Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.346.7ON1019101947670.0
Suva_5.136.7ON1023102039760.0
YEL055C (POL5)6.7ON1022102239730.0
Smik_5.326.7ON1020102039610.0
NCAS0F001806.7ON1018103824640.0
KAFR0L003306.7ON1028104821510.0
KNAG0E009706.7ON1004103020800.0
KLLA0D00792g6.7ON1020105419090.0
NDAI0K029106.7ON106373917770.0
ACR020C6.7ON1002104017650.0
ZYRO0F00440g6.7ON103971117570.0
Kwal_56.223346.7ON1008104317120.0
TDEL0G046406.7ON101771017040.0
TBLA0A072106.7ON1041105816560.0
KLTH0C11594g6.7ON1006104716280.0
Kpol_1045.806.7ON101970716020.0
SAKL0E00770g6.7ON104774514920.0
CAGL0B03553g6.7ON102171413511e-169
Ecym_30096.7ON102773413311e-166
TPHA0J002506.7ON102471712981e-161
ABR142W5.31ON195979791.4
Kwal_56.236718.292ON65789781.6
KLTH0A02684g8.69ON2140128781.6
KLTH0G12980g8.292ON63789772.1
KLLA0B10032gsingletonOFF192105733.1
Klac_YGOB_OAZ18.504ON272105743.5
Skud_16.500singletonON70493753.7
Suva_10.3348.407ON32854734.9
YLR239C (LIP2)8.407ON32854725.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.34
         (1019 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...  1840   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...  1536   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...  1535   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...  1530   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   953   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   833   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   805   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   739   0.0  
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   689   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   684   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   681   0.0  
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   664   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   660   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   642   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   631   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   621   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   579   0.0  
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   525   e-169
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   517   e-166
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   504   e-161
ABR142W Chr2 (664880..670759) [5880 bp, 1959 aa] {ON} Syntenic h...    35   1.4  
Kwal_56.23671 s56 (649753..651726) [1974 bp, 657 aa] {ON} YLR103...    35   1.6  
KLTH0A02684g Chr1 complement(227861..234283) [6423 bp, 2140 aa] ...    35   1.6  
KLTH0G12980g Chr7 (1112178..1114091) [1914 bp, 637 aa] {ON} high...    34   2.1  
KLLA0B10032g Chr2 (879469..880047) [579 bp, 192 aa] {OFF} conser...    33   3.1  
Klac_YGOB_OAZ1 Chr2 (879228..879488,879490..880047) [819 bp, 272...    33   3.5  
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    33   3.7  
Suva_10.334 Chr10 complement(582909..583895) [987 bp, 328 aa] {O...    33   4.9  
YLR239C Chr12 complement(616332..617318) [987 bp, 328 aa] {ON}  ...    32   5.4  

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score = 1840 bits (4767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 927/1019 (90%), Positives = 927/1019 (90%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120
            SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE
Sbjct: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180
            RGI            NEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180

Query: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240
            LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS
Sbjct: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240

Query: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300
            GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG
Sbjct: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300

Query: 301  SGKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAT 360
            SGKLENTEHIT          VQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAT
Sbjct: 301  SGKLENTEHITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAT 360

Query: 361  FKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCLN 420
            FKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCLN
Sbjct: 361  FKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCLN 420

Query: 421  AMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFIL 480
            AMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFIL
Sbjct: 421  AMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFIL 480

Query: 481  DSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGEL 540
            DSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGEL
Sbjct: 481  DSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGEL 540

Query: 541  TINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISKS 600
            TINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISKS
Sbjct: 541  TINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISKS 600

Query: 601  NTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNNSMVGITEILLSFLAQKKA 660
            NTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNNSMVGITEILLSFLAQKKA
Sbjct: 601  NTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNNSMVGITEILLSFLAQKKA 660

Query: 661  LLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFXXXXXXXXXXXXXXXXXX 720
            LLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF                  
Sbjct: 661  LLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFEGEGEFEEINEEENANEG 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATGALIKALHLPDNIVNDKGEVDM 780
                                         VVNIDKEATGALIKALHLPDNIVNDKGEVDM
Sbjct: 721  DSKSESESESESDSDESNEKDEEDEANEDVVNIDKEATGALIKALHLPDNIVNDKGEVDM 780

Query: 781  NQLGGXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKVEVKESREN 840
            NQLGG                       QLSEIFKRRKEALSNISTGNQRKVEVKESREN
Sbjct: 781  NQLGGLSDDDDDEDEESMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKVEVKESREN 840

Query: 841  VISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPL 900
            VISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPL
Sbjct: 841  VISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPL 900

Query: 901  ADKISKLLKGKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTSS 960
            ADKISKLLKGKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTSS
Sbjct: 901  ADKISKLLKGKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTSS 960

Query: 961  LFLSKLYFEIGGNNALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQNVLDKK 1019
            LFLSKLYFEIGGNNALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQNVLDKK
Sbjct: 961  LFLSKLYFEIGGNNALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQNVLDKK 1019

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
            YEL055C (REAL)
          Length = 1023

 Score = 1536 bits (3976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 784/1020 (76%), Positives = 856/1020 (83%), Gaps = 5/1020 (0%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSD+EEWSYVLNRLIKGLASDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120
            SARLGFSLCLTEV+NL +NMPSGQRPKGLES N+FLDTLS ILDI VN+  KKPVKGKDE
Sbjct: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180
            RGI            NEPLFS IFV+D+K+GNTEF+IRFMEQLIDLALRKNWI+EPCL+S
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180

Query: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240
            LFQTIKMLLP MNESTA +ILL YDKYDLTLTNEGLSTYL+LKYESD+ L+PSTL L+N 
Sbjct: 181  LFQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYESDKDLVPSTLGLKNL 240

Query: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQD-AKKQKNANWNPRLHFVWDVLLPLF 299
            GWKNNDPLARGNLPLLTKVLRDS+V PDTNGK QD  KKQKN NWNPRLHFVW++LLPLF
Sbjct: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300

Query: 300  GSGKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDA 359
            GSGKLEN EHI+          V +SIQFPEFW+MAVDESFFNEKASSERKYLGFLIIDA
Sbjct: 301  GSGKLENAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360

Query: 360  TFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCL 419
            TFKTVPGSCIG CFS+NVMRTLINQSIDSQRILNKIAQITL+SI+KACEEDP+ KLVPCL
Sbjct: 361  TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420

Query: 420  NAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFI 479
            +AMLFGPHGSINFDKLTK++I SKLIAIKELP+ VL QL + F+LQLQEK+ DLPHTHF+
Sbjct: 421  SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQEKKDDLPHTHFV 480

Query: 480  LDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGE 539
            LDSLLHIIRAHK EINDV IIKPVL+PI++MAFFKHATD++E EQLHELAKERLYSILGE
Sbjct: 481  LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540

Query: 540  LTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISK 599
            LTINKE+ SEDPQINSWQ+LTL LILD+EKS+K DL NPLDE LEK KNEAISSL EISK
Sbjct: 541  LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEISK 600

Query: 600  SNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNNSMVGITEILLSFLAQKK 659
            SNT+QSWGLSTLLSMCLIQLYAGETDSISVIEELCEF K +N+SMVGITEILLS LAQKK
Sbjct: 601  SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSSMVGITEILLSLLAQKK 660

Query: 660  ALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFXXXXXXXXXXXXXXXXX 719
            ALL+KLSLIIWQQFI DVGL+ELQILLDVLK RENKQGFA LF                 
Sbjct: 661  ALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLFEGEGEFEEVDEEESAVE 720

Query: 720  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATGALIKALHLPDNIVNDKGEVD 779
                                          VVNIDKEAT ALIKAL+LPDNIVNDKGEVD
Sbjct: 721  DESKSESESDSDSESNDDEERDEEDEANEDVVNIDKEATSALIKALNLPDNIVNDKGEVD 780

