Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_7.223.569ON70870836610.0
YGL245W (GUS1)3.569ON70870835310.0
Smik_7.163.569ON70870835170.0
Suva_7.163.569ON70870834920.0
NCAS0E002503.569ON70870832520.0
NDAI0I032503.569ON70970631650.0
KAFR0J028903.569ON70670831570.0
TDEL0D063703.569ON70670630680.0
KNAG0I002203.569ON70770630630.0
Kpol_507.83.569ON70770830370.0
CAGL0C01947g3.569ON70570930110.0
TPHA0A060203.569ON70770829770.0
SAKL0F00748g3.569ON70770829710.0
KLLA0A00682g3.569ON70870929550.0
Kwal_47.192723.569ON70470629360.0
AFR264W3.569ON70770829150.0
ZYRO0E09570g3.569ON70670428920.0
TBLA0E001903.569ON70770828720.0
KLTH0G00682g3.569ON70470628510.0
ZYRO0C07018g6.51ON8034416012e-66
KNAG0M011006.51ON7994385811e-63
YOR168W (GLN4)6.51ON8093735783e-63
KAFR0G026106.51ON7943825712e-62
TDEL0G041906.51ON8094985713e-62
Smik_15.3486.51ON8104255696e-62
Kwal_56.225596.51ON8003765651e-61
SAKL0E02134g6.51ON8013735633e-61
NCAS0F002406.51ON8114435617e-61
TBLA0G004506.51ON8083735617e-61
Skud_15.3326.51ON8093735609e-61
Kpol_1037.386.51ON8084545581e-60
NDAI0K028606.51ON8143825581e-60
KLTH0C10340g6.51ON8004925572e-60
CAGL0L04532g6.51ON7953765521e-59
AGR259C6.51ON7983855502e-59
Suva_8.2236.51ON8213735502e-59
TPHA0J005506.51ON8084475475e-59
Ecym_31356.51ON8043855395e-58
KLLA0F20449g6.51ON8043765282e-56
KNAG0L006207.100ON5172321957e-15
NCAS0I005607.100ON5272181752e-12
NDAI0A084607.100ON5292621734e-12
TBLA0E021807.100ON5312381582e-10
TPHA0L005907.100ON5582751564e-10
YOL033W (MSE1)7.100ON5362201555e-10
Kpol_1044.127.100ON5362281547e-10
CAGL0F01133g7.100ON5321501548e-10
KAFR0D013207.100ON5142261493e-09
Ecym_26267.100ON5732191467e-09
Suva_15.1347.100ON5353481458e-09
Skud_15.1227.100ON5323231412e-08
TDEL0H035007.100ON5342281377e-08
KLLA0F07975g7.100ON5422761333e-07
AEL338C7.100ON5332211314e-07
Smik_15.1327.100ON5352221305e-07
KLTH0D02794g7.100ON5462261271e-06
SAKL0B09548g7.100ON5542401252e-06
ZYRO0D05808g7.100ON5331151252e-06
Kwal_26.72027.100ON5672231243e-06
Smik_12.4694.236ON89565800.53
KNAG0A028608.350ON619130761.5
Ecym_61644.116ON298141751.6
Kwal_26.75522.425ON46184751.9
Skud_4.6905.519ON85531743.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_7.22
         (708 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1414   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1364   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1359   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1349   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1257   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1223   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1220   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1186   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1184   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1174   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1164   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1151   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1149   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1142   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1135   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1127   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1118   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1110   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1102   0.0  
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   236   2e-66
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   228   1e-63
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   227   3e-63
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   224   2e-62
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   224   3e-62
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   223   6e-62
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   222   1e-61
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   221   3e-61
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   220   7e-61
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   220   7e-61
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   220   9e-61
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   219   1e-60
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   219   1e-60
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   219   2e-60
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   217   1e-59
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   216   2e-59
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   216   2e-59
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   215   5e-59
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   212   5e-58
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   207   2e-56
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    80   7e-15
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    72   2e-12
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    71   4e-12
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    65   2e-10
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    65   4e-10
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    64   5e-10
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    64   7e-10
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    64   8e-10
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    62   3e-09
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    61   7e-09
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    60   8e-09
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    59   2e-08
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    57   7e-08
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    56   3e-07
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    55   4e-07
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    55   5e-07
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    54   1e-06
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    53   2e-06
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    53   2e-06
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    52   3e-06
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    35   0.53 
KNAG0A02860 Chr1 complement(340606..342465) [1860 bp, 619 aa] {O...    34   1.5  
Ecym_6164 Chr6 complement(301696..302592) [897 bp, 298 aa] {ON} ...    33   1.6  
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    33   1.9  
Skud_4.690 Chr4 (1220089..1222656) [2568 bp, 855 aa] {ON} YDR416...    33   3.1  

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1414 bits (3661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/708 (97%), Positives = 687/708 (97%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFV             TEGVFNKIT
Sbjct: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKIT 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
           GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV
Sbjct: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG
Sbjct: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1364 bits (3531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/708 (92%), Positives = 680/708 (96%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           MPSTLT+NGKAP VAYAELIAARIVNALAPNSIAI+ V             TE VFNKIT
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
            KFAAIFDNGDKEQV++W +LA+KELV+KNFAKLSQSLETLDSQLN+RTFILGGLKYSAA
Sbjct: 61  SKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFL+KSL ELKKSANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDLDLLGIKGD+ITYSSDYFQEM+DYCVQMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERMDG+ASARR+RSVEENLR+FTEEMKNGTEEGLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRN QYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEG+EAPQEPK+EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKH 540

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNPAVGEKK+IYYKDIVVD++DADVINVDEEVTLMDWGNVIITKKNDDGSMVAKL+LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMK+GDIIQFERKGYYRLDALPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1359 bits (3517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/708 (91%), Positives = 679/708 (95%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           MPSTLT+NGKAP VAYAELIAARIVNALAPNSIAI FV             TE VF+KIT
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
           GKFAAIFDNGDKEQ+++W DLA+KELVVKNFAKLSQSLE LDSQLN+RTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFL+KSLQELKKSANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEM+DYC+QMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERMDGIAS+RR+RSVEENLR+FTEEMKNGTEEGLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKK+IDPIAPRHTAIVNPVKIHLEG+EAPQEPK E KPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKH 540

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNPAVGEKK+IYYKDIVVD++DADVINVDEE+TLMDWGNVIITKKN+DGSM+AKL+LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMK+GDIIQFERKGYYRLDALPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1349 bits (3492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/708 (90%), Positives = 678/708 (95%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           MPSTLT+NGKAP+VAYAELIAARIVNALAPNSIA++FV             TE VFNKIT
Sbjct: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
           GKFAAIFDNG KE+V++W  LA++ELVVKNF KLSQSLETLD+QLN+RTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAH+FLTKSLQE+KK+ANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQEM+DYCVQMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERMDGIASARR+RSVEENLR+FTEEMKNGTE GLKNCVRAKIDYEALNKTLRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDK+LVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTA+VNPVKIHLEG EAPQEPK+EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNPAVGEKK+IYYKDIVVD++DADVI+VDEEVTLMDWGNV+ITKKN DGSMVAKLHLEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADTKD+VPVDLVDFDHL+TKD+LEEDESFEDFLTP+TEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMKVGDI+QFERKGY+RLDALPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1257 bits (3252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/708 (83%), Positives = 647/708 (91%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           M +TL +NGKAP VAYAELIAARIVN   PNSI+I+FV              +  F KI 
Sbjct: 1   MSATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIV 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
            +F+ +F N  +E +++W  +A +ELV+KNF KLS+SL  LD+ LN+RTFILGGLKYSAA
Sbjct: 61  AQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           D+ACWGALRSNGMCGSIIKNKV+VNVSRWYTLLEMDPIFG  H+FLTKSLQELKK+AN G
Sbjct: 121 DIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDL+LLGIKGD+IT+SSDYFQEM+DYC+QMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERMDGIASARR+RSVEENL++FTEEMKNGTEEGLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WMLQAL L
Sbjct: 361 IYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTAIVNPVKIHLEG + PQ PK+EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKH 540

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNPAVGEKK+IY+KDIV+D++DAD++  +EEVT+MDWGNVIIT+KN DGS+V KLHLEG
Sbjct: 541 KKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADT DVVPVDLVDFDHLITKD+LEEDESFEDFLTP TEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLN 660

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMKVGDIIQFERKGYYRLDALPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1223 bits (3165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/706 (81%), Positives = 633/706 (89%)

Query: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKITGK 62
           +TL +NGKAP VAY +LIAARI+N   P SI IQFV             ++  F KI   
Sbjct: 4   NTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEG 63

Query: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122
           F  IF   +K+ V+ WT +A +ELVVKNF KLS+SL  LD+QLN+RTFILGGLKYSAAD+
Sbjct: 64  FPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADI 123

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182
           ACWGALRSNGMCGSI+KNKVDVNVSRWY+LLEMDP FG  H+ LTKSLQELKK +N GKK
Sbjct: 124 ACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKK 183

