Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_6.1257.195ON2252259661e-134
Scer_YGOB_ADL119W (ADL119W)7.195ON96963411e-40
Suva_6.1147.195ON2681172643e-27
CAGL0D05148g7.195ON108791583e-13
KLTH0E04576g7.195ON115831392e-10
Kwal_55.20373singletonOFF115801295e-09
Kwal_YGOB_ADL119W7.195ON115801295e-09
NCAS0E018207.195ON114791207e-08
KNAG0L012307.195ON128651182e-07
KAFR0G029907.195ON110741154e-07
KLLA0D16192g7.195ON121761155e-07
ZYRO0D15818g7.195ON118861111e-06
Kpol_1063.107.195ON122951076e-06
TPHA0C045207.195ON135911061e-05
NDAI0G019907.195ON101561041e-05
TDEL0H025207.195ON119861032e-05
TBLA0J015107.195ON10770971e-04
Ecym_43817.195ON12084890.002
SAKL0F07480g7.195ON11380840.008
ADL119W7.195ON18577672.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_6.125
         (225 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)        376   e-134
Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...   135   1e-40
Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)        106   3e-27
CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...    65   3e-13
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...    58   2e-10
Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...    54   5e-09
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...    54   5e-09
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    51   7e-08
KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.1...    50   2e-07
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    49   4e-07
KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...    49   5e-07
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...    47   1e-06
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...    46   6e-06
TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...    45   1e-05
NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...    45   1e-05
TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...    44   2e-05
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    42   1e-04
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...    39   0.002
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...    37   0.008
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    30   2.6  

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score =  376 bits (966), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 187/225 (83%), Positives = 187/225 (83%)

Query: 1   MPFRVYRDKVSDFIKDAALELQVVYEPVYSARSCTAHGLWWCAFXXXXXXXXXXXXFPHH 60
           MPFRVYRDKVSDFIKDAALELQVVYEPVYSARSCTAHGLWWCAF            FPHH
Sbjct: 1   MPFRVYRDKVSDFIKDAALELQVVYEPVYSARSCTAHGLWWCAFLSSSPGSSLLLLFPHH 60

Query: 61  DFFPRYIHFSVAKTLLPNIPRERPGQPFACRNVXXXXXXXXXXXQKTLYTHTRQGKARQD 120
           DFFPRYIHFSVAKTLLPNIPRERPGQPFACRNV           QKTLYTHTRQGKARQD
Sbjct: 61  DFFPRYIHFSVAKTLLPNIPRERPGQPFACRNVREKRESEKKKSQKTLYTHTRQGKARQD 120

Query: 121 SRKNCGTLEMNVPLAPTPNRHLNIPDLRFEKVFKKALHRELAPSSSVPSKWAVITKVVVR 180
           SRKNCGTLEMNVPLAPTPNRHLNIPDLRFEKVFKKALHRELAPSSSVPSKWAVITKVVVR
Sbjct: 121 SRKNCGTLEMNVPLAPTPNRHLNIPDLRFEKVFKKALHRELAPSSSVPSKWAVITKVVVR 180

Query: 181 DVLLMPLLQSFVLSLVLMGVKDWLRFIXXXXXXXXXXXXXXXFPI 225
           DVLLMPLLQSFVLSLVLMGVKDWLRFI               FPI
Sbjct: 181 DVLLMPLLQSFVLSLVLMGVKDWLRFIRLEGRTLGGRLRQRLFPI 225

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 96

 Score =  135 bits (341), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 70/96 (72%), Positives = 74/96 (77%)

Query: 130 MNVPLAPTPNRHLNIPDLRFEKVFKKALHRELAPSSSVPSKWAVITKVVVRDVLLMPLLQ 189
           MNVP APTPN+HLNIPDLRFEKVFKKALHRELAPSSS+  K  VITKVVVRDVLLMPLLQ
Sbjct: 1   MNVPTAPTPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAGVITKVVVRDVLLMPLLQ 60