Query: 780  MNQLGGXXXXXXXXXXXXXXXXXXXXXXX----QLSEIFKRRKEALSNISTGNQRKVEVK 835
            M+QL G                           QLSEIFKRRKEALS+ISTGNQRKVEVK
Sbjct: 781  MDQLEGISDDGDGGDDDEDEESMDDEKMMELDDQLSEIFKRRKEALSSISTGNQRKVEVK 840

Query: 836  ESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRET 895
            ESRENVI+FKHRIVDMLT+YVK+CEKLAIANK E S  + GPLS LVYFI+PM+KCI+ET
Sbjct: 841  ESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKET 900

Query: 896  LDKPLADKISKLLKGKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSA 955
            LD+PLADKISKLLKGKIFKI+ + FK LDK IEL++LLKS H+ MLTSKPGQHA+VFFSA
Sbjct: 901  LDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSA 960

Query: 956  CSTSSLFLSKLYFEIGGNNALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQNV 1015
            CSTSSLFLSKLY +I GN+  D+LIDLYA+TTK+W  KGKF  N+FIDF NWLSSKK+ V
Sbjct: 961  CSTSSLFLSKLYVDINGNDKFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKEGV 1020

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
            POL5DNA Polymerase phi; has sequence similarity to the
            human MybBP1A and weak sequence similarity to B-type DNA
            polymerases, not required for chromosomal DNA
            replication; required for the synthesis of rRNA
          Length = 1022

 Score = 1535 bits (3973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 761/1022 (74%), Positives = 848/1022 (82%), Gaps = 3/1022 (0%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            MTGKVNRDLFFKLASDL+EERLHAAVALIKDLSAL+LP DAEEWSYVLNRLIKGL+SDRN
Sbjct: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120
            SARLGFSLCLTEV+NL +NMP GQRPKGLES NEFL TLS+IL++ VN+G+KK +KGKDE
Sbjct: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180
            RGI            NEPLFSEIFV D++KGNTEF IRF EQLIDLAL+KNWI+EPC F+
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180

Query: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240
            LFQT+KMLLPFM+ES+A KILLIYDKYDLTLTNEGLSTYL+LKYE DESLIPS LDL+N 
Sbjct: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240

Query: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300
            GWK+NDPLARGNLPLLTKVLR+SSV+PD NG L++ KKQKN NWNPRLHFVW VLLPLFG
Sbjct: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300

Query: 301  SGKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAT 360
            +GKLENT HI+          VQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDA 
Sbjct: 301  NGKLENTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAA 360

Query: 361  FKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCLN 420
            FK VPGS IG CFSQNVMRTLINQSIDSQR+LNKI+Q+TL+SIVKACEED   +LVPCLN
Sbjct: 361  FKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCLN 420

Query: 421  AMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFIL 480
            AMLFGPHGSINFDKLTKS  +SKLIAIKELPS VLAQL+  F LQLQ+K+G L HT F L
Sbjct: 421  AMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKKGVLSHTLFAL 480

Query: 481  DSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGEL 540
            DS+LHI+RAHKVEIND+ I+KPVL PI++MAFFKH +D+ + EQLHELAKERLYSILGEL
Sbjct: 481  DSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGEL 540

Query: 541  TINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISKS 600
            TINKE+  +DP+INSWQYLTL LILDIE S+  DLINPLDE+LE IKNEAIS L+++ +S
Sbjct: 541  TINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCLSKVCRS 600

Query: 601  NTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNNSMVGITEILLSFLAQKKA 660
             T QSWGLSTLLSMCL+QLYAG+TDSISVIEELCEF+KH+NNSMVGITEILLS LAQKKA
Sbjct: 601  RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNSMVGITEILLSLLAQKKA 660

Query: 661  LLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFXXXXXXXXXXXX--XXXX 718
            LLRKLSLIIWQQFIE+VGLEELQILLD+LKARENKQGFAQLF                  
Sbjct: 661  LLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFEGEEEFEEIKEENDASED 720

Query: 719  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATGALIKALHLPDNIVNDKGEV 778
                                           ++NIDKEAT AL+KAL+LPDNIVNDKGEV
Sbjct: 721  ESKTGSESESESESDSDDADEKDEEDEANEDILNIDKEATSALVKALNLPDNIVNDKGEV 780

Query: 779  DMNQLGGXXXXXXXXXXXXXXXXXXXXXX-XQLSEIFKRRKEALSNISTGNQRKVEVKES 837
            D++QL G                        QLSEIFKRRKEALS+ISTGNQRK EVK+S
Sbjct: 781  DLDQLEGLSDDGGDDEDEESMDDEKMMELDDQLSEIFKRRKEALSSISTGNQRKFEVKQS 840

Query: 838  RENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLD 897
            RENVISFKHR+VDML VYVKYCEKL +ANK E+S+NL G LSKLVYFI+PMLKC+ ETLD
Sbjct: 841  RENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLD 900

Query: 898  KPLADKISKLLKGKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACS 957
            +PLADKISKLLKGKIFKIK   FK ++K+IELM+LLK TH+LMLTSKPGQHA+VF+S CS
Sbjct: 901  RPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCS 960

Query: 958  TSSLFLSKLYFEIGGNNALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQNVLD 1017
            TSSLFLSKLY EIGGN+ LDELIDLY ATTKEWM KGK   N+FIDF NWLSSKKQ V+D
Sbjct: 961  TSSLFLSKLYVEIGGNDKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTVMD 1020

Query: 1018 KK 1019
            K+
Sbjct: 1021 KE 1022

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
            YEL055C (REAL)
          Length = 1020

 Score = 1530 bits (3961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 774/1020 (75%), Positives = 861/1020 (84%), Gaps = 1/1020 (0%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            MTGKVNRDLFFKLASDLQEERLHAAVALI+DLSAL LPSDAEEW YVLNRL+KGLASDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120
            SARLGFSLCLTEV+NL INMPSGQRPKGLES N+FL+TLSS+LD+ VNDG KK VKGKDE
Sbjct: 61   SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180
            RGI            NEPLFSEIF+ + + GNT+F IRF E+LIDLAL+KNWI+EPC F+
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFT 180

Query: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240
            LFQTIKMLLPF++ES A KILLIYDKY++TLTNEGLSTYL+LKY  D++LIPSTLDL+N 
Sbjct: 181  LFQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYGGDKNLIPSTLDLKNL 240

Query: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300
            GWK++DPLARGNLPLLTKVLRDSSV+PDT+GK +D KKQKN NWNPRLHFVWD+LLPLFG
Sbjct: 241  GWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWDILLPLFG 300

Query: 301  SGKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAT 360
            SGKLENTEH++          VQNSIQFPEFWKMA+DESFFNEKASSERKYLGFLIIDA 
Sbjct: 301  SGKLENTEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLGFLIIDAA 360

Query: 361  FKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCLN 420
            FKTVPGS IGSCFSQNVMRTLINQSIDSQR+LNKIAQITL SIVKACEED   KLVPCLN
Sbjct: 361  FKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTNKLVPCLN 420

Query: 421  AMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFIL 480
            +MLFGPHGS+NFDKLTKS+ +SKLIAIKELPS VL QL++ FL QLQ+ + DL HTHFIL
Sbjct: 421  SMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSKRDLTHTHFIL 480

Query: 481  DSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGEL 540
            DS+LHIIRAHKVEI+D+ ++KP+LTPII+MAFFK ATD+QE EQLHELAKERL+SILGEL
Sbjct: 481  DSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDDQELEQLHELAKERLFSILGEL 540

Query: 541  TINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISKS 600
            T+NKE++SEDP+INSWQ+LTL LILD+EKS++  LINPLDE+LEK K EAISSLAEIS+S
Sbjct: 541  TMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTKEEAISSLAEISRS 600

