXXXXXXXX 197
            ED            ATGHSDIKASKLSQLK     K + R++  Y              
Sbjct: 136 GEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDEF 195

Query: 198 XX---XXXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXX-XXXXXISDYNKL 253
                                 P+ RK  Y +                     + D+NK+
Sbjct: 196 KDDFIEEDSDYKENDDDEEGYDPYARKSKYAQDNDEEEDEEVEWAEQLDRDAEVQDFNKI 255

Query: 254 RIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFY 313
           RIGRSFVAK+CFYPGF ++++GCYGRVN+G DKRTG  +YRMV+IE+VFLQKPY+MGKF+
Sbjct: 256 RIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFF 315

Query: 314 TNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMD 373
           TNQYFGVTQGKDRKVFQMN+FSDG F + E+ RY KALD+S++ KPS +++  K KE+ +
Sbjct: 316 TNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISE 375

Query: 374 FVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQL 433
           F++ PLT+K TDE+VR+RM  NKKLSGTNAVLEKT+L++KL+YAKE  NE DIAKYS QL
Sbjct: 376 FISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQL 435

Query: 434 RNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPF 493
           RNFEKRM++YEKHHENDQ+DIK L  LTSKNRKLNM+ IRNAE +KKE++ NFDSKSDPF
Sbjct: 436 RNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPF 495

Query: 494 SRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMI 553
           SRLKTRTKVYYQEIQKEEN KAKE A QE+L+                +FRRLGGL+++I
Sbjct: 496 SRLKTRTKVYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGGLQKII 555

Query: 554 GEL--DIKFDF 562
           G +  DIK D 
Sbjct: 556 GSINVDIKLDI 566

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/484 (54%), Positives = 348/484 (71%), Gaps = 2/484 (0%)

Query: 81  NPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA 140
           NPFPLEGK+KDE DR  LESLPEMERE+LLFERSQIMQ+YQER+  + R +++++QQQ+ 
Sbjct: 93  NPFPLEGKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKR 152

Query: 141 KDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXXXXXXX 200
           + +++            ATGHSD+K SKLS+LKKQRA+K+  Y                 
Sbjct: 153 QQQQEGKQVRSSTRTTRATGHSDVKTSKLSELKKQRAKKSGTYDYSEDEEGDGDDHKYDD 212

Query: 201 XXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGRSFV 260
                              RK+ +++                    ++D+NK++IGRSFV
Sbjct: 213 YYDEGGEDDDEDDYDPY-YRKNRHEEDDDDEEVKWAETEDFDRDTGLADFNKVKIGRSFV 271

Query: 261 AKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGV 320
           AKFCFYPGF ++V+  YGRVN+G DK TG+T+YRMV+IE+VFLQKPY+MGKF+TNQYFGV
Sbjct: 272 AKFCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGV 331

Query: 321 TQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLT 380
           TQGKDRKVFQMN+FSDG+    EY RY K+L+   + KPS+++L+NK+KE+ +FV+ P+T
Sbjct: 332 TQGKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSVYNLNNKSKEISEFVSQPMT 391

Query: 381 DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM 440
            K TD++VR+RM FNKKLSGTNAVLEKTVL+EKLQYAKET+NE+DIAKYS+QL+N EKR+
Sbjct: 392 SKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETSNERDIAKYSSQLKNLEKRI 451

Query: 441 SIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRT 500
           S YEKHHENDQ+ IK LG LTSKNRKLN+  I++AE V+K+D  NFD+KSDPFSRLKTRT
Sbjct: 452 SSYEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQKDD-VNFDAKSDPFSRLKTRT 510

Query: 501 KVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGELDIKF 560
           K+YY+E+Q++EN KAKE A+Q++L+                +FR LGGLE +IG +D++ 
Sbjct: 511 KIYYKEVQQQENEKAKEAARQKQLEEDKGTATRKENELLLAKFRSLGGLEEIIGGIDLQI 570

Query: 561 DFKF 564
           +   
Sbjct: 571 NVNL 574

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  515 bits (1326), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 263/463 (56%), Positives = 324/463 (69%), Gaps = 6/463 (1%)