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFDD
Sbjct: 184 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 243

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302
           TNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQ+M++ CV+MIK+GKAYCDDTPTE+
Sbjct: 244 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEK 303

Query: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDGIASARR+RSVEENLR+F EEMKNGTEEGLKNCVRAKIDY+ALNKTLRDPVIY
Sbjct: 304 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 363

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422
           RCNLTPHHRTG+TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWML A+ LRK
Sbjct: 364 RCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 483

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+A RHTAIV+PVKIHLEG + PQ PK EMKPKHKK
Sbjct: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKK 543

Query: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602
           NPAVGEKK+IYYKDIV+D+ DAD+I  +EEVT+MDWGNVIITKKN DGSMV KLHL+GDF
Sbjct: 544 NPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDF 603

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTKHKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP TEFHT AIADLNVK
Sbjct: 604 KKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVK 663

Query: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           DMKVGDIIQFERKGYYRLDA+ K+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 664 DMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1220 bits (3157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/708 (81%), Positives = 635/708 (89%), Gaps = 2/708 (0%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           M +TL +NGKAP VAY  LIAAR+VNA  P++I I+FV             +EG FNKI 
Sbjct: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
             F   F N +    S W ++A +E +VKNF KL+QSLE LD+ LN+RTFI GGL+YSAA
Sbjct: 61  AAFPDAFRNAN--VASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           D+A WGALRSNGM GSIIKNKV VNVSRWY+LLEMDP+FG  H+FLTKSLQELKK+A+ G
Sbjct: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQDSILEDL+LLGIKGD++TYSSDYFQEM+D CVQ+IK+G AYCDDTPT
Sbjct: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERMDGIASARR+R+VEENLR+FTEEMKNGTEEGLKNCVRAKIDY ALNKTLRDPV
Sbjct: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 478

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWN+IWAFNKKVIDP+APRHTA+VNPVKIHL G +AP+ PK+EMKPKH
Sbjct: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNPAVGEKK+IYYKDIVVD+EDADVI V+EEVTLMDWGN+IITKKN DGSM AK+HLEG
Sbjct: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKT HKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLN
Sbjct: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VK+MKVGD+IQFERKGY+RLD+LPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1186 bits (3068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/706 (79%), Positives = 626/706 (88%), Gaps = 1/706 (0%)

Query: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKITGK 62
           + L +NGKAP VAYAELIAAR+VN + P SI ++FV             +EGVF KI   
Sbjct: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61

Query: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122
           F  IF  G  E+++ W   A  + V+KNF KLS SLE LD+ LN+RT+ILGGLKYSAAD+
Sbjct: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182
           ACWGALRSNGM GSIIKNKVDVNVSRWYTLLE D  FG AH+FLTKS+Q+LKK++NVGKK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KE HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302
           TNPSKEKEEFQDSI+EDL LLGI+GD++T+SSDYFQEM+D CV+MIK+GKAYCDDT TE+
Sbjct: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301

Query: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDGIASARR+R VEENLR+FT+EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422
           RCNLTPHHRTG+T K YPTYDFCVP+VDAIEGVTHALRTIEYRDRN QYDWML A+ LRK
Sbjct: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+APR TA+VNPVK+HL+G +APQ PK EMKPKHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540

Query: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602
           NP VGEKK+I+YKD+V+D++DADV+  +EEVTLMDWGNVIITKKN DGS+  KL+L+GDF
Sbjct: 541 NPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTKHKLTWLADT+DV PVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLNVK
Sbjct: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           D+KVGDIIQFERKGYYRLDAL K+GKPYVFFTIPDGKSVNRYGAKK
Sbjct: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1184 bits (3063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/706 (78%), Positives = 619/706 (87%), Gaps = 2/706 (0%)

Query: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKITGK 62
           +TL +NGKAP VAY  LIAARI N+   +S+AI+FV             +E V +KI  +
Sbjct: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63

Query: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122
           F  +F   +   V+ W   A  E VVKNFAKL++SL  LD+ LN+RTF+LGGLKYS AD+
Sbjct: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182
           ACWGALRSNGM GSIIKNKV VNVSRWYTL EM P F  AH+FLTKS+QELKK++  GKK
Sbjct: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KE+HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD
Sbjct: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302
           TNPSKEKEEFQDSILEDL LLGIKGD++TYSSDYFQ+M+D C+Q+IK+G AYCDDTPTE+
Sbjct: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303

Query: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDGIASARR+RSVEENL++FTEEMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422
           RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN+QYDWML AL LRK
Sbjct: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNFVLS 483

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+V+PVK+H+EG  AP+ PK EMKPKHKK
Sbjct: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541

Query: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602
           NPAVGEKK+I+Y+++V+D+EDA  +  DEEVTLMDWGNVIITK++ DGS+  KLHLEGDF
Sbjct: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTKHKLTWLADT+DVVPVDLVDFDHLI KDRLEE ESFEDFLTPQTEF T AIADLNVK
Sbjct: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661

Query: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
            MKVGDIIQFERKGYYRLD+LPK+GKPY+FFTIPDGKSVNRYGAKK
Sbjct: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1174 bits (3037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/708 (78%), Positives = 623/708 (87%), Gaps = 1/708 (0%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           M +TL + GKAP VAYAELIAARIVN+  P+SI I+FV             +  V +KI 
Sbjct: 1   MSATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIV 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
              + +F  G     + W  +A +ELVVKNF +L++SLE LD+ LN+RT+I GGL ++ A
Sbjct: 61  TANSDVFPEGAANS-TEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           D+ACWGALRSNGM GSIIKNKV+VNVSRWYTLLE + +FG  H+FLTKSLQELKK++  G
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAG 179

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKE  EFQDSILEDL+LLGIKGD+IT+SSDYFQEM+DYCVQ+IKDGKAYCDDTPT
Sbjct: 240 DDTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPT 299

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           E+MR+ERM+GIAS RR+RSVEENL++FTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV
Sbjct: 300 EKMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           I+RCNLTPHHRTGS WK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL+L
Sbjct: 360 IFRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NW+DPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIW+FNKKVIDP+ PR TA+V+PVKIHLEG +APQ  KVEMKPKH
Sbjct: 480 LSQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKH 539

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
            KNP VGEKK+++YKDIV+DREDAD I   EE+TLM+WGN IITKKN DGS+ AKLHLEG
Sbjct: 540 PKNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHK+TWLADT+DVV VDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLN
Sbjct: 600 DFKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 659

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMKVGDIIQFERKGYYRLD+L  +GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 660 VKDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/709 (79%), Positives = 623/709 (87%), Gaps = 5/709 (0%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVN-ALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKI 59
           M STL +NGKAP VAYAELIAAR+VN + +  S+ ++FV             ++     I
Sbjct: 1   MSSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAI 60

Query: 60  TGKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSA 119
             KF  I   G  E+   W  LA +ELV+KNF KL+QSLE LD+QLN RT+I GGLK+ +
Sbjct: 61  VAKFPEIL--GANEESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDS 118

Query: 120 ADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANV 179
           AD+ACWGALRSNGM GSIIKNKV VNVSRWY LLE +P FG++H+FLTKSLQELKK+AN 
Sbjct: 119 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANA 178

Query: 180 GKKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 239
           GKKKE+HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR
Sbjct: 179 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 238

Query: 240 FDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTP 299
           FDDTNPSKEK EFQDSILEDL+LLGIKGD+ITYSSDYFQEM++ CV++IK+GKAYCDDTP
Sbjct: 239 FDDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTP 298

Query: 300 TERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDP 359
           TE+MREERMDGIASARR RSVEENL++FTE+MKNGTEEGLKNCVRAKIDY ALNKTLRDP
Sbjct: 299 TEKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDP 358

Query: 360 VIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALR 419
           VIYRCNLTPHHRTGS WK+YPTYDFCVPIVD+IEGVTHALRTIEYRDRN QYDW L  L 
Sbjct: 359 VIYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLN 418

Query: 420 LRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNF 479
           LRKVHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNF
Sbjct: 419 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 478

Query: 480 VLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPK 539
           VLSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTAIVNPVKIH+EG  AP+ PK EMKPK
Sbjct: 479 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKPK 536

Query: 540 HKKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLE 599
           HKKNPAVGEKK+IYY+++V+D+EDAD I  +EEVTLMDWGN+IITKKN DGSM AKLHLE
Sbjct: 537 HKKNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLE 596

Query: 600 GDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADL 659
           GDFKKTKHKLTWLADT D V VDLVDFDHLI+KD+LEEDESFEDFLTPQTEFHT+AIADL
Sbjct: 597 GDFKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADL 656

Query: 660 NVKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           NVKDM VGDIIQFERKGYYRLDA  K+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 657 NVKDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1151 bits (2977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/708 (77%), Positives = 622/708 (87%), Gaps = 1/708 (0%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           MP+TL + GK+  VAY+ELIAARIVN++ P+SI I+FV             T+ V +KI 
Sbjct: 1   MPATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIV 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
              A +F  G       W  LA  ELV+KNF KL+ SL+ LD+ LN+RTFI GGL YS A
Sbjct: 61  SANADVFPEGVTGS-EEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           D+ACWGALRSNGM GSIIKNKV+VNVSRWYTL E +PIFGEA++FLTKSLQELKK+++ G
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAG 179