Query: 601  NTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNNSMVGITEILLSFLAQKKA 660
            +T Q+WGLSTLLSMCLIQLYAGETDSISVIEELCEF+K  NNSMVGITEILLS LAQKKA
Sbjct: 601  STAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEFSKDKNNSMVGITEILLSLLAQKKA 660

Query: 661  LLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFXXXXXXXXXXXXXXXXXX 720
            LL+KLSLIIWQQFIEDVGLEELQ+LLDVLKARENKQGFAQLF                  
Sbjct: 661  LLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQLFEGEGEFEEIKEEESASED 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATGALIKALHLPDNIVNDKGEVDM 780
                                         VVNIDKEAT AL+KAL+LPDNIVNDKGEVD+
Sbjct: 721  ESKSEGDSESESNSDDADEKDEEDDANEEVVNIDKEATSALVKALNLPDNIVNDKGEVDI 780

Query: 781  NQLGGXXXXXXXXXXXXXXXXXXXXXXX-QLSEIFKRRKEALSNISTGNQRKVEVKESRE 839
            +QL G                        QLSEIFKRRKEALSNISTGNQRKVEVKESRE
Sbjct: 781  DQLEGLSDDDEDDEDEESMDDEKMMELDGQLSEIFKRRKEALSNISTGNQRKVEVKESRE 840

Query: 840  NVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKP 899
            NVISFKHRIVDMLTVYVKYCEKLA+ANK E+SS++  PLSKLVYFI+P+LKCI ETLD+P
Sbjct: 841  NVISFKHRIVDMLTVYVKYCEKLALANKSEDSSSIGSPLSKLVYFIIPILKCINETLDRP 900

Query: 900  LADKISKLLKGKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTS 959
            LADKISKLLKGKIFKIK N FK +DKNIE+M+LLKSTH+++LTSKPGQH +VF+SACSTS
Sbjct: 901  LADKISKLLKGKIFKIKVNAFKEMDKNIEVMDLLKSTHKVLLTSKPGQHPAVFYSACSTS 960

Query: 960  SLFLSKLYFEIGGNNALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQNVLDKK 1019
            SLFLSKLY EI GN+ LDELIDLYAATTKEW  +GKF  NVFIDF NWLSSKKQNV D+K
Sbjct: 961  SLFLSKLYVEIHGNDKLDELIDLYAATTKEWTNRGKFGANVFIDFINWLSSKKQNVEDEK 1020

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/1038 (51%), Positives = 687/1038 (66%), Gaps = 46/1038 (4%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            M  KVNRDLF+KLASDLQEER  AA++L+K+L+ L LP + EEW+YV+NRLIKGLASDR+
Sbjct: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVN---DGSKKPVKG 117
            SARLGFSLCLTEV+NL ++M     P+GL++ ++FL  LS  L +  N    G+ K  KG
Sbjct: 61   SARLGFSLCLTEVINLALSMKENA-PEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119

Query: 118  KDERGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTE---FVIRFMEQLIDLALRKNWIR 174
            +DERG+            NEP+FS +F+   K G TE   F  +FM +++DLAL+KNWI+
Sbjct: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTK-KDGKTEITPFAFKFMNEVVDLALKKNWIK 178

Query: 175  EPCLFSLFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKY--ESDESLIP 232
            E CLF+LFQTI+ LLP+ N+ T + IL + D ++L+LT+EGL+ YL + Y   +D  L  
Sbjct: 179  ESCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDT 238

Query: 233  STLDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVW 292
            S+++ +N GWKNNDPL+RGNLPLLT+VLRDSSV   + G  +++KKQ  +NWNPRLHFVW
Sbjct: 239  SSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEG-YENSKKQNASNWNPRLHFVW 297

Query: 293  DVLLPLFGSGK---LENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSER 349
            D+LLP+  SGK     NT+HI+           ++ I+FPEFW+M VDESFFNEKASSER
Sbjct: 298  DILLPILISGKHTTASNTQHISKKRKKNNNELPKH-IEFPEFWQMVVDESFFNEKASSER 356

Query: 350  KYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEE 409
            KYLGFLI   T K V  + + +CFS N MR+LINQS DS+R+L+K++Q  L +I++ C+E
Sbjct: 357  KYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQE 416

Query: 410  DPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEK 469
            D   KLV C+NAM+FGP GSINFDKLTKS  ISKLI+I  L    LA L   F   + EK
Sbjct: 417  DSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEK 476

Query: 470  RGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELA 529
              +     ++LD+LLHI+R HK  +    I+ P+L P+I  AFF      +E E L+ELA
Sbjct: 477  SENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFA-----KENEPLNELA 531

Query: 530  KERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNE 589
            KER  SIL ELT    V  ++P  +SWQY  L++IL  E++ K +L+N LDE+L KIKN+
Sbjct: 532  KERFSSILAELT---SVIPKEPH-HSWQYYALDIILKKERTGKFELVNKLDENLGKIKND 587

Query: 590  AISSLAEISKS-NTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKH-----DNNS 643
            A   + +I KS  + Q  GL +LLSMCL+QL++GET+S+S IEEL EF K      ++ S
Sbjct: 588  ACDVIVKIIKSPQSPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDTESTS 647

Query: 644  MVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFX 703
            +VGITEILLS LAQKKA+LRKLSL++W+QFI +VG EEL ILLDVLKARENKQGFA LF 
Sbjct: 648  LVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFE 707

Query: 704  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXVVNIDKEATGAL 761
                                                            V NIDKEAT AL
Sbjct: 708  GADEYEEIEDEQEGESNQSEEKDVSGEESEESEESEIDDEDDSLDTAEVNNIDKEATSAL 767

Query: 762  IKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXXXX-----QLSEIFKR 816
             KAL+LP+NIVNDKGEVD+ +L                              QLSEIFKR
Sbjct: 768  AKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMMLLDDQLSEIFKR 827

Query: 817  RKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEG 876
            RKEALS  STGNQRK+E KESRENVI+FK R+VD+LTVYVKY EKL  A+  +   N   
Sbjct: 828  RKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQKFVN--- 884

Query: 877  PLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDKNIELMNLLKST 936
                L+ F+ PM+ C+++TLDK LADK+SKLLK +IFKIK++TFK     +E++  LK  
Sbjct: 885  ----LISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVEVLEYLKKL 940

Query: 937  HELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGN--NALDELIDLYAATTKEWMLKG 994
            HE +LT KPGQH  ++++  S++SLF SK+Y     +  NA ++LID Y+ TTK WM K 
Sbjct: 941  HEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKS 1000

Query: 995  KFSTNVFIDFTNWLSSKK 1012
            KF  N F DF NWL+S+K
Sbjct: 1001 KFGPNFFADFFNWLASRK 1018

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1028

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1048 (46%), Positives = 653/1048 (62%), Gaps = 62/1048 (5%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            M+GKVNRDLF+KLAS+L EERL AAV++I++LSAL+LP   EEW+YVL RLIKGL+SDR 
Sbjct: 4    MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 61   SARLGFSLCLTEVVNLGINMPS-GQRPKGLESKNEFLDTLSSILDIYV-NDGSKKPVKGK 118
             ARLGFSLCLTEV+NL I++   G     L + +++L  LS  L I   N  + K +KGK
Sbjct: 64   GARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGK 123

Query: 119  DERGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCL 178
            DERG+            NEPLFS+ F+ + KK  + F  RFM +L+DLA RKNWIREPCL
Sbjct: 124  DERGLLFGKMFGLKALLNEPLFSKTFLPN-KKVASNFCERFMVELLDLASRKNWIREPCL 182

Query: 179  FSLFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIP-----S 233
            F+LFQT++ LLPF +      +L + D +  TLTNEGL+ YL+L ++  E          
Sbjct: 183  FTLFQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKIK 242