Query: 190 SFVLSLVLMGVKDWLRFIXXXXXXXXXXXXXXXFPI 225
           SFVLSL LMGVK+WL +I               FPI
Sbjct: 61  SFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLFPI 96

>Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)
          Length = 268

 Score =  106 bits (264), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 80/117 (68%), Gaps = 2/117 (1%)

Query: 109 YTHTRQGKARQDSRKNCGTLEMNVPLAPTPNRHLNIPDLRFEKVFKKALHRELAPSSSVP 168
           YTH     + Q +  NCG   MNVP APTPN+ LNIPDLRF KVF++AL+R+L PS+S  
Sbjct: 154 YTHNTSLVSGQHT-SNCGN-TMNVPSAPTPNKQLNIPDLRFGKVFERALYRDLTPSASRS 211

Query: 169 SKWAVITKVVVRDVLLMPLLQSFVLSLVLMGVKDWLRFIXXXXXXXXXXXXXXXFPI 225
            K AV+ KVVVRDVLLMPL+QS VLS+VL+GVKDWLR+I               FPI
Sbjct: 212 RKLAVVAKVVVRDVLLMPLVQSIVLSVVLIGVKDWLRYIRLKGFTLGARLRQRLFPI 268

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {ON}
           some similarities with KLLA0D16192g Kluyveromyces lactis
           and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 10/79 (12%)

Query: 139 NRHLNIPDLRFEKVFKKALHRELAPSSSVPSKWA----------VITKVVVRDVLLMPLL 188
           N  + IPD RFE+ F++A+ RE+A  +++  K            VI KVVVRDVLLMP +
Sbjct: 2   NGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPFI 61

Query: 189 QSFVLSLVLMGVKDWLRFI 207
           QS + +  L+G+K WLR +
Sbjct: 62  QSVLWTGFLLGLKPWLRMV 80

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {ON}
           conserved hypothetical protein
          Length = 115

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 12/83 (14%)

Query: 137 TPNRHLNIPDLRFEKVFKKALHRELAPSSSVPSKW------------AVITKVVVRDVLL 184
           T  + + +PDLRFE+ F++AL RE + +    S+             +VI KVV+RDVLL
Sbjct: 8   TGAQKVAVPDLRFEQTFQRALRREASKNQKATSQGHSTTDADATISASVICKVVLRDVLL 67

Query: 185 MPLLQSFVLSLVLMGVKDWLRFI 207
           MP LQ  + +  L+ +K WL  +
Sbjct: 68  MPFLQGILWTSALIALKPWLHMV 90

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {OFF}
           [contig 149] FULL
          Length = 115

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 13/80 (16%)

Query: 137 TPNRHLNIPDLRFEKVFKKALHRELAPS------------SSVPSKWAVITKVVVRDVLL 184
           TP + ++IPDLRFE+ FK AL RE   +            S  P   ++I KVV+RDVLL
Sbjct: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLL 67

Query: 185 MPLLQSFVLSLVLMGVKDWL 204
           +P LQ  + + VL+ ++ WL
Sbjct: 68  LPFLQGALWTGVLIAMRPWL 87

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 115

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 13/80 (16%)

Query: 137 TPNRHLNIPDLRFEKVFKKALHRELAPS------------SSVPSKWAVITKVVVRDVLL 184
           TP + ++IPDLRFE+ FK AL RE   +            S  P   ++I KVV+RDVLL
Sbjct: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLL 67

Query: 185 MPLLQSFVLSLVLMGVKDWL 204
           +P LQ  + + VL+ ++ WL
Sbjct: 68  LPFLQGALWTGVLIAMRPWL 87

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
           Anc_7.195
          Length = 114

 Score = 50.8 bits (120), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 15/79 (18%)