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFA AYKGKLIIRF
Sbjct: 180 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQ+SILEDL LLGIKGD+IT+SSDYFQEM+DYC+Q+IK+GKAYCDDTP 
Sbjct: 240 DDTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPV 299

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           ++MREERMDGIASARRNRSVEENL++FTEEM+NGTEEGL+NCVRAKIDYEALNKTLRDPV
Sbjct: 300 DKMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           IYRCNL PHHRTG+ WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WML A+ L
Sbjct: 360 IYRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MT+EGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           +SQGPSRNVINLEWNLIWAFNKKVIDP+APR T ++NP+KIHL G +AP+ P+VEMKPKH
Sbjct: 480 ISQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKH 539

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
            KNPAVGEK++I+ KDIV+D++DADVI   EE+TLM+WGN II KKN DGS+ A LHLEG
Sbjct: 540 PKNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHK+TWLA+T+DV  VDLVDFDHLITKD+LEEDESFE+FLTP TEFHTDAIAD+N
Sbjct: 600 DFKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVN 659

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMKVGDIIQFERKGYYRLDALPK+GKPY+FFTIPDGK+VN+YGAKK
Sbjct: 660 VKDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1149 bits (2971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/708 (77%), Positives = 617/708 (87%), Gaps = 1/708 (0%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           M + L +NGKAP VAYAELIAARIVNA   ++I I+FV              +  F+KI 
Sbjct: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
             +  +F  G  +  S W+ LA +E ++KNF KLS SL  LDS+LN+RT+IL     + A
Sbjct: 61  NAYQDVFSEG-VQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           D+ACWGALRSNGM GSIIKNKV VNVSRWYT+LE+DP+F  AH+FLTKSLQELKK++N  
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEI LPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQDSILEDLDLLGIKGDKITYSSDYF+EM+  CVQ+IK+GKAYCDDTPT
Sbjct: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERMDGIASARR+RSVEENLR+F EEMKNGTEEGLKNCVRAKIDY+ALNK LRDPV
Sbjct: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           I+RCNLTPHHRTG+TWK+YPTYDFCVPIVDAIEGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK  V NWDDPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+V PVK+HLEG + PQ PK+EMK KH
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNP VGEKK+IYYKD+++D+EDADV++  EE+TLMDWGNVIITKKN DGS+V KLHLEG
Sbjct: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTK KLTWLADT+D V VDLVDFDHLI+KD+LEE ++FEDFLTP+TEFHT AIADLN
Sbjct: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMKVGD+IQFERKGYYRLD+L K+GKPYVFFTIPDGK+VN+YGAKK
Sbjct: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/709 (76%), Positives = 609/709 (85%), Gaps = 2/709 (0%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNAL-APNSIAIQFVXXXXXXXXXXXXXTEGVFNKI 59
           M ++L +  KAP +AY ELIAAR VNA    N+I I FV             TE V  K+
Sbjct: 1   MSASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKL 60

Query: 60  TGKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSA 119
           +  +  I  N + +  + W +   K+LV+KNF +L++SL  L++ LN+RT+IL  L+ S 
Sbjct: 61  SAAYPDIL-NDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSL 119

Query: 120 ADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANV 179
           AD+A WG LRSNGM GSIIKNKV +NVSRWY+  E+ P FG+AH+FLTKSLQELKK++NV
Sbjct: 120 ADIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNV 179

Query: 180 GKKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 239
            KKKETHKANFEI LPDAKVG+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR
Sbjct: 180 NKKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 239

Query: 240 FDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTP 299
           FDDTNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQEM+DYCVQMIK+GKAYCDDTP
Sbjct: 240 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTP 299

Query: 300 TERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDP 359
           TERMREER +GI S+RR R+VEENL++FTEEMKNGTEEGLKNCVRAKIDYEALNK +RDP
Sbjct: 300 TERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDP 359

Query: 360 VIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALR 419
           VIYRCNLTPHHRTG+ WKIYPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWML AL 
Sbjct: 360 VIYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALH 419

Query: 420 LRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNF 479
           LRKVHIWDFAR+NFVRTLLSKRKLQW+VDKD+V NWDDPRFPT        MT+EGLRNF
Sbjct: 420 LRKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNF 479

Query: 480 VLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPK 539
           VLSQGPSRNVINLEWNLIW+FNKKVIDP+APRHTAIV+PVK+HLEG + PQ P VEMK K
Sbjct: 480 VLSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLK 539

Query: 540 HKKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLE 599
           HKKNPA+GEKK+IYYKDIV+D EDA +++  EEVTLMDWGN IITKKNDDGS  AKLHLE
Sbjct: 540 HKKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLE 599

Query: 600 GDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADL 659
           GDFK TK KLTWLADT D V  DLVDFDHLI+KD+LEE E+FEDFLTP+TEFHT A ADL
Sbjct: 600 GDFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADL 659

Query: 660 NVKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           NVKDMKVGDIIQFERKGY+RLD+LPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 660 NVKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1135 bits (2936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/706 (76%), Positives = 602/706 (85%), Gaps = 3/706 (0%)

Query: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKITGK 62
           + LT+  KAP VAY+ELIAAR+ NA+ P +I I FV             +  V   I   
Sbjct: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61

Query: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122
           F   F  G  +   +W+  A +ELVVKNF KLS SL+ LD+QLN+RTF+LGG  YS AD+
Sbjct: 62  FPEAFKGG-FDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182
           ACWG+LRSNGM GSIIKN+V VNVSRWYTLLE  P FG AH+FLTK++QELKK++   KK
Sbjct: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302
           TNPSKEKEEFQDSILEDL+LLGIKGD++TYSSDYFQEM++ CV+MI++GKAYCDDT TER
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300

Query: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDGIASARR+RSVEENLR+FT EMKNGTEEGLKNCVRAKIDYEA NKTLRDPVIY
Sbjct: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYDWML AL LRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDKDLV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+VNPVK H++G  APQ P V+MK KHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538

Query: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602
           NPAVGEKK+IYY D+++D +DA +I   EE+TLMDWGNVI+TKKN DGS+  KLHLEGDF
Sbjct: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTK K+TWLADT D V VDLVDFDHLI+KD+LEE E F DFLTP+TEFH  AIADLNVK
Sbjct: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658

Query: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           DMK GDIIQFERKGYYRLDA+    KPYVFF+IPDGKSVN+YGAKK
Sbjct: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1127 bits (2915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/708 (75%), Positives = 601/708 (84%), Gaps = 1/708 (0%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           M STL +  K+P+VAYAELIAAR VN    +++AIQF              ++    ++ 
Sbjct: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
            K+  +  +   E+ + W   A  +LVVK+F KLS SLE LD+ LN+RTF+LGG++ + A
Sbjct: 61  EKYPDVLGSV-PEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           DVA WGALRSNG  GSIIKNKV VNVSRWYT LE+ P FG AH+FL KSL+ELK + NV 
Sbjct: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKE+ EFQDSILEDL+LLGIKGD+IT+SSDYFQEM+DYCVQMIK+GKAYCDDTPT
Sbjct: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           ERMREERM+GIASARR RSVEENL++FTEEMKNGTEEGLKNCVRAK DY ALNKTL+DPV
Sbjct: 300 ERMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           +YRCNLTPHHRTG+ WKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL+L
Sbjct: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQW+VDK +V NWDDPRFPT        MT+EGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHT + NPVK+HL G + PQ P  EMKPKH
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNPAVGEKK+IYYKD+++  EDA ++   EEVTLMDWGN II  KNDDGS+ A L+LEG
Sbjct: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTK KLTWLADT D VPVDLVDFDHLI+KDRLEE+++FEDFLTP+TEFHT AIADLN
Sbjct: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMKVGD+IQFER GYYRLD +    KP+VFFTIPDGK+VN+YGAKK
Sbjct: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1118 bits (2892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/704 (74%), Positives = 605/704 (85%), Gaps = 1/704 (0%)

Query: 5   LTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKITGKFA 64
           L +NGKAP VAYAELIA+RIVNA   ++I ++FV             ++  F KI   + 
Sbjct: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63

Query: 65  AIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADVAC 124
            +F +   E+V+ W  +A ++LVVKNF +LSQSLE LD+ LN+RTFILGGLK SAAD+ C
Sbjct: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123

Query: 125 WGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKKKE 184
           WGALRSNGM GSIIKNKV VNVSRWYTLLE++P FG AH++LTKS+Q +KK+   GKKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183

Query: 185 THKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 244
            HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243

Query: 245 PSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTERMR 304
           PSKE+ EFQD+ILEDL+L+GIKGDKITYSSDYFQEM+D CVQ+IK+GKAYCDDT  E+MR
Sbjct: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303