Query: 104 MERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKDKEDXXXXXXXXXXXHATGHSD 163
           MERETLLFERSQ+MQKYQ+RKLFR R R++K QQ+     ++            ATGHSD
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 164 IKASKLSQLKKQRAR-KNRQYSXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXPFD 219
           +KASKLSQLK+QR + KNRQYS                                   P+ 
Sbjct: 61  VKASKLSQLKRQREKNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYDPYS 120

Query: 220 RKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGR 279
           RK  Y +                    + D+NK++IGRSFVA++CF+P F ++VKGCYGR
Sbjct: 121 RKPRY-REEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVKGCYGR 179

Query: 280 VNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSF 339
           VN+G D+RT +T+YRMV+IE+VFLQKPY+MGKF+TNQYFGVTQGKDRKVFQMN+FSDG  
Sbjct: 180 VNVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPI 239

Query: 340 ADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLS 399
             +E+ RY ++LD S+  KPS++SL+ K KE+ +FV+ P+TDK TDE+VR+RM FNKKLS
Sbjct: 240 TIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVFNKKLS 299

Query: 400 GTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGE 459
           GTNAVLEKTVLR KLQYAKE NNE+DIAKYS QLRN EKR+S YEKHHENDQ+  + LG 
Sbjct: 300 GTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGARKLGA 359

Query: 460 LTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIA 519
           LTSKNRK+NM   +N EHVK+ED  NFDSK+DPFSRLKTRTK+YYQE+QKEEN KAKE+A
Sbjct: 360 LTSKNRKVNMDKAKNVEHVKEED-INFDSKADPFSRLKTRTKIYYQEVQKEENEKAKELA 418

Query: 520 QQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGELDIKFDF 562
           QQ+KL+                +FRRLGGLE +I  +DI+   
Sbjct: 419 QQKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  513 bits (1320), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 284/550 (51%), Positives = 360/550 (65%), Gaps = 30/550 (5%)

Query: 27  TSAKRAKNNDQSVSKKRRI--------EVDSAXXXXXXXXXXXXYNP-----YSVGNAGY 73
           TS KR+K+ D S SKKRR+        E +              YNP     +  G+   
Sbjct: 27  TSQKRSKH-DSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNPGTEYGFDEGHEAS 85

Query: 74  GSEGEEANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDM 133
             E EE NP+PL GK++D+ DREH+E++PEMERETLLFERSQ MQKYQERK+ R R +++
Sbjct: 86  EDEVEEENPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERAKNI 145

Query: 134 KEQQQRAKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXX 193
           + QQQR + K D             TGHSD++ SKLS+L+KQRA+K+  Y          
Sbjct: 146 RAQQQRRQQK-DGSALRSSGRSTRTTGHSDLRDSKLSELRKQRAKKSGNYDYSAGEDDSD 204

Query: 194 XXXXXXXXXXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKL 253
                                  P D + LY                      + D+NK+
Sbjct: 205 HSDDYVDSDNEDDYD--------PHDGRQLY---REEADEVKWAEDDLDRDAELDDFNKI 253

Query: 254 RIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFY 313
           ++GRSFVAKFCFYP F   V+GCYGRVNIG DK TG+  YRMV+IE+VFLQKPY+MGKF+
Sbjct: 254 KVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFLQKPYNMGKFF 313

Query: 314 TNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMD 373
           TNQYFGVTQGKDRKVFQMN+FSDG     EY RY   +    + KPSL++L+NK K++ +
Sbjct: 314 TNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLNNKAKDLTN 373

Query: 374 FVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQL 433
           FV+ P+T K TD++VR+RMQFNKKL+GTNAVLEKTVLR+KLQYA++TNNEKDIAKYS+QL
Sbjct: 374 FVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIAKYSSQL 433

Query: 434 RNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPF 493
           +N EKRMS YEKHHENDQ+ I+ L  LTSKNRK+N+  IR+ E+VKKED++  + K+DPF
Sbjct: 434 KNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSATLNVKTDPF 493