Query: 234  TLDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWD 293
             L L+NS WK NDPLARGNLP LT+VLR+SS+  +     +   +  +ANW PRLHFVWD
Sbjct: 243  LLVLKNSSWKLNDPLARGNLPRLTQVLRESSLASE-----EKKVEVMSANWQPRLHFVWD 297

Query: 294  VLLPLFGSGKLENTE-HITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYL 352
            +LLP   + +  + E H++              I+FPEFW+M VDESFFNEKASSERKYL
Sbjct: 298  ILLPTVSTIESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKYL 357

Query: 353  GFLIIDATFKTVPGSCIG-SCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDP 411
            GF I +     V       +CFSQN MR+LINQS D+ R+L+KI+   + +IVKACEE P
Sbjct: 358  GFSIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEESP 417

Query: 412  IKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRG 471
              KL+P ++++LF  +GS NFDKLTKS  +SKLI+I  L    L QL      Q++    
Sbjct: 418  STKLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGTS 477

Query: 472  -DLPHTHFILDSLLHIIRAHKVEINDVG--------IIKPVLTPIIHMAFFKH---ATDE 519
             D   T FILDSLLHI+R+HK +I D          IIK  + P++ +AFF     A  E
Sbjct: 478  EDFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDIAKKE 537

Query: 520  QEFE-QLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINP 578
             E + Q+ ELAKERL+S+L ELT      + + Q++SWQY TL  I+D E      LIN 
Sbjct: 538  DESDNQVDELAKERLFSVLSELT-----TTTNKQLHSWQYYTLLEIIDRENENPNSLINK 592

Query: 579  LDESLEKIKNEAISSLAEISKSN--TTQSW--GLSTLLSMCLIQLYAGETDSISVIEELC 634
            +D+ L+ +++ AI  +  I+  N  TT S   GL +LLSMCL+QLY+G+ DS++ IEEL 
Sbjct: 593  MDDDLKTVRDNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEELI 652

Query: 635  EFTK-----HDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVL 689
             F        +  +MVGITEILLS LAQKKA+L+KLSL++W+QF+ ++  + L +LLDVL
Sbjct: 653  TFYNASRDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLDVL 712

Query: 690  KARENKQGFAQLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-- 747
             ARENKQGFA+LF                                               
Sbjct: 713  PARENKQGFAELFENADEYEEDDEEENEYKEENESDDESSSDDEDDEEGDEDDEGAEGGN 772

Query: 748  XXVVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXXX 807
              +  IDKEAT AL KAL+LPD+I+N+ GEV+ + L                        
Sbjct: 773  EAIAKIDKEATSALAKALNLPDDIINENGEVNFDDLSD--GSDISSDEESLDDEKMMELD 830

Query: 808  XQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANK 867
             QL+EIFKRRKEALS++STGNQRK+EVKESRE+VI+FKHR+ D+L++Y+K+ E       
Sbjct: 831  DQLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAE------- 883

Query: 868  VENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDKNI 927
                 + E P    + FI PM+KC+++TLDK LADKISKLLK K++K+K    + +    
Sbjct: 884  -----DSELPAKYAILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKNMEEITAE- 937

Query: 928  ELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNN--ALDELIDLYAA 985
            ++ + + S HE +LTSKPGQ+   F+S CS++S+FLSKL   +  +   A  +++D+Y+ 
Sbjct: 938  QVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIVDIYSE 997

Query: 986  TTKEWMLK-GKFSTNVFIDFTNWLSSKK 1012
            TTK+W+LK  KF +N+FIDF NWLSSKK
Sbjct: 998  TTKKWVLKDSKFGSNIFIDFYNWLSSKK 1025

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/1030 (44%), Positives = 648/1030 (62%), Gaps = 45/1030 (4%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            MTGKVNRD F+KLASDL EERL AAV+LIK+LS+L LP+  +EWSYV+NRLIKGL+SDRN
Sbjct: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120
             ARLGFSLCLTEVV+L I M   + P+ L+S + FL  LS    I   D  KK    + E
Sbjct: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKE-E 119

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180
            RG+            NEPLFS+IF+ D K   T+F  +F+++L++LA RKNWI++PCLF+
Sbjct: 120  RGLMFGKLFALQALLNEPLFSDIFIKDGKI--TKFTTKFIDELVNLASRKNWIKQPCLFT 177

Query: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240
            L+QTI+ LLP+ ++S    ++ + D    TLTNEGL+ YL+   +   S + S +++ N 
Sbjct: 178  LYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLS-INVTNK 236

Query: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300
            GWK N+PL +GNL L+++V+R+S+V+ D N       K  NANW+P+LHFVWD+LLP+  
Sbjct: 237  GWKYNNPLLKGNLSLVSEVVRESAVVVDDN-----ETKTNNANWHPKLHFVWDILLPILY 291

Query: 301  SGKLE---NTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLII 357
            +   E     +                +I+FPEFWK  VDE++F++KASSERK+LG LI 
Sbjct: 292  NDPREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIF 351

Query: 358  DATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVP 417
                 TVP   I  CFSQN+MR LINQ  DS+R L+KIA+  L SIVK CE DP  KLVP
Sbjct: 352  LKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVP 411

Query: 418  CLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTH 477
             + A+LFG +GSINFD+LTKS  ++KLIA K L    + +L + F  +L  ++ +    H
Sbjct: 412  VVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNE-AVLH 470

Query: 478  FILDSLLHIIRAHKVEINDVGI----IKPVLTPIIHMAFFKHATDEQEFEQLH--ELAKE 531
            FILD+LLHI+R+HK+ +    I    +  +L P++ + FF HAT+    ++++  E+A+E
Sbjct: 471  FILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFF-HATETSPEDKINVSEIARE 529

Query: 532  RLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAI 591
            R+YSIL EL+    V + D   +SWQ+  LN +  +E   +  L N LDE L  +K+  +
Sbjct: 530  RIYSILSELS---SVPTGDA--HSWQFHILNELTTVEN--ELTLTNALDEDLTTVKDTGL 582

Query: 592  SSLAEISKSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNN-----SMVG 646
            S +  +S  N   S G+ +LL+MCL+QLY+GE DS++ I+E+C++   + +     S+VG
Sbjct: 583  SVIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVG 642

Query: 647  ITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFXXXX 706
            ITEILL  LAQKK +L K SL++W+Q IEDVG +EL ++LDVL ARENK+GF+ LF    
Sbjct: 643  ITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLF--EG 700

Query: 707  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATGALIKALH 766
                                                       V NID++   AL KAL 
Sbjct: 701  AEEYEKVSGDENEVAPEEESASSDTSDSSSDSDDESEEADNKDVTNIDRQTACALAKALK 760

Query: 767  LPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSNIST 826
            LP+N+VN+ GEV  N++                         QL++IFKRRK+ALS++ T
Sbjct: 761  LPENVVNEDGEVKFNEI--DDLEDESSDDESMDDEAMMALDGQLADIFKRRKDALSHVPT 818

Query: 827  GNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIV 886
            GN RK+EV++SRE+VI+FK R++DMLT+YVKY EKL +    E+   ++  L  +  F+ 
Sbjct: 819  GNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDL----EDKDVMKEKLQTVSTFVE 874

Query: 887  PMLKCIRETLDKPLADKISKLLKGKIFKIKAN-TFKILDKNIELMNLLKSTHELMLTSKP 945
            PMLKC++ TLD+PLADKI KLLK KIFK+K   + +  ++ +E +  +  T+  +L  K 
Sbjct: 875  PMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPVSAEDGERFVESLQRIHGTY--LLAEKS 932

Query: 946  GQHASVFFSACSTSSLFLSKLYFEIGGNN--ALDELIDLYAATTKEWMLKGKFSTNVFID 1003
            GQ+ ++++S CS++S+F  KL  E   N   A +E+ID+YA TTK+WM K KF T+VF D
Sbjct: 933  GQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSVFFD 992