Query: 305 EERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRC 364
           EERM+GI SA+R+ SVEENLR+FTEEMKNGTE G KNCVRAKIDY+A NKTLRDPVIYRC
Sbjct: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363

Query: 365 NLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVH 424
           NLTPHHRT   WK+YPTYDFCVPIVD+IEGVTHALRTIEYRDRN QYDWML+ALRLRKVH
Sbjct: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423

Query: 425 IWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 484
           IWDFAR+NF+RTLLSKRKLQWMVD  LV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVISQG 483

Query: 485 PSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNP 544
           PS+NVINLEWNLIWA NKK+IDP+APRHTA+V+PV+I LEG  AP+ PKVE+KPKHKKNP
Sbjct: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543

Query: 545 AVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDFKK 604
           AVGEKK+IY   I++D+EDA V+ V EE+TLMDWGN+IIT KN DGS+VAK +L GDFKK
Sbjct: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603

Query: 605 TKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVKDM 664
           TKHK+TWLA+T D VPV++VDFDHLITKD+LEEDE+F DF+TPQTEFHT A+ D+NVKDM
Sbjct: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662

Query: 665 KVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           KVGDIIQFERKGY RLD+  +  KPY+FFTIPDGKSVNRYGAKK
Sbjct: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1110 bits (2872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/708 (76%), Positives = 617/708 (87%), Gaps = 1/708 (0%)

Query: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKIT 60
           M + L ++GKA +VAY ELIAARIVN  + N++ I FV             ++ V  KI 
Sbjct: 1   MSTKLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIV 60

Query: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120
               + F +  KE V+ WT LA+++LVVKNF +L+Q+LE LD+QLN+R+F+LGGL +SAA
Sbjct: 61  ALSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180
           DVA WGALRSNGM GSIIKNKV VNVSRWY+ LE++P FGE+H+FLTKSLQELKK+AN G
Sbjct: 121 DVAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKE+HKANFEIDL DAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEF++SI+EDL LLGIKGD++T+SSDYFQEM+DYC+QMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERM+G  SARRNRSVEENL++FTE+M NGTEEGLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420
           IYRCNLTPHH TG  WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WML AL+L
Sbjct: 361 IYRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           R VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        M++EGLRNFV
Sbjct: 421 RHVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDP APRHTA+VNP K+HLEG+E PQ  K+EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKH 540

Query: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600
           KKNP VGEKK+++ K+I++D+EDADV+   EE TLMDWGN IITKK D  S+ AKLHLEG
Sbjct: 541 KKNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKK-DANSITAKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHK+TWLADTKDVV VDLVDFDHL+ KDR+EE ESFEDFLT +TEFHT AIADLN
Sbjct: 600 DFKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLN 659

Query: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           VKDMK+GD IQFERKGYYRLD+LPKNG PYVFFTIPDGK+VN+YGAKK
Sbjct: 660 VKDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1102 bits (2851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/706 (76%), Positives = 597/706 (84%), Gaps = 3/706 (0%)

Query: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVXXXXXXXXXXXXXTEGVFNKITGK 62
           + L +  KAP VAY+ELIAAR+VN+   ++I I+FV              + V  +I   
Sbjct: 2   AKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQT 61

Query: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122
           +  +F +G  E    W  LA +EL VKNF KLS SL  LD+ LN RTFILGG  +SAAD+
Sbjct: 62  YPEVFKHG-FENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADI 120

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182
           ACWG+LRSNGM GSIIKNKV VNVSRWYTLLE  P FG AH+FL K+LQELKK++   KK
Sbjct: 121 ACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKK 180

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KETHKANFEIDL DAKVG+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302
           TNPSKEKEEFQDSILEDL+LLGIKGD++TYSSDYFQEM+D CV+MI++G AYCDDTPT++
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDK 300

Query: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDG+ASARR+RSVEENLR+FT+EMKNGTEEGLKNCVRAKIDY+ALNKTLRDPVIY
Sbjct: 301 MREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 360

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY WML AL LRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDKDLV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTAIV PVK H+EG  APQ P V++K KHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKLKHKK 538

Query: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602
           NPAVGEKK+IYY DI++D++DAD +   EE+TLMDWGN I+TKKN DGS+  KLHLEGDF
Sbjct: 539 NPAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDF 598

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTK KLTWLADT D V VDLVDFDHLITKD+LEE E F D+LTPQTEFH  A+ADLNVK
Sbjct: 599 KKTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVK 658

Query: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708
           DMK GDIIQFERKGYYRLD+     KPYVFF IPDGKSVN+YGAKK
Sbjct: 659 DMKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  236 bits (601), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 148/441 (33%), Positives = 235/441 (53%), Gaps = 28/441 (6%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATHGLVHTRFPPEPNGYLHIGHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESI 305

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTERMREER---MDGI-- 311
           +  ++ LG    KITYSSDYF ++++   ++I  GK Y  +   E ++  R    DG   
Sbjct: 306 IRMVNWLGFHPWKITYSSDYFDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPG 365

Query: 312 ----ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R+RSVEENL  F  +MK+G  +  +  +R K D  + +  + D + YR    
Sbjct: 366 GERHACKHRSRSVEENLTEF-RKMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNA 424

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTG+ W+IYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 425 PHPRTGNKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQRE 484

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVDEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
           +V N++     +  +K ++   PR   I++PV++ ++      E  V + P     P  G
Sbjct: 545 SVTNIQLVRFESAIRKYLEDTTPRLMFILDPVEVVVDNVPDSFEDVVSI-PFRPGTPEFG 603

Query: 548 EKKLIYYKDIVVDREDADVINVDEE---------VTLMDWGNVIITK---KNDDGSMVAK 595
           E+++ + K + +DR D      D+E         V L+   + +I K   K+ DG  + K
Sbjct: 604 EREVPFTKRVFIDRSDFSENASDKEFFRLTPEQPVGLIKVPHALIYKSLEKDSDGK-ITK 662

Query: 596 LHL----EGDFKKTKHKLTWL 612
           +H+    EG  KK K  + W+
Sbjct: 663 IHVHYDTEGKIKKPKTYIQWV 683

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  228 bits (581), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 140/438 (31%), Positives = 228/438 (52%), Gaps = 24/438 (5%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDG--- 310
              +  LG +  KITYSSDYF ++++    +IK+GK Y   C      R R  + DG   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 311 ---IASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
                   R  S+E+NL  F E MK G  +  +  +R K D+ + +  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V++ +V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
           +V N++     +  +K ++   PR   +++P+++ ++      E  VE+ P    +   G
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEVVVDNLPEDHEELVEV-PYKAGSAEFG 603

Query: 548 EKKLIYYKDIVVDRED-ADVINVDEEVTLMDWGNVIITK----------KNDDGSMVAKL 596
            + L +     +DR D ++ ++  E   L    +V + K          + D    + +L
Sbjct: 604 SRTLPFTNRFYIDRSDFSETVDDKEFFRLTPSQSVGLVKVPRTVTFVSVEKDANGHITRL 663

Query: 597 HLEGDFKKTKHK--LTWL 612
           H+  D +K K K  + W+
Sbjct: 664 HVNYDSEKKKPKTYIQWV 681

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  227 bits (578), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 207/373 (55%), Gaps = 11/373 (2%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI----- 311
           +  LG K  KITYSSDYF E++     +IK+GKAY   C     +R R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 312 -ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R++S+E+NL+ F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG+ W+IYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   +++PV++ ++      E ++   P     P  GE+ 
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYE-ELATIPYRPGTPEFGERT 607

Query: 551 LIYYKDIVVDRED 563
           + +     ++R D
Sbjct: 608 VPFTNKFYIERSD 620

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  224 bits (571), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 137/382 (35%), Positives = 210/382 (54%), Gaps = 15/382 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI----- 311
           +  LG K  KITYSSDYF +++D    +IK  K Y   C     +R R  + DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 312 -ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A A R+R +EE+L  F  +MK+G  E  K  +R K D ++ N  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG  W+IYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++        +K ++   PR   I++P++I ++      E  V + P  KK    G++ 
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEIIVDNLAEDYEEIVSI-PYSKK---FGDRT 601

Query: 551 LIYYKDIVVDREDADVINVDEE 572
           + + K I ++R+D D  + DEE
Sbjct: 602 VPFTKRIYIERKDFDE-SADEE 622

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  224 bits (571), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 148/498 (29%), Positives = 255/498 (51%), Gaps = 35/498 (7%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTERMREER---MDG------ 310
           +  LG K  KITYSSDYF ++++    +IK GK Y     +E ++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 311 IASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R+RS+EE L  F  +M+NG  +  +  +R K D  + +  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEF-RKMRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   +++PV++ L+      E  V++ P    +P  GE++
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLDNLPEDYEELVKI-PFRPGSPEFGERE 609

Query: 551 LIYYKDIVVDREDADVINVDEEVTLMD-----------WGNVIITKKNDDGSMVAKLHL- 598
           + + K   ++R D    + D+E   M            +     + + D+   + ++H  
Sbjct: 610 VPFTKRFFIERSDFSENSDDKEFFRMTPKQPVGLIKVPYNVSFKSAEKDESGRIIRIHAH 669