Query: 494 SRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMI 553
           SRLKTRTK+YYQEIQ+EEN KA+E+A+Q+  Q                +FRRLGGLE  +
Sbjct: 494 SRLKTRTKIYYQEIQQEENEKAQELAKQK--QQQDKEEKHDRKQQLLAKFRRLGGLEDAL 551

Query: 554 GELD--IKFD 561
            +LD  IK D
Sbjct: 552 SKLDFRIKLD 561

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  510 bits (1313), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 278/539 (51%), Positives = 360/539 (66%), Gaps = 11/539 (2%)

Query: 28  SAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPY------SVGNAGYGSEGEEAN 81
           S KR++++ Q+ S KRRI VD              YNP       + G      E EE N
Sbjct: 30  SKKRSRSS-QNASNKRRI-VDEDEEIDEDDDDQDDYNPERGIYGDASGAEDEEDEEEEEN 87

Query: 82  PFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK 141
           PFPLEGK+KDE DRE+LESLPEMERETLLF+RSQ MQKY+ER++ + R R+++ QQQ+ +
Sbjct: 88  PFPLEGKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKRQ 147

Query: 142 DKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYSXXXXXXXXXXXXXXXXX 201
            +++             TGHSD+K S+LS+LKKQRA+K+  Y                  
Sbjct: 148 LQQESTKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKSGTYDYSEDEDDGGRDEEDDYG 207

Query: 202 XXXXXXXXXXXXXXXPFDRKDLYDKRXXXXXXXXXXXXXXXXXXXISDYNKLRIGRSFVA 261
                          P  +KD  D+                    +SD+NK++IGRSFVA
Sbjct: 208 YDDQDEEEESEDDYQPGYKKDKIDE--DDEEVKWAEEDDLDRDPELSDFNKVKIGRSFVA 265

Query: 262 KFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGVT 321
           KFCFYP F D+++GCYGRVN+G DKR  +T YRMV+IERVFLQKPY+MGKF+TNQYFGVT
Sbjct: 266 KFCFYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFLQKPYNMGKFFTNQYFGVT 325

Query: 322 QGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLTD 381
           QGKDRKVFQMN+FSDG+    E+ RY K+LD S +  PSL++L+NK+ E+  FV+ P+T 
Sbjct: 326 QGKDRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNKSNEINGFVSQPVTP 385

Query: 382 KTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMS 441
           K TDE+VR+RM FNKKLSGTNAVLEKT+LR+KLQYAKET +E+D+AKYS+QLR+ E+R++
Sbjct: 386 KLTDELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVAKYSSQLRSLERRLT 445

Query: 442 IYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRTK 501
            YEKHHENDQ+  K LG LTS+NR+ NM   +N +  KKED + FD+K+DPFSRLKTRTK
Sbjct: 446 SYEKHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKED-TPFDAKTDPFSRLKTRTK 504

Query: 502 VYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRLGGLERMIGELDIKF 560
           +YYQEIQKEEN KAKE+A+ E+L+                +F+ LGGLE ++  +D K 
Sbjct: 505 IYYQEIQKEENEKAKELARIEQLEKGNSDLAEKERKLLLARFKNLGGLEEVVSGIDFKL 563

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  440 bits (1131), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 200/316 (63%), Positives = 255/316 (80%), Gaps = 1/316 (0%)

Query: 247 ISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKP 306
           + D+NK++IGRSFVAK+CFYPGF +++KGCYG+VN+GTD+RTG TSYRMV+IE++FLQKP
Sbjct: 242 LDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKP 301

Query: 307 YSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSN 366
           Y MG+F+TNQYFGVTQG +RKVFQMN+FSDG F  DE+ RY ++LD SH+ KPS+++L N
Sbjct: 302 YRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKN 361

Query: 367 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 426
           K KE+  F++ PLT++  D +VR+RM FNKKLSGTNAVLEKTVLR+KL+YA+E NNE+D+
Sbjct: 362 KAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDV 421