Query: 1004 FTNWLSSKKQ 1013
            F NWLSSK+Q
Sbjct: 993  FYNWLSSKRQ 1002

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1054 (43%), Positives = 618/1054 (58%), Gaps = 83/1054 (7%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSAL---ELPSDAEEWSYVLNRLIKGLAS 57
            +  +VNRDLFFK+AS+L++ERL AA+ LI ++S +   E      EW YV+ RL+KGLAS
Sbjct: 6    VVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLAS 65

Query: 58   DRNSARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKG 117
            +R  ARLGFS+CLTEV+ L +     +R   L S   FL+ L   L             G
Sbjct: 66   NRGGARLGFSMCLTEVIALAL-----ERRDILPSIYAFLNQLEQTLP-----AGTAFKNG 115

Query: 118  KDERGIXXXXXXXXXXXXNEPLFSEIFVD-DIKKGNTEFVIRFMEQLIDLALRKNWIREP 176
            K+ERG+            NEP+FS++F+  D    N EF++ ++ +LI LAL K W+REP
Sbjct: 116  KEERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREP 175

Query: 177  CLFSLFQTI-KMLLPFMNESTAVKILL-IYDKYDLTLTNEGLSTYLVLKYESDESLIPST 234
            CL+S++QTI K      N+ TA+ ++L + D+  LTLTNEGLS YL+   + D     S+
Sbjct: 176  CLYSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMFNAQRDT--YSSS 233

Query: 235  LDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDV 294
            L + NSGWKNNDPL++GN+ LL  VL+D  V+P     L    KQK   W PRLH+VWD+
Sbjct: 234  LVIHNSGWKNNDPLSKGNVQLLASVLKD--VVPVEKSDL----KQK-GTWAPRLHYVWDI 286

Query: 295  LLPLF---GSGKLENTEHITXXXXXXXXXXVQ---NSIQFPEFWKMAVDESFFNEKASSE 348
            LLPL    GS       HI+                 IQFP+FW+  VDESFFNEK+S+E
Sbjct: 287  LLPLLEDDGSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNE 346

Query: 349  RKYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACE 408
            RKYLGFLI++   K      I    SQN++R +INQS DSQR+LNKI+   L+SIV  CE
Sbjct: 347  RKYLGFLILEEAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECE 406

Query: 409  EDPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQL-- 466
              P  K+VP +    FG +GSINFDKL KS +++ LI+   L    L  L++  + QL  
Sbjct: 407  RSP-AKVVPLVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQ 465

Query: 467  -QEKRGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQL 525
             Q  +     T FI D+ LHI RAHK  + +   +KP+L+ II  AFF    +E +  +L
Sbjct: 466  DQSTKDSFNLTRFIFDTFLHITRAHKTRL-ESHWVKPLLSAIIKAAFF----NESDNSKL 520

Query: 526  HELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEK 585
             ELAKERLYSILGEL      +S D  I++W Y+ L +IL IE S     I+ LDE LE 
Sbjct: 521  SELAKERLYSILGELISEPSKSSGD--ISTWPYIALQIILKIEGSGSTLSID-LDEDLES 577

Query: 586  IKNEAISSLAE---ISKSNTTQSW-GLSTLLSMCLIQLYAGETDSISVIEELCEFTKH-- 639
            ++  AI SL +    +K+NT     GL  LLS+ ++QLYAG+ +S+S++++L  F +   
Sbjct: 578  VRKSAIKSLKQNHSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEECD 637

Query: 640  -DNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGF 698
             ++  +VGITEILLS +AQ+K+LL+KLSLI+W+ F+ D+G  EL +LL  L ARENKQGF
Sbjct: 638  KESTDLVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGF 697

Query: 699  AQLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXVVNIDK 755
            A LF                                                  +  I+K
Sbjct: 698  ADLFEGDEEEDDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVSEEDKDAALEKIEK 757

Query: 756  EATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXX----------XXXXXXXXXX 805
            EAT AL KAL+LPD+IV + G+V   QLG                               
Sbjct: 758  EATSALAKALNLPDSIVGEHGDV---QLGNNEEEDSDEDSDEDDDFSGEDESMDDEAMMQ 814

Query: 806  XXXQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIA 865
               QLSEIFKRRKEAL ++ TGN+RKVEV+ESRENVISFKHR+VDML +YVK  ++    
Sbjct: 815  LDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDRAVAR 874

Query: 866  NK-----VENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTF 920
            N      VE  +NL          I+P+LKC++ TLDK LADK +KL+K ++ K+KA   
Sbjct: 875  NNTSIITVEEWNNLSS-------IILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIA 927

Query: 921  KILDKNI--ELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNNALDE 978
            K  +K +  E+ +LL+  H+L++T+KPGQ   +FFS CS +SLFLSKLY   GG++  + 
Sbjct: 928  K-EEKTVTSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGGSH--EN 984

Query: 979  LIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKK 1012
            LIDLYA T+K WM  GK + N FIDF+NWL +K+
Sbjct: 985  LIDLYADTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/739 (51%), Positives = 497/739 (67%), Gaps = 45/739 (6%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
           M GKVNRDLF+KLASDL+EERL +AV+LIK+LS L +P D EEW+YVLNRLIKGLASDRN
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDI------YVNDGSKKP 114
           SARLGFSLCLTE +NL + M     P+G++S NEFLD LS  L I        N  + K 
Sbjct: 61  SARLGFSLCLTEAINLALGM-GDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119

Query: 115 VKGKDERGIXXXXXXXXXXXXNEPLFSEIFV-DDIKKGNTEFVIRFMEQLIDLALRKNWI 173
            KG+DERGI            NEPLFS IF+ +D KK ++   IR++++L  L  +KNWI
Sbjct: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179

Query: 174 REPCLFSLFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYES------D 227
           RE C F+L+QTI+ LLP+ +      +L + DKY+LTL+ EGL+ YL++ Y S      +
Sbjct: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239

Query: 228 ESLIPSTLDLRNSGWKNNDPLARGNLPLLTKVLRDSSV--LPDTNGKLQDAKKQKNANWN 285
           ++L  S + L NS WK+N+PLARGNLP LT +LRDS+V    D         KQ  ANW 
Sbjct: 240 KTL--SDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWA 297

Query: 286 PRLHFVWDVLLPLF---GSGKLENTEHITXXXXXXXXXXVQNS---IQFPEFWKMAVDES 339
           PRLHFVWD+LLP+     + +  N++              Q+S   I+FPEFW+MA+DES
Sbjct: 298 PRLHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDES 357

Query: 340 FFNEKASSERKYLGFLIIDATFKTVP---GSCIGSCFSQNVMRTLINQSIDSQRILNKIA 396
           FFNEKASSERKYLGFLI   T +++       I +CF++N MR+LINQS D++R+L+K++
Sbjct: 358 FFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMS 417

Query: 397 QITLESIVKACEEDPIKKLVPCLNAMLFGPH--GSINFDKLTKSNIISKLIAIKELPSAV 454
           QI +++IVK CE+DP  KL+PCL+A+LF  +  GSINFDKLTKS  +SKLI+IK L S+ 
Sbjct: 418 QIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSST 477

Query: 455 LAQLISAFLLQLQEKRGDLPHT---HFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMA 511
           L QLI  F+ Q+     +   T    F LD++LH++R+HK E +   +++P+L P++ +A
Sbjct: 478 LRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLA 537

Query: 512 FFKHATDEQEFEQLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSY 571
           FF      ++ E L+ELAKERLYSIL ELT            +SW Y TL LIL++EKS 
Sbjct: 538 FF-----SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSG 592

Query: 572 KADLINPLDESLEKIKNEAISSLAEISKSN----TTQSWGLSTLLSMCLIQLYAGETDSI 627
             +L+N LD  LE IKN  +  L EIS +N    T QS GL  LLSMC++QL++G+T+S+
Sbjct: 593 NQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESL 652