Query: 599 ------EGDFKKTKHKLTWLADTKDV-VPVDLVD---FDHLITKDRLE-EDESFEDFLTP 647
                 +G  +K K  + W+  +K    PV + +   ++ L + +      E +   + P
Sbjct: 670 YDNSPQDGKPQKPKTYIQWVPFSKKYNSPVQVAETRIYNQLFSSENPSAHPEGYLKDINP 729

Query: 648 QTEF-HTDAIADLNVKDM 664
           ++E  +T+++ + N  ++
Sbjct: 730 ESELVYTNSVVEPNFSEV 747

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  223 bits (569), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 225/425 (52%), Gaps = 24/425 (5%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDG------ 310
           +  LG    KITYSSDYF E++     +IK+GK Y   C     +R R  + DG      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 311 IASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R++S+E NL+ F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   +++PV++ ++      E ++   P     P  GE+ 
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYE-ELATIPFRPGTPEFGERT 608

Query: 551 LIYYKDIVVDREDADVINVDEE----------VTLMDWGNVIITK--KNDDGSMVAKLHL 598
           + +     ++R D    NVD++          V L+   + +  K  + D+   + K+H+
Sbjct: 609 VPFTNRFYIERSDFSE-NVDDKEFFRLTPNQPVGLIKVSHTVSFKSLEKDEAGRIVKIHV 667

Query: 599 EGDFK 603
             D K
Sbjct: 668 NYDSK 672

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  222 bits (565), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 131/376 (34%), Positives = 205/376 (54%), Gaps = 11/376 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESI 301

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI-- 311
              +  LG K  KITYSSDYF ++++    +I + KAY   C     +R R  + DG   
Sbjct: 302 KNMVAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPG 361

Query: 312 ----ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R+RSVEENL  F  +M++G  +  +  +R K D E+ +  + D + YR    
Sbjct: 362 GERRACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNA 420

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 421 PHPRTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
           +  N++     +  +K ++   PR   I++PV++ ++      E  V++ P     P  G
Sbjct: 541 STTNIQVVRFESAIRKYLEDNTPRLMMILDPVEVVVDNLPDDYEELVKI-PYRPGTPEFG 599

Query: 548 EKKLIYYKDIVVDRED 563
           E+ + + K   ++R D
Sbjct: 600 ERSVPFTKKFYIERSD 615

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  221 bits (563), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/373 (33%), Positives = 205/373 (54%), Gaps = 11/373 (2%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDG------ 310
           +  LG +  KITYSSDYF +++D    +IK+GKAY   C     +R R  + DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 311 IASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
           +A   R+R +EENL  F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEF-RKMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++ +V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++    R   +++PV+I ++      E  V + P     P  G++ 
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEIVVDNLPEDYEEMVTI-PYRPGTPEFGDRT 603

Query: 551 LIYYKDIVVDRED 563
           + + K   ++R D
Sbjct: 604 VPFTKKFFIERSD 616

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  220 bits (561), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 141/443 (31%), Positives = 226/443 (51%), Gaps = 29/443 (6%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G  I+RFDDTNP  E  E+ +SI
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI-- 311
              +  LG    KITYSSDYF +++D    +I + + Y   C     +R R  + DG   
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 312 ----ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R+ S+E NL+ F   M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 371 GERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+R     Y+W+   + + +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
           +  N++        +K ++   PR   I++P++I ++      E  + + P     P  G
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVVDNLPEDYEEILSI-PYRAGTPEFG 608

Query: 548 EKKLIYYKDIVVDREDADVINVDEE-VTLMDWGNVIITK----------KNDDGSMVAKL 596
           ++ + + K   ++R D   ++ D+E   L    NV + K          + D    + K+
Sbjct: 609 DRTVPFTKRFYIERSDFSEVSDDKEFFRLTPTQNVGLIKVPHTVSFKSVEKDSNGKITKI 668

Query: 597 HL-------EGDFKKTKHKLTWL 612
           H+       EG  KK K  + W+
Sbjct: 669 HVHYNNEAQEGKPKKPKTYIQWV 691

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  220 bits (561), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 125/373 (33%), Positives = 201/373 (53%), Gaps = 11/373 (2%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDG------ 310
           +  LG K  KITYSSDYF ++++    +I + K Y   C     +R R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 311 IASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   RNR +EENL+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   I++P+++ ++      E  V + P     P  GE+ 
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDNLADDYEELVSI-PYRPATPEFGERN 608

Query: 551 LIYYKDIVVDRED 563
           + +     ++R D
Sbjct: 609 VPFTNKFYIERSD 621

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  220 bits (560), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 124/373 (33%), Positives = 204/373 (54%), Gaps = 11/373 (2%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDG------ 310
           +  LG K  KITYSSDYF E++     +I +GK Y   C     +R R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGER 369

Query: 311 IASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R++S+E NL+ F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   +++P+++ ++      E ++ + P        GE+ 
Sbjct: 549 NIQVIRFESAVRKYLEDTTPRLMFVLDPIEVVVDNLPDDYE-ELAIIPFRPGTSEFGERT 607

Query: 551 LIYYKDIVVDRED 563
           + +     ++R D
Sbjct: 608 VPFTNKFYIERSD 620

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  219 bits (558), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 139/454 (30%), Positives = 233/454 (51%), Gaps = 30/454 (6%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI----- 311
           +  LG K  KITYSSDYF ++++    +I++ + Y   C     +R R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 312 -ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R+R VEE+L+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEF-RNMRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V+ + V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   +++P+++ ++      E ++   P     P  GE+ 
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVVDNLPEDYE-EIASIPYRPGTPEFGERN 608

Query: 551 LIYYKDIVVDREDADVINVDEE---------VTLMDWGNVIITK--KNDDGSMVAKLHL- 598
           + + K   ++R D      D E         V L+   + +  K  + D+   + +LH+ 
Sbjct: 609 VPFTKKFYIERSDFSENTDDSEFFRLTPTQPVGLIKVPHTVSFKSLEKDESGKIIRLHVN 668

Query: 599 ------EGDFKKTKHKLTWL-ADTKDVVPVDLVD 625
                 EG  KK K  + W+   +K   P+ + +
Sbjct: 669 YDNEQKEGKPKKPKTYIQWVPVSSKHNSPIRIAE 702

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  219 bits (558), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 127/382 (33%), Positives = 204/382 (53%), Gaps = 11/382 (2%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI----- 311
           +  LG    KITYSSDYF +++D    +I +GK Y   C     +R R  + DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 312 -ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R+R +EENL+ F   M++G  +  +  +R K D  + +  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   I++P+++ ++      E  V + P     P  GE+ 
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDNLSDDYEELVTI-PYRAGTPEFGERT 612

Query: 551 LIYYKDIVVDREDADVINVDEE 572
           + +     ++R D   +  D+E
Sbjct: 613 VPFTNKFFIERSDFSEVTDDKE 634

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  219 bits (557), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 148/492 (30%), Positives = 249/492 (50%), Gaps = 33/492 (6%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI----- 311
           +  LG K  KITYSSDYF ++++   ++I +GKAY   C     +R R  + DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 312 -ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R RSVEENL  F  +M++G  +  +  +R K D E+ +  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEF-RKMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++  V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   +++PV++ ++      E  V + P     P  GE++
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVVDNLPEDYEELVTV-PYRPGTPEFGERQ 602

Query: 551 LIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKK-----------NDDGSMVAKLHLE 599
           + +     ++R D      D+E   +     +   K            D    V ++H++
Sbjct: 603 VPFTGKFYIERSDFSEATDDKEFFRLTPNQPVGLIKVPYTVSYQSVDKDSNGKVIRIHVK 662

Query: 600 GDF-----KKTKHKLTWL-ADTKDVVPVDLVD---FDHLI-TKDRLEEDESFEDFLTPQT 649
            D      KK K  + W+   +K   PV + +   ++ L  +++     E F + + P++
Sbjct: 663 YDNEDAKPKKPKTYIQWVPVSSKYNSPVRIAETRVYNQLFKSENPSAHPEGFLNDINPES 722

Query: 650 EF-HTDAIADLN 660
           E  H +++ + N
Sbjct: 723 ELVHGNSVVEHN 734

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  217 bits (552), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 204/376 (54%), Gaps = 11/376 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 238 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 297

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI-- 311
              +  LG K  K+TYSSDYF ++++    +IK+GK Y   C     +R R  + DG   
Sbjct: 298 KRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPG 357

Query: 312 ----ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R++SVE+NL  F   M++G  +  +  +R K + E+ +  + D + YR    
Sbjct: 358 GERHACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNA 416

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 417 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 476

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 477 YGRLNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 536

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
           +  N++     +  +K ++   PR   I++P+++ +E      E  V + P        G
Sbjct: 537 STTNIQVVRFESAIRKYLEDSTPRLMMILDPIEVVVENLPEDYEELVTI-PYRAGTKEFG 595