Query: 427 AKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNF 486
           AKYS+QLRN EKR+S+YEKHHENDQ     LG LTSKNRK+NM  I+N  H KKE+   F
Sbjct: 422 AKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEE-IGF 480

Query: 487 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRL 546
           DSKSDPFSRLKTRTK+YYQE+Q+EEN KAK +A +++L+                +FRRL
Sbjct: 481 DSKSDPFSRLKTRTKIYYQEVQQEENEKAKALAAEKQLKENNEAQARKENELLLAKFRRL 540

Query: 547 GGLERMIGELDIKFDF 562
           GGLE MI  L++  +F
Sbjct: 541 GGLENMINSLNLDVNF 556

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  430 bits (1105), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 203/318 (63%), Positives = 249/318 (78%)

Query: 247 ISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKP 306
           + D+NK++IGRSFVAKFCFYP F + V+ CYGRVNIG DK TG   YRMV+IERVFLQKP
Sbjct: 245 LEDFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHTGLPMYRMVKIERVFLQKP 304

Query: 307 YSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSN 366
           YSMGKF+TNQYFGVTQGKDRKVFQMNYFSDG     E+ RY   +    M KPSL++L+N
Sbjct: 305 YSMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYLNQMAKYDMNKPSLYTLNN 364

Query: 367 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 426
           K KE+ +FV+ P+T K TD++VR+RM FNKKL+GTNAVLEK+VL++KLQYAK+TNNE  +
Sbjct: 365 KAKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAKDTNNESAV 424

Query: 427 AKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNF 486
           AKY+AQL+N EKRMS YEKHHENDQ+ I+ LG LTSKNRK+NM  IR AE+V+KED+SN 
Sbjct: 425 AKYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVNMDKIRLAENVRKEDSSNV 484

Query: 487 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRL 546
           D+KSDPFSRLKTRTK+YYQEIQ+EEN KA E+A+Q+  +                +FRRL
Sbjct: 485 DAKSDPFSRLKTRTKIYYQEIQQEENEKAMELAKQKHQEQDKETQENKERQLLLAKFRRL 544

Query: 547 GGLERMIGELDIKFDFKF 564
           GGLE ++  +  K +  F
Sbjct: 545 GGLEEIVSSIPFKIELGF 562

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 85/126 (67%), Gaps = 6/126 (4%)

Query: 63  YNP-----YSVGNAGYGSEGEEANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIM 117
           YNP     +   + G G E EE NP+PLEGK+KDE DR  ++ +PEMERETLLFERSQ M
Sbjct: 67  YNPGTQYDFEGNDDGSGDEQEERNPYPLEGKYKDEEDRNRIQDMPEMERETLLFERSQEM 126

Query: 118 QKYQERKLFRARGRDMKEQQQRAKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRA 177
           QKYQERK+ R R + ++ QQQ+ + ++D             TGHS+++ SKLS+L+KQRA
Sbjct: 127 QKYQERKVLRQRAKSIRAQQQQRQLQKD-STKRSSGRSTRTTGHSELRTSKLSELRKQRA 185

Query: 178 RKNRQY 183
           +K+  Y
Sbjct: 186 KKSGNY 191

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  424 bits (1089), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/316 (62%), Positives = 254/316 (80%), Gaps = 1/316 (0%)

Query: 247 ISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKP 306
           + D+N+++IGRSFVAKFCFYP F D++KGCYGRVN+G DKR+G+T YRMV+IE+VFLQKP
Sbjct: 245 LGDFNRIKIGRSFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKP 304

Query: 307 YSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSN 366
           Y+MGKF+TNQYFGVTQGK+RKVFQMN+FSDG+    E+ RY ++L+ S + KPSL+ ++N
Sbjct: 305 YNMGKFFTNQYFGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINN 364

Query: 367 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 426
           K+ E+  FV+ P+T K TDE+VR+RM FNKKLSGTNAVLEKT+L++KLQYAKE+ +E+D+
Sbjct: 365 KSNEINSFVSQPVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDV 424