Query: 628 SVIEELCEF----TKHDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQ 683
           S IEEL EF     + ++ S+VGITEILLS LAQKKA+LRKLSL +W+ FI D+G  EL 
Sbjct: 653 STIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELN 712

Query: 684 ILLDVLKARENKQGFAQLF 702
           +LL VL  RENKQGFA LF
Sbjct: 713 VLLAVLPVRENKQGFAHLF 731

 Score =  259 bits (662), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 182/281 (64%), Gaps = 23/281 (8%)

Query: 750  VVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXX-------- 801
            + NIDKEAT AL KAL+LP+NIVN+KGEVD+ +L                          
Sbjct: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESMD 846

Query: 802  --XXXXXXXQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYC 859
                     QLSEIFKRRKEALSNISTGNQRK+EVKESRENVI+FKHR++DML +Y+KY 
Sbjct: 847  DEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906

Query: 860  EKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANT 919
            E L +    EN          L+ FI PM+KC+++TLDK LADK+ KL+K K+FKIK++ 
Sbjct: 907  EGLTLT--TENGE----KFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSN 960

Query: 920  FKILDKNIE---LMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNN-- 974
            F+I   N +   +M LL+ THE +LTSK GQ  S+++S CST S+FL K+   +  N+  
Sbjct: 961  FQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKE 1020

Query: 975  -ALDELIDLYAATTKEW-MLKGKFSTNVFIDFTNWLSSKKQ 1013
             A  +LIDLY  TTK W M KGKF  N F DF NWLSS++Q
Sbjct: 1021 IAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1040 (41%), Positives = 605/1040 (58%), Gaps = 69/1040 (6%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            M  +VNRDLF+KL SDL +ER+ +A+ALI +L+ L +  + +EW YVL RL++GLAS   
Sbjct: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120
            SARLGFSLCLTEV    +   +G     + S  E+L+ L + L +       K   GK+E
Sbjct: 61   SARLGFSLCLTEVAAAALE--NGH----IGSAEEYLERLEAALPV------DKVKNGKEE 108

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180
            RG             NEPLFS +FV    +    F  +FM++L+ LAL K W+R+PCLF+
Sbjct: 109  RGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFT 168

Query: 181  LFQTIKMLLPFMNESTAVK-ILLIYDKYDLTLTNEGLSTYLVLKYES-------DESLIP 232
            L+Q I+ L P   ++  ++ +L + D+++LT T+EGL+ YL L+ +        DE+ I 
Sbjct: 169  LYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIF 228

Query: 233  STLDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVW 292
              L L    WK ++PLA+GN   L  VL+D +++        D  KQK   W PRLHFVW
Sbjct: 229  DALPLVKR-WKADNPLAKGNAKALASVLKDDALIEG------DGPKQKGV-WTPRLHFVW 280

Query: 293  DVLLPLFGSGKLENTEHITXXXXXXXXXXVQNS----IQFPEFWKMAVDESFFNEKASSE 348
            D+LLPL    K+    H+            +++    + F EFW++ VDESFF+EKASSE
Sbjct: 281  DLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSE 340

Query: 349  RKYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACE 408
            RKYLG LI++   ++VP S +   FS+N +RTLINQS ++ R L+K++   L++IV ACE
Sbjct: 341  RKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACE 400

Query: 409  EDPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQE 468
             D   K+VP L A+ FGP+G+INFDKLTKS     L+  K L +  LAQL++  L QL+ 
Sbjct: 401  TDA-SKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEH 459

Query: 469  KRGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATD-EQEFEQLHE 527
            +  D+    FILD+LLH+IRAHK + + +    P+L  ++  AFF   +   ++ E++  
Sbjct: 460  ENTDISKIKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSEQSEEIIT 518

Query: 528  LAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIK 587
            L++ERL+S+LGEL     ++  D    SW Y TL L+L  ++  K  L   LD  LE + 
Sbjct: 519  LSRERLFSVLGELI---PLSKHDMGAPSWAYATLELLL--QEKEKHPLALQLDAELETVT 573

Query: 588  NEAISSLAEI------SKSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF----T 637
            + A+  L +I      S +   Q +GL  LLS+ ++Q++AG+ DS S +EEL  F    T
Sbjct: 574  SNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESAT 633

Query: 638  KHDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQG 697
            +  +N +VGITEILLS +AQKK++LRKL+L++W+ FI+ VG EEL++LL+ L ARENK G
Sbjct: 634  QGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAG 693

Query: 698  FAQLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEA 757
            FAQLF                                               V  IDKEA
Sbjct: 694  FAQLF----EGADEYEELGSDEAGTDNEDQSSESNEDSSDEVSDQEDYSDEDVAKIDKEA 749

Query: 758  TGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRR 817
            T AL  AL LPDNI+++ G V     G                        QLSEIFKRR
Sbjct: 750  TSALAHALRLPDNILDEDGNV-----GFEEMDDEEEEEESMDDEAMMELDGQLSEIFKRR 804

Query: 818  KEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGP 877
            K+AL+ I TGNQRK+E KESR++VI+FKHR+VDML +Y K  E+    NK      L   
Sbjct: 805  KDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNK-----KLSAT 859

Query: 878  LSK-LVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDKNI---ELMNLL 933
            +S  ++    PM+K I++TLD+PLA+KISKLLK  + K+K   +K     I    ++  L
Sbjct: 860  MSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESILTSL 919

Query: 934  KSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNNALDE-LIDLYAATTKEWML 992
            ++ H  +L+ KPGQ   +FFSACS++SLFLSK+   +  + +  E +I +Y+ T K W +
Sbjct: 920  ENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMKHWNV 979

Query: 993  KGKFSTNVFIDFTNWLSSKK 1012
             GKF  N FIDF NWL+SKK
Sbjct: 980  SGKFGPNFFIDFINWLASKK 999

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/711 (51%), Positives = 497/711 (69%), Gaps = 29/711 (4%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
           M GKVNRD F++LASDLQ+ER+ AAV+LI++LSALELP+  EEWSYVL RLI GLAS RN
Sbjct: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 61  SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120
           SARLGFSLCL+EVV + ++  +   P+ L S +++L+ LS+ L       SKK +KGKDE
Sbjct: 61  SARLGFSLCLSEVVKMALDKGT-LAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDE 119

Query: 121 RGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180
           RGI            NEPLF+ IF D   K  + F +RF ++L +LA++KNW+RE CL++
Sbjct: 120 RGILFGKMFGLQAILNEPLFTSIFFDQEGKV-SPFALRFAQELAELAVKKNWLRESCLYT 178

Query: 181 LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVL-----KYESDESLIPSTL 235
           LFQT++ L+P M       ILL+ DKY LT+TNEGL+ YL+L     +       +PS+L
Sbjct: 179 LFQTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL 238

Query: 236 DLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVL 295
            L  + WKNNDPL++GNLP L++VLRD+   P  + ++ D    K+ANWNPRLHFVWD+L
Sbjct: 239 ALEFAAWKNNDPLSKGNLPQLSRVLRDA---PANDSEVADGSHPKSANWNPRLHFVWDIL 295

Query: 296 LPLFGSGKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFL 355
           +P+   GK +                V+  I+FPEF++ AVDE+FF+EKASSERKYLGFL
Sbjct: 296 IPILAPGKSDEEIPSKKSHKKKKKDTVEG-IEFPEFFQAAVDETFFSEKASSERKYLGFL 354

Query: 356 IIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKL 415
           +     + V    I SCF+QN MRTLINQS DS+R+LNKI+Q  L++IVKACE+D  +K+
Sbjct: 355 VFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKI 414

Query: 416 VPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQL-QEKRGDLP 474
             CL AMLFGPHG+I+FDKLTKS   SKL+AIK++ S+ L +L +    QL +E+  +  
Sbjct: 415 ALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQ 474