Query: 548 EKKLIYYKDIVVDRED 563
           ++ + +     ++R D
Sbjct: 596 DRNVPFTNKFYIERAD 611

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  216 bits (550), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 128/385 (33%), Positives = 203/385 (52%), Gaps = 11/385 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESI 301

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDG--- 310
              +  LG    KITYSSDYF ++++    +IK+GK Y   C      R R  + DG   
Sbjct: 302 ERMVAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPG 361

Query: 311 ---IASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
              +  A R R +EENL  F   M++G     +  +R K D  + +  + D V YR    
Sbjct: 362 GERLPCAHRERPIEENLAEF-RNMRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNA 420

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTGS W+IYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    +
Sbjct: 421 PHPRTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V +  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
           +  N++     +  +K ++    R   +++P+++ ++      E  V + P     P  G
Sbjct: 541 STTNIQVVRFESAIRKYLEDTTARLMFVLDPIEVIVDNLPEDYEELVSI-PYRPGTPEFG 599

Query: 548 EKKLIYYKDIVVDREDADVINVDEE 572
           E+ + + K   ++R D      D+E
Sbjct: 600 ERTVPFSKRFYIERSDFSEDTSDKE 624

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  216 bits (550), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 123/373 (32%), Positives = 202/373 (54%), Gaps = 11/373 (2%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 260 LDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDG------ 310
           +  LG +  KITYSSDYF E++     +I + K Y   C     +R R  + DG      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 311 IASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R++ +E NL+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 371 RTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVGEKK 550
           N++     +  +K ++   PR   +++P+++ ++   A    ++   P     PA GE+ 
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNL-ADDFEELATIPYRPGTPAFGERT 607

Query: 551 LIYYKDIVVDRED 563
           + +     ++R D
Sbjct: 608 VPFTNKFYIERSD 620

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  215 bits (547), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 134/447 (29%), Positives = 230/447 (51%), Gaps = 29/447 (6%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESI 307

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI-- 311
              +  LG K  K+TYSSDYF ++++    +IK+ K Y   C     +R R  + DG   
Sbjct: 308 QRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPG 367

Query: 312 ----ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R+R +EE+L+ F   M+ G  +  +  +R K D  + +  + D + YR   +
Sbjct: 368 GERSACKHRDRPIEESLQEF-RNMREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNS 426

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTG  WKIYPTYDF   +VD+ E ++H+L T E+      Y+W+   + + +    +
Sbjct: 427 PHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
           +  N++     +  +K ++   PR   I++P+++ +E      E  V + P    +   G
Sbjct: 547 STTNIQVARFESAIRKFLEDTTPRLMFILDPIEVIVENLSENYEELVTI-PYRAGSAEFG 605

Query: 548 EKKLIYYKDIVVDREDADVINVDEE---------VTLMDWGNVI--ITKKNDDGSMVAKL 596
           ++++ +     ++R D    + D+E         V L+   + +  +  + D+   + K+
Sbjct: 606 DRQVPFTNRFYIERSDFSEDSSDKEFFRLTPEQSVGLIKVPHTVSFVRSEKDESGKITKI 665

Query: 597 H-------LEGDFKKTKHKLTWLADTK 616
           +       ++G  KK K  + W+  +K
Sbjct: 666 YVKYDNEPVDGKPKKPKTYIQWVPVSK 692

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  212 bits (539), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 204/385 (52%), Gaps = 11/385 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESI 307

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI-- 311
              +  LG K  KITYSSDYF +++D    +I++ K Y   C     +R R  + DG   
Sbjct: 308 ERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPG 367

Query: 312 ----ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               + + R RS+ ENL  F  +M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 368 GERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 426

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 427 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
              N++     +  +K ++    R   +++P+++ +       +  V + P     P  G
Sbjct: 547 TTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEVVVNNLPEDYQELVTI-PYRPGTPEFG 605

Query: 548 EKKLIYYKDIVVDREDADVINVDEE 572
           ++ + + K   ++R D      D+E
Sbjct: 606 DRTVPFTKRFYIERTDFSENTADKE 630

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  207 bits (528), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 200/376 (53%), Gaps = 11/376 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESI 305

Query: 257 LEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGI-- 311
              +  LG K  K TYSSDYF E++     +IK+GKAY   C     +R R  + DG   
Sbjct: 306 KSMVSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPG 365

Query: 312 ----ASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R R +EE+L  F  +M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 366 GERKACVSRERPIEESLTEF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 424

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
           PH RTG  WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    +
Sbjct: 425 PHPRTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 428 FARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V    V  W+DPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNPAVG 547
           +  N++     +  +K ++   PR   I++PV++ ++  +        + P     P  G
Sbjct: 545 STTNIQVVRFESAIRKYLEDTTPRLMFILDPVEVVVDNVDEDFVELCNI-PYRPNTPEFG 603

Query: 548 EKKLIYYKDIVVDRED 563
           ++ + + K   ++R D
Sbjct: 604 DRTVPFTKRFYIERSD 619

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 101/232 (43%), Gaps = 26/232 (11%)

Query: 199 VGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILE 258
           V  VVTRF P P+G LH+G  + AL N   A+   GK I+R +DT+  +   E + +IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 259 DLDLLGIKGDKITY-SSDYFQEMF--DYCVQMIKDGKAY---CDDTPTERMREERMDGIA 312
            LD   IK D   Y  SD  +E     Y  Q++K G AY   C       +REE  D   
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 313 SARRNRSVEEN------LRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNL 366
           +   ++ V         +R    E+ +  ++ L   VR  I          DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSDR 215

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQAL 418
                       +PTY     + D + GVTH +R  E+     ++  M +A 
Sbjct: 216 ------------FPTYHLANVVDDHLMGVTHVIRGEEWLPSTPKHIAMYKAF 255

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 99/218 (45%), Gaps = 24/218 (11%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V+TRF P P+G LH+G  + AL N   A+   GK I+R +DT+ ++   E   +I + L 
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 262 LLGIKGDKITYSSDYFQEMF-DYCVQMIKDGKAYCDDTPTERMREERMDGIASARRNRSV 320
              ++ D+          ++ +Y  +++K G AY      ER+ + R   +A    +   
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYD- 164

Query: 321 EENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY-----RCNLTPHHRTGST 375
            + + L  E +K   ++G+   +R K          R P+I+       N+ P++R G  
Sbjct: 165 RKCIHLDEETIKVNLDKGIPYTIRMK-------SPERYPLIHDLLHGELNIQPNNREG-M 216

Query: 376 W---------KIYPTYDFCVPIVDAIEGVTHALRTIEY 404
           W           +PTY F   + D +  VTH +R  E+
Sbjct: 217 WFDDPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEW 254

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 107/262 (40%), Gaps = 35/262 (13%)

Query: 203 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDL 262
           +TRF P P+G LH+G  + AL N   A++  GK I+R +DT+ S+   E   +I E L  
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 263 LGIKGDK-ITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMREERMDGIASARRNR 318
            GI  D+     SD       Y   ++  G AY   C     E++R +  +   S   +R
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 319 SVEENLRLFTEEMKNGTEEGLKNCVRAKID--YEALNKTLRDPVIYRCNLTPHHRTGSTW 376
           +      L TE +++     L   +R K    Y      L   V  + N     +    W
Sbjct: 163 NC---YHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQLN----QKERGVW 215

Query: 377 ---------KIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIWD 427
                      YPTY F   + D + G+TH +R  E+     ++      + L ++  WD
Sbjct: 216 FDDPILIKSDGYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH------VALYQLFGWD 269

Query: 428 FARINFVRTL-------LSKRK 442
             +   +  L       LSKRK
Sbjct: 270 MPKFIHIPLLTSIDDKKLSKRK 291

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 105/238 (44%), Gaps = 51/238 (21%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+  +  +  +++I   L 
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 262 LLGIKGD-------------KITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTERM----- 303
            LG++ D             K +  S  +Q+   Y  +++ +GKAY      ER+     
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQK---YINELLDNGKAYRCFCSKERLTGLKE 160

Query: 304 REERMDGIASARRNR--------SVEENL--------RLFTEEMKNGTEEGLKNCVRAKI 347
             +++    +A  +R         +EENL        RL + ++    E+ L   +  + 
Sbjct: 161 SAQKLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKLNIQP 220

Query: 348 DYEALNKTLRDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEY 404
            Y ++++   DPV+ +  NL             PTY F   + D +  ++H +R  E+
Sbjct: 221 QYNSIDRRFDDPVLMKSDNL-------------PTYHFANVVDDHLMKISHVIRGEEW 265

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 119/275 (43%), Gaps = 48/275 (17%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G++H+G  + AL N   A++  G+ ++R +DT+  +  E  ++ I E L 
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 262 LLGIKGDKIT----------YSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMRE--E 306
             GI+ D+              S+  +    +   ++++G AY   C     + M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 307 RMDGIASARRNRSV----EE------------NLRLFTEEMKNGTEEGLKNCVRAKIDYE 350
           +++  +SA  +R      EE             +RL + E     E+ L   +  +I Y 
Sbjct: 166 KLNPPSSASYDRHCLHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQIQYN 225