Query: 142 LNIPDLRFEKVFKKALHRELA----------PSSSVPS-----KWAVITKVVVRDVLLMP 186
           LNIPDLR E+ FK+A+ +E            P S++       K  + +KV++RD+L+MP
Sbjct: 6   LNIPDLRVEQTFKRAVAKETKEYIIKNKATFPRSTITELTRVEKAVICSKVILRDILVMP 65

Query: 187 LLQSFVLSLVLMGVKDWLR 205
            LQS   +  L+ +K WLR
Sbjct: 66  FLQSVAWTGFLIVLKPWLR 84

>KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 128

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 142 LNIPDLRFEKVFKKALHRELAPSS-SVPSKWAVITKVVVRDVLLMPLLQSFVLSLVLMGV 200
           + IP++RF  VF  AL  E A  + + P+ W ++ KVV +DVLLMP LQSF+ + +L+ +
Sbjct: 34  IKIPEMRFNYVFNNALKAEAARHNVAEPTTW-MVCKVVCKDVLLMPFLQSFLWTALLISM 92

Query: 201 KDWLR 205
           K  L+
Sbjct: 93  KTPLK 97

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 110

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 7/74 (9%)

Query: 139 NRHLNIPDLRFEKVFKKALHREL-------APSSSVPSKWAVITKVVVRDVLLMPLLQSF 191
           N +L IPD RF  VF+KA+ +EL          +   +K  +I KV+ RDV+LMP +QS 
Sbjct: 9   NNNLAIPDTRFGYVFRKAVQKELRKQVKETDSDNKHINKNLIICKVIARDVILMPFIQSI 68

Query: 192 VLSLVLMGVKDWLR 205
           + +  L+  K  LR
Sbjct: 69  LWTGFLISFKPCLR 82

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
           conserved hypothetical protein
          Length = 121

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (56%), Gaps = 12/76 (15%)

Query: 143 NIPDLRFEKVFKKALHRE----------LAPSSSV--PSKWAVITKVVVRDVLLMPLLQS 190
           ++PDLRFE+ FK++L +E          +A  S V  P    ++ KVV RD+L+ P LQ 
Sbjct: 17  SLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQG 76

Query: 191 FVLSLVLMGVKDWLRF 206
             LSL  +  K WL++
Sbjct: 77  VFLSLFYIVAKPWLQY 92

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
           conserved hypothetical protein
          Length = 118

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 42/86 (48%), Gaps = 22/86 (25%)

Query: 144 IPDLRFEKVFKKALHRE----------------------LAPSSSVPSKWAVITKVVVRD 181
           IPD RFE  FK+AL+RE                      L  +  V     V+ KVV RD
Sbjct: 7   IPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVCKVVARD 66

Query: 182 VLLMPLLQSFVLSLVLMGVKDWLRFI 207
           V+ MPL+Q  + + +L+ +K WLR +
Sbjct: 67  VIFMPLVQGLLWTSLLITMKPWLRSV 92

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
           complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 22/95 (23%)

Query: 134 LAPTPNRHLNIPDLRFEKVFKKALHRELAPSSSVPSKWAVIT------------------ 175
           +AP P  +  +PD+RFE+ F +A+++E         K   +T                  
Sbjct: 3   VAPGPT-NFPVPDVRFEETFNRAINKEAEKQREYSLKKKGLTTDEISKIKENEAPEVTTY 61

Query: 176 ---KVVVRDVLLMPLLQSFVLSLVLMGVKDWLRFI 207
              KV+VRD+L+MP +Q  + S +L+ +K WLR +
Sbjct: 62  IVWKVIVRDMLIMPFIQGIMFSGLLIILKPWLRSV 96

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 21/91 (23%)

Query: 138 PNRHLNIPDLRFEKVFKKALHRE-------------------LAPSSSVPSKWA--VITK 176
           P   L +PD+R E+ F  AL +E                   L    + P+     ++ K
Sbjct: 19  PQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWK 78