Query: 475 HTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLY 534
           H  F+LD++LH +R H++EI+   I  P+L  I+ +AFF      ++ E + +LA+ERL+
Sbjct: 475 HYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFS-----KKGEDISDLARERLF 529

Query: 535 SILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSL 594
           SIL ELTI K     D Q  SWQ+ TL LIL  E +   + IN LDE L+ I+ EA+  L
Sbjct: 530 SILSELTIQK-----DGQ--SWQHYTLKLILSKE-AEGNEPINKLDEDLKAIETEALDIL 581

Query: 595 AEISKSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTK---HDNNSMVGITEIL 651
             IS S++ QS GL  LLS CL+QLY+G+++S+S++EELC F +   +++NS+VGITEIL
Sbjct: 582 QNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEIL 640

Query: 652 LSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702
           LS LAQKKALLRKLSL++W+QF+ +VG +EL+ILL+VL ARENK+GFA+LF
Sbjct: 641 LSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLF 691

 Score =  260 bits (664), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 140/285 (49%), Positives = 186/285 (65%), Gaps = 25/285 (8%)

Query: 750  VVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXX---------------XXXXX 794
            V  ID+EAT AL KAL+LP+NIVNDKGEVD+ +L                          
Sbjct: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEE 814

Query: 795  XXXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTV 854
                          QLS+IFKRRKEALS ++TGN+RKVEVKE+RENVI+FKHRIVDML  
Sbjct: 815  EESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874

Query: 855  YVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFK 914
            Y+K+ +++A+ +   + +N +     L  F+ PM++C++ TLDKPLADKISKLLKG+++K
Sbjct: 875  YIKHADRIALQDN-NDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933

Query: 915  IKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNN 974
            IK + FK    +  L+  L+ TH+ +LTSKPGQ  +++FS CST+SLFL K+  E   NN
Sbjct: 934  IKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVE---NN 990

Query: 975  ALD------ELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQ 1013
            + D      ++IDLYA TTKEW+L GKF  NVF DF NWL S+K+
Sbjct: 991  SEDPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1043 (40%), Positives = 593/1043 (56%), Gaps = 76/1043 (7%)

Query: 4    KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRNSAR 63
            ++NRDLF+KLASDL EERL A + L+  LS LE   D+ EW YVL+RLIKGL+S RN AR
Sbjct: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62

Query: 64   LGFSLCLTEVVNLGINMPSGQRPKGLESK-NEFLDTLSSILDIYVNDGSKKPVK-GKDER 121
            LGFSLCLTEVV L +        KG+ ++ ++++  L S L       SK+ VK GK+ER
Sbjct: 63   LGFSLCLTEVVALALE-------KGVLARVDQYMHLLISAL-------SKENVKNGKEER 108

Query: 122  GIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFSL 181
            G+            NEPLFS++F  D  + N E +  +M  LID+AL K WIRE  LF+L
Sbjct: 109  GLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTL 168

Query: 182  FQTIKMLLPFMNESTAVKILL-IYDKYDLTLTNEGLSTYLVLKYESDESL-------IPS 233
            FQ ++ L P +     +K +L + D   LT T+EGL+ YL L +    +           
Sbjct: 169  FQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLD 228

Query: 234  TLDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWD 293
             L+L+N  WKNNDPL RGNLP ++  L+DS       G   D    +   W PRLHF WD
Sbjct: 229  ELNLKNP-WKNNDPLKRGNLPAISNALKDS-------GARDDPSLTQKGVWAPRLHFAWD 280

Query: 294  VLLPLFGSGKLENTEHITXXXXXXXXXXVQNS--IQFPEFWKMAVDESFFNEKASSERKY 351
            ++L        EN+E  T           +    I+FPEFWK  VDESFFNEK+SSERKY
Sbjct: 281  IVLQTLLHA--ENSEITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKY 338

Query: 352  LGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDP 411
            LG L+ + TF+  P   +   FS+N++R LINQ   ++R L+KI+Q  L +IV+ C+  P
Sbjct: 339  LGILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQP 398

Query: 412  IKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRG 471
             +K  P    + FG +G+INFD LTK+  ++ L++ K L S  L  L  + +  L     
Sbjct: 399  -EKTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLK 457

Query: 472  DLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFF-----KHATDEQE-FEQL 525
            +L    FILD++LH++RAHK   ++V  +KPVL  ++ + FF     K   D QE F  L
Sbjct: 458  ELSRARFILDAILHLVRAHKAHADEVW-LKPVLKALVCLGFFQQSELKDVKDSQESFHSL 516

Query: 526  HELAKERLYSILGE-LTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLE 584
              +A ERL+SIL + LT+ ++  S       W ++ + L L  + + K  L+  +DE L 
Sbjct: 517  SSIASERLFSILADLLTVEQDTYSV-----CWPFIAVQL-LKTDTNQKT-LLQSMDEELG 569

Query: 585  KIKNEAISSLAEISK----SNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKH- 639
             I + +++ L+ IS+    +N +Q  GL  L S+ ++Q YAGE +SISV+E+L  F    
Sbjct: 570  DILDSSMTVLSSISQKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEF 629

Query: 640  ----DNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENK 695
                 +  + G  EILLS  AQKKAL RK SL+ W+ F+ DV  ++L +LL+VL  RENK
Sbjct: 630  EDGAKSAPLAGFIEILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENK 689

Query: 696  QGFAQLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVN-ID 754
            +GF+ LF                                                +  ID
Sbjct: 690  EGFSNLFEGGSESEGDSEEDEEMNDEEEPEKDASDDEIEESDNNVSEDDSSSDDDMGKID 749

Query: 755  KEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXXXXQLSEIF 814
            KEAT AL KAL+LPD+IV+DKGEV    L G                       QLSEIF
Sbjct: 750  KEATSALAKALNLPDSIVDDKGEVRFEDL-GDTDEEEEESEEDLDDEKMMELDGQLSEIF 808

Query: 815  KRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNL 874
            KRRKEALS I TGN+RK EVKESRENVI+FKHR+VDML + V++ E     +K++   ++
Sbjct: 809  KRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE-----SKMKKDGHI 863

Query: 875  E-GPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIK---ANTFKILDKNIELM 930
            E   L K+   I+P+L CIR TLDKPLA+KI+KLLK KI K+K   ++T + +DK   ++
Sbjct: 864  EKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKK-AVL 922

Query: 931  NLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGN-NALDELIDLYAATTKE 989
            +LL+S HE ML  K GQ  +++FS CST+S+FL++L  +        +EL  +Y  T   
Sbjct: 923  SLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTLDG 982

Query: 990  WMLKGKFSTNVFIDFTNWLSSKK 1012
            W + GKF  ++F++F NWLS KK
Sbjct: 983  WFVTGKFGVSMFVEFLNWLSVKK 1005

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/710 (51%), Positives = 475/710 (66%), Gaps = 28/710 (3%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
           MTG+VNRD F+KLASDLQEER+ AAVALI++LSAL+LP  A EWSYVL RLI GL+S RN
Sbjct: 1   MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 61  SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVN-DGSKKPVKGKD 119
           SARLGFSLCLTEV+NL +N+  G RP+ L S + FLD LSS L +  +   SKK +KGKD
Sbjct: 61  SARLGFSLCLTEVINLALNL-EGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIKGKD 119

Query: 120 ERGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLF 179
           ERG+            +EPLF ++F+   +KG ++F +RFM++L  LA+ K+W+REPCLF
Sbjct: 120 ERGLLFGKMFGLQALLSEPLFEKVFISK-EKGISDFALRFMDELCQLAVFKSWLREPCLF 178

Query: 180 SLFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTL--DL 237
           +LFQ  + +LP  +  TA  +L + D+Y LTLTNEGL+ YL+L Y+S      S L  D 
Sbjct: 179 TLFQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQMDF 238