Query: 351 ALNKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQ 410
              KT  DP++ + +              PTY F   + D +  +TH +R  E+     +
Sbjct: 226 PHKKTYDDPILIKSD------------GLPTYHFANVVDDHLMKITHVIRGEEWLPSTPK 273

Query: 411 YDWMLQAL---RLRKVHIWDFARINFVRTLLSKRK 442
           +  M  AL     + +HI     IN  +  LSKRK
Sbjct: 274 HISMYNALGWQAPKYIHIPLLTSINDKK--LSKRK 306

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 96/220 (43%), Gaps = 24/220 (10%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  E  +++I E L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 262 LLGIKGDKITYSSDYFQEMFD-YCVQMIKDGKAYCDDTPTERMREERMDGI-----ASAR 315
              I  D+        + ++D Y   ++  GKAY      ER+ + R   +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 316 RNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHHRTGST 375
            +R       L  EE+K+   +G+   VR K        T  D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERY--PTFTDLLHGQINLQP--QVNFN 217

Query: 376 WKIY-----------PTYDFCVPIVDAIEGVTHALRTIEY 404
            K Y           PTY     + D + G+TH +R  E+
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEW 257

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 100/228 (43%), Gaps = 25/228 (10%)

Query: 199 VGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILE 258
           +  V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  ++ +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 259 DLDLLGIKGDKITYS----------SDYFQEMFDYCVQMIKDGKAYCDDTPTERM----- 303
            L   GI  D+   S          SD  +    Y  +++ +G AY    P ER+     
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 304 REERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKID--YEALNKTLRDPVI 361
             +++    +   +R+    L L  +E++N    G+   VR K    Y   +  L   + 
Sbjct: 158 SAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHGHIN 214

Query: 362 YRCNLTPHHRTGSTWKI-----YPTYDFCVPIVDAIEGVTHALRTIEY 404
            +  +  + R      +      PTY F   I D +  +TH +R  E+
Sbjct: 215 IQPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 76/150 (50%), Gaps = 7/150 (4%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
            VTRF P P+G LH+G  + AL N   A+   GK I+R +DT+ S+ K+   D+I   L 
Sbjct: 46  AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLK 105

Query: 262 LLGIKGDKITY----SSDYFQEMFDYCVQMIKDGKAYCDDTPTERMREERMDGIASARRN 317
              +K D+  Y     +D +++  ++ ++  +  + +C     + +R+  +  +     N
Sbjct: 106 WCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPT--N 163

Query: 318 RSVEENLRLFTE-EMKNGTEEGLKNCVRAK 346
            S + +    +E E+K+  ++G+   VR K
Sbjct: 164 VSYDRHCAHLSEGEIKSKLDQGIPFTVRFK 193

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 100/226 (44%), Gaps = 17/226 (7%)

Query: 201 QVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDL 260
           +VVTRF P P+G LHIG  + AL N   A++  GK I+R +DT+ ++ K   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 261 DLLGIKGD-KITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTERMREERMDGIASARRNRS 319
           +   +K D      SD      +Y  ++++ G AY      +R+   R  G      + S
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGYDRHCLHLS 158

Query: 320 VEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH-RTGSTWKI 378
             +  RLF       T   L+  +++   Y++    L   V    N+     R G    I
Sbjct: 159 DNDVRRLFDA---GHTRPVLR--LKSPNKYDSFQDMLHGTV----NIQERKDRVGFDDPI 209

Query: 379 ------YPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQAL 418
                 +PTY F   + D +  VTH +R  E+     ++  + +AL
Sbjct: 210 LMKSDGFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKAL 255

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 99/219 (45%), Gaps = 18/219 (8%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+ ++     + ++ +    L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 264 GIKGDK-----ITYS----SDYFQEMFDYCVQMIKDGKAYCDDTPTERMREERMDGIA-S 313
           GI+ D+      TY     SD  +    Y  Q+I  G AY      ER++  R   +A  
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSDQLISTGHAYRCFCSKERLKGLRDSAMALK 181

Query: 314 ARRNRSVEENL-RLFTEEMKNGTEEGLKNCVRAKID--YEALNKTLRDPVIYRCNLTP-H 369
              N + + +  +L  E++++  + G+   +R K    YE     L + +  +  + P  
Sbjct: 182 PPTNVTYDRHCAKLSKEDIRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQINPID 241

Query: 370 HRTGSTWKI----YPTYDFCVPIVDAIEGVTHALRTIEY 404
            R      I     PTY F   I D +  +TH +R  E+
Sbjct: 242 VRYDDPILIKSSGLPTYHFAHVIDDHLMEITHVIRGQEW 280

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 136/348 (39%), Gaps = 54/348 (15%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G+LH+G  + AL N   A+  KG+ ++R +DT+  +     +++I E L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 262 LLGIKGDKITYSSDYFQEMFD-YCVQMIKDGKAYCDDTPTERMREERMDGI-----ASAR 315
              I  D+        + ++D Y   ++  G AY      ER+ + R   +     + A 
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPPSMAS 164

Query: 316 RNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPH-----H 370
            +R       L  EE+++   + +   VR K   +    T  D +    NL P       
Sbjct: 165 YDRCCAH---LAKEEIESKLAQDMPFTVRFKSPEQY--PTFTDVLHGEINLQPQVNYNDR 219

Query: 371 RTGSTWKI----YPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIW 426
           R      +     PTY     + D + G+TH +R  E+     ++  +  A        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 427 DFARINFVRTL-------LSKRKL---------QWMVDKDLVG-----NWDDPRFPTXXX 465
           D+ +   +  L       LSKRK          Q ++ + LV       W  PR      
Sbjct: 274 DYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DLAS 331

Query: 466 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDPI 508
                 ++E L       G ++    ++   +W FNK     ++ DP+
Sbjct: 332 KKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPV 379

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 126/323 (39%), Gaps = 54/323 (16%)

Query: 144 VNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKKKETHKANFEIDLPDAKVGQVV 203
           + + R +  L + P  G     L KSL   K       K++ H ++            V 
Sbjct: 4   LRIPRRFYCLSLKPTKGVGPSSLNKSLLSRKT------KEDIHPSS-----------PVR 46

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I + L   
Sbjct: 47  TRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLKWC 106

Query: 264 GIKGDKITYSSDYFQEMFD-YCVQMIKDGKAYCDDTPTERMREERMDGI-----ASARRN 317
            I  D+        + ++D Y   ++  G AY      ER+ E R   +     + A  +
Sbjct: 107 KINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMASYD 166

Query: 318 RSVEENLRLFTEEMKNGTEEGLKNCVRAKI--DYEALNKTLRDPVIYRCNLTPH-----H 370
           R       L  EE+ +   +G+   VR K    Y      L   +    NL P       
Sbjct: 167 RCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKYPLFADLLHGEI----NLQPQVNFNDR 219

Query: 371 RTGSTWKI----YPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVHIW 426
           R      +     PTY     + D + G+TH +R  E+     ++  +  A        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 427 D---FARINFVRTL----LSKRK 442
           D   F  I  + T+    LSKRK
Sbjct: 274 DCPKFIHIPLLTTVGDKKLSKRK 296

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 101/228 (44%), Gaps = 31/228 (13%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LHIG  + AL N   A+  +G+ ++R +DT+ ++  +  +++I + L 
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 262 LLGIKGD-------------KITYSSDYFQEMFDYCVQMIKDGKAY---CDDTPTERMRE 305
             GI+ D             + +  ++ +Q+  D    ++K G AY   C     + +RE
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVD---GLLKSGHAYRCFCSKERLDGLRE 157

Query: 306 --ERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKID--YEALNKTLRDPVI 361
             +R+    +   +R  E    L   E++    + + + +R K    Y A +  L   V 
Sbjct: 158 SAKRLKPPTTVTYDRKCES---LSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVD 214

Query: 362 YRCNLTPHHRTGSTWKI-----YPTYDFCVPIVDAIEGVTHALRTIEY 404
            +  +  + R      +      PTY F   I D +  +TH +R  E+
Sbjct: 215 IQPQVNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 112/276 (40%), Gaps = 51/276 (18%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     + S+ + L 
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 262 LLGIKGD------------KITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTERMREE--- 306
              IK D            + +  +  +QE  +  V+     K +C     + +RE    
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 307 -------RMDGIASARRNRSVEENLRL---FTEEMKNGTE-EGLKNCVRAKIDYE----A 351
                    D   S   ++ VE NL+    FT   K+  +    ++ +  K+D +     
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 352 LNKTLRDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQ 410
           L+    DP++ +  NL             PTY F   I D +  +TH +R  E+     +
Sbjct: 231 LDIRYDDPILMKSDNL-------------PTYHFANVIDDHLMKITHVIRGEEWLPSTPK 277

Query: 411 YDWMLQALRLRKVHIWDFARINFVRTL----LSKRK 442
           +  + +A      H   +  I  + T     LSKRK
Sbjct: 278 HTALYEAYGWTPPH---YVHIPLLTTTSDKKLSKRK 310