Query: 427 AKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNF 486
           AKYS+QLRN EKR+S YEKHHENDQ+  K LG LTSKNR++N+   +N E  KKED + F
Sbjct: 425 AKYSSQLRNLEKRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKED-TPF 483

Query: 487 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRRL 546
           D+K+DPFSRLKTRTK+YYQEIQ+EEN KAKE+A+QE+LQ                +F+ L
Sbjct: 484 DAKTDPFSRLKTRTKIYYQEIQREENEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNL 543

Query: 547 GGLERMIGELDIKFDF 562
           GGLE +I  +D +   
Sbjct: 544 GGLEDIISNMDFQVSL 559

 Score =  117 bits (294), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 103/163 (63%), Gaps = 2/163 (1%)

Query: 23  VLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNP--YSVGNAGYGSEGEEA 80
           V   +S KR++++ QS SK+R ++ D              YNP   S        E EE 
Sbjct: 24  VQIGSSKKRSRSDHQSSSKRRIVDEDEEQDDDEEEGEEDDYNPEAASYDMDSEEDEDEEP 83

Query: 81  NPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA 140
           NPFPLEGK+K+E DR +LESLPEMERET+LFERSQ MQKYQER++ + R +++++QQQ+ 
Sbjct: 84  NPFPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKR 143

Query: 141 KDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQY 183
           + +++             TGHSD+K S+LS+LKKQRA+K   Y
Sbjct: 144 QLQQEGKKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKKGTY 186

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  403 bits (1036), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 194/315 (61%), Positives = 245/315 (77%), Gaps = 2/315 (0%)

Query: 247 ISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKP 306
           + DYNK++IGRSFVAKFCFYP F  +V+GCYGRVNIG DK TG + YRMV+IERVFLQKP
Sbjct: 265 LDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVFLQKP 324

Query: 307 YSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSN 366
           Y+MGKF+TNQYFGVTQGKDRK+FQM+YFSD      EY RY  +L+   + +PS + L+N
Sbjct: 325 YNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPYILNN 384

Query: 367 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 426
           K+K V +FV  PLT K  D++VR+RM FNKKLSGTNAV+EK VL+EKLQ++K++ + +  
Sbjct: 385 KSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGDIESE 444

Query: 427 AKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSN- 485
           +KY+ QL+  EKR+S YEKHHENDQ+DIKTLG LTSKNRKLN+  IR+AE +K+E+  N 
Sbjct: 445 SKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREEGVNK 504

Query: 486 FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRR 545
            D+KSDPFSRLKTRTK+YYQEIQ+EEN KA+E A+++ L+                +FRR
Sbjct: 505 VDAKSDPFSRLKTRTKIYYQEIQQEENEKAREEAKRQ-LEVDQEAEEQKKKELLLAKFRR 563

Query: 546 LGGLERMIGELDIKF 560
           LGGLE +IG LD+K 
Sbjct: 564 LGGLEEIIGSLDLKL 578

 Score =  117 bits (292), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/102 (59%), Positives = 72/102 (70%), Gaps = 2/102 (1%)

Query: 82  PFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK 141
           PFPLEGK+KDE DRE LE LPEMERE++LFERSQ MQKYQERKL R   + +K+QQQ   
Sbjct: 89  PFPLEGKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQ- 147

Query: 142 DKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQY 183
            +E              TGHSD+K SKLS+LKKQRA+K+  Y
Sbjct: 148 -REGSKSTRASTRSSRTTGHSDLKQSKLSELKKQRAKKSGNY 188

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  399 bits (1025), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 188/317 (59%), Positives = 242/317 (76%), Gaps = 4/317 (1%)

Query: 247 ISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQK- 305
           + D+NK++IGRSF  KFCFYP F D+VK CY +VN+  D+   K  YRMV+IE+VFL K 
Sbjct: 255 VQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVFLDKR 312

Query: 306 PYSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLS 365
           P+ MGKF+TNQ FGVTQG +RKV+ M YFSD      E+ RY + L++ H+ +PS+++++
Sbjct: 313 PHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAIN 372