Query: 177 VVVRDVLLMPLLQSFVLSLVLMGVKDWLRFI 207
           V++RD++LMP +Q  + + +LM VK WLR +
Sbjct: 79  VILRDMILMPFIQGALFTGLLMAVKPWLRGV 109

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
           Anc_7.195
          Length = 101

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 9/56 (16%)

Query: 144 IPDLRFEKVFKKALHRE---LAPSSSVPSKWAVIT------KVVVRDVLLMPLLQS 190
           IPD RF++VF+ AL RE   L P ++  +   ++T      KV++RDV+L+P +QS
Sbjct: 6   IPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQS 61

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 26/86 (30%)

Query: 144 IPDLRFEKVFKKALHRELAPSSSVPSKW------------------------AVITKVVV 179
           +PD RFE+ F++AL RE     +  ++W                         V+ KVV+
Sbjct: 7   VPDTRFEQTFRRALTREAEKHRA--AQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVL 64

Query: 180 RDVLLMPLLQSFVLSLVLMGVKDWLR 205
           RDV+ MPL+Q  + + VL+ +K WL+
Sbjct: 65  RDVIFMPLVQGLLWTGVLIAMKPWLK 90

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 144 IPDLRFEKVFKKALHREL----APSSSVPS-----KWAVITKVVVRDVLLMPLLQSFVLS 194
           IPD RFE  F++ L +EL      S+S+       K   + KV+ RDV+ MP +Q   + 
Sbjct: 12  IPDTRFESTFRRKLDKELNKNNVNSNSIIKDERVRKLLCLGKVICRDVIFMPFVQGMFMC 71

Query: 195 LVLMGVKDWL 204
              + +K WL
Sbjct: 72  GAFILIKPWL 81

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
           similar to Ashbya gossypii ADL119W
          Length = 120

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 20/84 (23%)

Query: 142 LNIPDLRFEKVFKKALHRE-----------LAPSSSV--------PSKWA-VITKVVVRD 181
           L IPD+RFE+ F  AL +E           L  S  +        P+    V+ KV+VRD
Sbjct: 6   LAIPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSEDFGEPTITTFVVAKVIVRD 65

Query: 182 VLLMPLLQSFVLSLVLMGVKDWLR 205
           V+L+PL+   + +  L+ +K WL+
Sbjct: 66  VVLLPLVHGMLWTGFLIMMKPWLK 89

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserved
           hypothetical protein
          Length = 113

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 11/80 (13%)

Query: 137 TPNRHLNIPDLRFEKVFKKALHRE-----------LAPSSSVPSKWAVITKVVVRDVLLM 185
           TP + + +PD RFE+ FK AL +E                + P    V+ KVVVRDVLLM
Sbjct: 7   TPIQTIVVPDTRFEQTFKNALKKEAKRMKAARLGITTLDDNAPVTPMVVAKVVVRDVLLM 66

Query: 186 PLLQSFVLSLVLMGVKDWLR 205
           PL+Q  + +  L+ +K WLR
Sbjct: 67  PLVQGVLWTSFLIAIKPWLR 86

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 14/77 (18%)

Query: 139 NRHLNIPDLRFEKVFKKALHRELA---------PSSSVPSKWAVITKVVVRD-----VLL 184
            + + IPD+RFE+ F+ AL +E A            +     A I+ +VV       VLL
Sbjct: 77  RKAITIPDVRFEQTFRAALAKESARQRQLRAQKEGEAAADGEAGISALVVAKVVVRDVLL 136

Query: 185 MPLLQSFVLSLVLMGVK 201
           MPL+Q  + + +L+ +K
Sbjct: 137 MPLVQGALWTGLLITMK 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,918,255
Number of extensions: 657197
Number of successful extensions: 1618
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1625
Number of HSP's successfully gapped: 21
Length of query: 225
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 119
Effective length of database: 41,326,803
Effective search space: 4917889557
Effective search space used: 4917889557
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)