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 92/221 (41%), Gaps = 22/221 (9%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+GYLH+G  + AL N   A+   G+ ++R +DT+  +   + + +I + L  L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 264 GIKGDK---------ITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTERMREERMDGIA-S 313
           GI+ D+             SD       +  +++  G AY      ER+   R   +A  
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHADKLLASGHAYRCFCSKERLENLRTSAMALQ 164

Query: 314 ARRNRSVE-ENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHHRT 372
              N S + E   L  E + +  ++ +   +R K    A+ +   D +  R +L P    
Sbjct: 165 PPTNVSYDRECANLSQEHIDHKLDQNVPFTLRFK--SPAVYEPFEDLLHGRVDLQPQTNP 222

Query: 373 GST---------WKIYPTYDFCVPIVDAIEGVTHALRTIEY 404
                           PTY F   + D +  +TH +R  E+
Sbjct: 223 NDIRYDDPVLMKSDGLPTYHFANVVDDHLMKITHVIRGEEW 263

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 91/222 (40%), Gaps = 28/222 (12%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LH+G  + AL N   A+   G+ ++R +DT+  +     +  I + L+
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 262 LLGIKGDKITYSSDYFQEMFD-YCVQMIKDGKAYCDDTPTERMREERMDGI-----ASAR 315
              I+ D+        + ++D Y   ++  G AY      ER+ + R   +     + A 
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 316 RNRSVEENLRLFTEEMKNGTEEGLKNCVRAKI--DYEALNKTLRDPVIYRCNLTPHHRTG 373
            +R       L  EE+ +   +G+   VR K    Y      L   V    NL P  +  
Sbjct: 165 YDRCCAH---LKEEEINSNLTQGIPFTVRFKSPEQYPVFTDLLHGEV----NLQP--QVN 215

Query: 374 STWKIY-----------PTYDFCVPIVDAIEGVTHALRTIEY 404
              K Y           PTY     + D + G+TH +R  E+
Sbjct: 216 FNDKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEW 257

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 97/226 (42%), Gaps = 31/226 (13%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+G LHIG  + AL N   A++  G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 264 GIKGDKIT----------YSSDYFQEMFDYCVQMIKDGKAY-CDDTPTERMREERMDGI- 311
           GI  D+              SD  +    Y  +++  G AY C  T      +ER+DG+ 
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTNKLLDSGHAYRCFCT------KERLDGLR 160

Query: 312 ASARR-----NRSVEENLRLFTE-EMKNGTEEGLKNCVRAKID--YEALNKTLRDPVIYR 363
            SA++       S + +    +E E++   ++ +   +R K    Y      L   +  +
Sbjct: 161 ESAQKLQPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQ 220

Query: 364 CNLTPHHRTGSTWKI-----YPTYDFCVPIVDAIEGVTHALRTIEY 404
             + P+ R      +      PTY F   + D +  +TH +R  E+
Sbjct: 221 PQVNPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEW 266

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 96/240 (40%), Gaps = 55/240 (22%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LH+G  + AL N   A++  G+ ++R +DT+  +     + +I + L 
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 262 LLGIKGDK----------ITYSSDYFQEMFDYCVQMIKDGKAY-CDDTPTERMREERMDG 310
             G++ D+              SD  +    Y  Q++  G AY C         +ER+DG
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRC------FCSKERLDG 174

Query: 311 IASARRN------RSVEENLRLFTE-EMKNGTEEGLKNCVRAKI--DYEALNKTLR---- 357
           + S+ +        S + +    TE E+    ++G+   VR K    Y      L     
Sbjct: 175 LRSSAQQLQPPTTASYDRHCTELTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQLD 234

Query: 358 -------------DPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEY 404
                        DP++ + +              PTY F   + D +  +TH +R  E+
Sbjct: 235 MQIQINMNDIRYDDPILMKSD------------GLPTYHFANVVDDHLMRITHVIRGEEW 282

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 9/115 (7%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+ S+  E  +++I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 262 LLGIKGDK--------ITYSSDYFQEMF-DYCVQMIKDGKAYCDDTPTERMREER 307
              +  D+          Y      E++  Y   +++ G AY    P ER+ + R
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLR 154

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 92/223 (41%), Gaps = 25/223 (11%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+G LHIG  + AL N   A++  G+ ++R +DT+  +     ++SI E L   
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 264 GIKGDKIT----------YSSDYFQEMFDYCVQMIKDGKAYCDDTPTERM-----REERM 308
           G+  D+              SD  +    Y  +++  G AY    P ER+       +++
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAYRCFCPKERLDNLRDSAQKL 173

Query: 309 DGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKI--DYEALNKTLRDPVIYRCNL 366
               +   +R    +    TE+++   ++ +   VR K    Y      L   +  +  +
Sbjct: 174 QPPTTVSYDRHCAHH---STEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDMQPQV 230

Query: 367 TPHHRTGSTWKI-----YPTYDFCVPIVDAIEGVTHALRTIEY 404
            P+        +      PTY F   + D +  +TH +R  E+
Sbjct: 231 NPNDMRYDDPILMKSDGLPTYHFANVVDDHLMKITHVVRGEEW 273

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 173 LKKSANVGKK--KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQ 230
           +KK   +GKK  ++T +   E D P      ++ +FP  PSG LHIGH +  +++    +
Sbjct: 21  VKKLIAIGKKWKQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLNR 79

Query: 231 AYKGK 235
            YK +
Sbjct: 80  FYKQR 84

>KNAG0A02860 Chr1 complement(340606..342465) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 59/130 (45%), Gaps = 24/130 (18%)

Query: 495 NLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMK----------PKHKKNP 544
           N++    + VI P +P  +  +NPV++    TE+ +   VEMK          P   KNP
Sbjct: 279 NVMKTKQRSVIAP-SPMQSNEINPVEVENPATESNEINPVEMKNPATESNEINPVEVKNP 337

Query: 545 AVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDFKK 604
           A        Y D+ V +     ++V  + T     NV  T+K D+G   A  ++  + K+
Sbjct: 338 ATE-----SYADVKVPK----AVSVANKATSPSSNNVKTTEK-DNG---ASTNIANNPKE 384

Query: 605 TKHKLTWLAD 614
           TK  + +L D
Sbjct: 385 TKKDIKFLED 394

>Ecym_6164 Chr6 complement(301696..302592) [897 bp, 298 aa] {ON}
           similar to Ashbya gossypii AFL012C
          Length = 298

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 17/141 (12%)

Query: 296 DDTPTERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRA---KIDYEAL 352
           D     R+ EE+   I +   +R   E +R F+E+     ++GL N V A   KI    +
Sbjct: 139 DGDGARRLEEEQSLFIETCNESRLTSEKVRAFSEDAV--LQQGLVNAVIARYLKIGDYLM 196

Query: 353 NKTLRDPVIYRCNLTPHHRTGSTWKIYPT----YDFCVPIVDAIEGVTHA--LRTIEYRD 406
            K+LR+   +   L+P  R G+ +  YP     Y   + +  AI+  T A  L+ +    
Sbjct: 197 FKSLREQNYF---LSPGARFGARFIAYPGDPLRYHSHMAVQPAIDYYTEAVDLQQVVCGG 253

Query: 407 R---NIQYDWMLQALRLRKVH 424
           R    ++  W+L  +R R+V 
Sbjct: 254 RLGTGVKKLWILGGVRYREVE 274

>Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W
           (CTK1) - alpha subunit of the kinase which
           phosphorylates the RNA polymerase largest subunit CTD
           (carboxyl-terminal domain) [contig 53] FULL
          Length = 461

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 3/84 (3%)

Query: 520 KIHLEGTEAPQEPKVEMKPKHKKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWG 579
           K H+ G E P  PK  +K + + +P   + K+     +  DRE + V    ++V    +G
Sbjct: 85  KQHVNGLELPTGPKTPIKRQSRYDPGNSKPKVAPVSIVSKDRE-SSVYERIQQVGEGTYG 143

Query: 580 NVIITKKNDDGSMVA--KLHLEGD 601
            V   +    G +VA  +L LEG+
Sbjct: 144 KVYKARNTVTGQLVALKRLRLEGE 167

>Skud_4.690 Chr4 (1220089..1222656) [2568 bp, 855 aa] {ON} YDR416W
           (REAL)
          Length = 855

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 24/31 (77%)

Query: 624 VDFDHLITKDRLEEDESFEDFLTPQTEFHTD 654
           ++F++LIT ++L EDE +E+F++  +E + D
Sbjct: 266 LNFNYLITLEKLGEDEQYEEFMSQMSEIYPD 296

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,089,545
Number of extensions: 3499934
Number of successful extensions: 10544
Number of sequences better than 10.0: 74
Number of HSP's gapped: 10796
Number of HSP's successfully gapped: 74
Length of query: 708
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 591
Effective length of database: 40,065,477
Effective search space: 23678696907
Effective search space used: 23678696907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)