Query: 366 NKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKD 425
           NK KE+  F   PLTDK TD++VR+RM+FNKKLSGTNAVLEKTVLR KLQ+AKET NE+D
Sbjct: 373 NKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERD 432

Query: 426 IAKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSN 485
           + KYSAQLRN EKR+S+YEKHHENDQ+  K LG+LTS+NRKLNM   RN EH KK + + 
Sbjct: 433 VTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-KKVELAG 491

Query: 486 FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQXXXXXXXXXXXXXXXXQFRR 545
           FD+K+DPFSRLKTRTK+YYQEIQKEEN KA+E+A +++L+                +F+ 
Sbjct: 492 FDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAEFKC 551

Query: 546 LGGLERMIGELDIKFDF 562
           LGGLE+M+G L+ KFDF
Sbjct: 552 LGGLEKMVGSLNFKFDF 568

 Score =  130 bits (327), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 102/169 (60%), Gaps = 16/169 (9%)

Query: 23  VLTSTSAKRAKNNDQSVSKKRRIEVDSAXXXXXXXXXXXXYNPY-------SVGNAGYGS 75
            L  +S KRA+NND S SK+R+IEVD+             YNP        S  N   G 
Sbjct: 22  TLMVSSKKRARNNDSS-SKRRKIEVDNEDEEEEDD-----YNPVFNEDNNQSTYNTMDG- 74

Query: 76  EGEEANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKE 135
           E EE NPFPLEGK+KDE+DRE +ES+PEMERETLLFERSQIMQKYQERK+FR R R  K+
Sbjct: 75  EREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQ 132

Query: 136 QQQRAKDKEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRQYS 184
                                H TG SD K+SKLSQLK+QR R+N+  S
Sbjct: 133 MSLNNNSNLTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRNKGQS 181

>Skud_14.111 Chr14 complement(211532..213280) [1749 bp, 582 aa] {ON}
           YNL225C (REAL)
          Length = 582

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 366 NKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKT--VLREKLQYAKETNNE 423
           N T E+ D  N     KT  + +R R   N  L GTN  L K    L EK  + K +N+E
Sbjct: 325 NATSEINDLRNELENKKTEIQTMRER---NNNLLGTNKTLSKQNKALCEK--FDKLSNDE 379

Query: 424 KDIAK-----YSAQLRNFEKRMSIYEKHHENDQSDIK 455
           K+I K        +L +  +R+  +EK  EN ++ +K
Sbjct: 380 KNILKGCNEEIKIKLESLNERLGSWEKSKENYEASLK 416

>Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {ON}
           YNL225C (REAL)
          Length = 581

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 20/109 (18%)

Query: 382 KTTDEVVRHRMQFNKKLSGTNAVLEKT--VLREKLQYAKETNNEKDIAK-----YSAQLR 434
           K+  +V+R R   N  L GTN  L K   VL +K  + K +N+EK++ K       A+L 
Sbjct: 340 KSEIQVIRER---NNNLLGTNKTLSKQNKVLCDK--FEKLSNDEKEMLKGCNEEIKAKLE 394

Query: 435 NFEKRMSIYEKHHENDQSDIK----TLGELTSKNRKLNMSNIRNAEHVK 479
           +  +R+  +EK  EN ++ +K    T+GE   K   ++    R   H+K
Sbjct: 395 SLNERLGSWEKSKENYEAALKDKDQTIGEFEKKANSMS----REINHLK 439

>Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON}
           (144394..145599) [1206 nt, 402 aa]
          Length = 401

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 373 DFVNTPLTDKT--TDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYS 430
           + ++  LT++T   DE+V+ R    KK++    + E   LREKL Y  E N  +    Y 
Sbjct: 77  ELISDVLTEQTRQADELVKQRKLLEKKVAELKQMPESGSLREKLAYTFEYNTARKFPAYI 136

Query: 431 AQ 432
            Q
Sbjct: 137 WQ 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,959,046
Number of extensions: 2114632
Number of successful extensions: 11640
Number of sequences better than 10.0: 285
Number of HSP's gapped: 12227
Number of HSP's successfully gapped: 316
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 68 (30.8 bits)