Query: 238 RNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLP 297
            +  WK+NDPLARGNLPLL++VLRDSSV        +D    K +NW PRLHFVWD+LLP
Sbjct: 239 ESKSWKSNDPLARGNLPLLSQVLRDSSV------ATEDESSPKASNWTPRLHFVWDILLP 292

Query: 298 LFGSGKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLII 357
           +                          +IQFPEFW+MAVDES FNEKAS+ERK+LG +I 
Sbjct: 293 IITQDNSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIF 352

Query: 358 DATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVP 417
               +  P   +G CFSQNVMRTLIN + DS+R+L KI+   L SIV  C++ P +KLVP
Sbjct: 353 QKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVP 412

Query: 418 CLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKR-GDLPHT 476
           CL+A+LFGPHGSINFDKLTKS   + L+A+  L    L +L       L E    +  + 
Sbjct: 413 CLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQKNQ 472

Query: 477 HFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSI 536
            FILD++LH +R+HK E+N   I+  +L PII +AFF         E    LAKER YSI
Sbjct: 473 QFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFFTVKD-----EHTSNLAKERFYSI 527

Query: 537 LGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAE 596
           L E+T    +N+E P   S+Q + L++I D E +   +L   LD++LE +K+EA+ +L  
Sbjct: 528 LSEIT---HLNNEGP---SYQNMALDIIRD-EIAAGKELTTKLDDTLEDVKSEALRTLQA 580

Query: 597 ISKSNTT-QSWGLSTLLSMCLIQLYAGETDSISVIEELCEF---TKHDNNSMVGITEILL 652
           IS +    Q  GL  L+SMCL+QLY+GE++++SVIEELC F   T  ++ S+VGITEILL
Sbjct: 581 ISNNEKNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQDTDENSTSLVGITEILL 640

Query: 653 SFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702
           S LAQKKA+LRKLSL  WQQF+ ++G  EL+ LLDVL ARENK+GF+QLF
Sbjct: 641 SLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLF 690

 Score =  249 bits (636), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/279 (48%), Positives = 179/279 (64%), Gaps = 22/279 (7%)

Query: 750  VVNIDKEATGALIKALHLPDNIVNDKGEVDMNQ--------------LGGXXXXXXXXXX 795
            V  IDKEAT AL KAL+LPDNIVNDKGEVD+N                            
Sbjct: 745  VAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDE 804

Query: 796  XXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVY 855
                         QLS+IFKRRK+ALSNISTGNQRK E KESRE+VI+FK R++DML +Y
Sbjct: 805  DSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIY 864

Query: 856  VKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKI 915
            VK+ EK ++  K EN S     +S  +  + PM+KCI++T DK LA++I+KLL+ K+FK+
Sbjct: 865  VKFVEKQSL--KEENYSK----ISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKL 918

Query: 916  KANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNN- 974
            K + F       ELM +L+ THE + T KPGQH ++++S CST+SLFL+K+  E   +  
Sbjct: 919  KTSAFCGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSKD 978

Query: 975  -ALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKK 1012
             A+ ++IDLYA T K+W   GKF  N+FIDF+NWLSS+K
Sbjct: 979  AAVHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1058 (40%), Positives = 603/1058 (56%), Gaps = 77/1058 (7%)

Query: 5    VNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAE-------EWSYVLNRLIKGLAS 57
            VNRD+F++LASDL+EERL + V L+K+L  L+  +  E       EW+YV+NRLI GLAS
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 58   DRNSARLGFSLCLTEVVNLGINMP-SGQRPKGLESKNEFLDTLSSILDIYVNDGS--KKP 114
            +R  ARLGFSLCLTEV+NL ++       P  L   + FL  +S  L I  +     +K 
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 115  VKGKDERGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIR 174
            +KGKDERG+            N+P+F +IF     K N   +  F+ +LI L+  KNWI+
Sbjct: 124  LKGKDERGLLFGKLFALQSLLNDPIFGKIF----NKDNKAILFEFIYELIALSNLKNWIK 179

Query: 175  EPCLFSLFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPST 234
            EP LF+LF  I+ ++ F++ S  V++L I    +LTLTNEGLS Y+ L Y ++  + P  
Sbjct: 180  EPTLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIY-TNPHISPED 238

Query: 235  LDL---RNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFV 291
            + +    N+ WKNNDP  + N+ LL+KVL ++S         Q  K   NANW PRLH+V
Sbjct: 239  IQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAAS------QSEKHTSNANWTPRLHYV 292

Query: 292  WDVLLPLFGSGKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKY 351
            WDV+LP+  + K  +++ +            ++ I+F EFW+  +DESFFNEKAS ERKY
Sbjct: 293  WDVILPILLNPK--SSDKLLNKNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKASHERKY 350

Query: 352  LGFLIIDATFKTV-PGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEED 410
            LGFLII  TF  +   + I S F+ N++R++INQ  DS+R LNKI+  T++ IV  C+ +
Sbjct: 351  LGFLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSN 410

Query: 411  PIKKLVPCLNAMLFGPH--GSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQE 468
               +L+P LN  LF      SINFDKLTK+  IS+LI +++L +  L++L   F  +L +
Sbjct: 411  SELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSKL-D 469

Query: 469  KRGDLPHTHFILDSLLHIIRAHKVE-INDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHE 527
                     F+LDS+LHIIR+HK + I     + PVL PII + FFK   D      +  
Sbjct: 470  SFTTTTELQFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKETAD----VSISN 525

Query: 528  LAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIK 587
            + K+RL SIL +LT   E +S      S QYLTLNLI+++ +  K  L    D+SL ++K
Sbjct: 526  ILKDRLISILNDLTTVGENSS------SIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVK 579

Query: 588  NEAISSLA---EISKSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF-------- 636
            + AI++L    E SK ++     L +LLS+ +IQLY  + DSI+ I++LC+F        
Sbjct: 580  DSAITTLKRAIEHSKRDSRLK-SLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSNT 638

Query: 637  -TKHDNNS-MVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKAREN 694
              K+D N   +GI EILL+  AQKK++L+KL L +W+ FI+ + L E   + DVL  REN
Sbjct: 639  IMKNDKNRPSLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTREN 698

Query: 695  KQGFAQLFX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVV 751
            K+GFA+LF                                                  + 
Sbjct: 699  KEGFARLFEGDDEYEEIDSHDDEEKDEDKNIDDISTENSDDDNSSDEENDSIVESNDDIN 758

Query: 752  NIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXX---------XXXXXXXXXXXXXXX 802
             IDKEAT AL KAL LPDNI+NDKGEVD+ +L                            
Sbjct: 759  RIDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMDDEQ 818

Query: 803  XXXXXXQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKL 862
                  QLS+IF RRKEALSNI TGN+RK++VKESRENVI+FKHRIVDM+ VY+K+ E +
Sbjct: 819  MMELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKHIEII 878

Query: 863  AIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFK- 921
              +++    +     L+ +   I  +L CI++TLD+ LA+KISKLLK K+FKIK   FK 
Sbjct: 879  TKSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLVEFKD 938

Query: 922  ---ILDKNIELMNLLKSTH-ELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNNAL- 976
               +  +NI  +  + + H E +L  K GQ+  ++F  CS SSLF  +++ E   N  L 
Sbjct: 939  CGDLTSENI--LEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNADLY 996

Query: 977  DELIDLYAATTKEWMLKG--KFSTNVFIDFTNWLSSKK 1012
            D LIDLY  TTK W      K  T +F DF NWLSSK+
Sbjct: 997  DSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1047 (40%), Positives = 580/1047 (55%), Gaps = 72/1047 (6%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
            +  +V+RDLF+KLASDL EERL A + L+  LS +E   ++ EW YVLNRLIKGL+S RN
Sbjct: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59

Query: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120
             ARLG+ LCLTEVV       S      L   +E+L  L S L        +    GK+E
Sbjct: 60   GARLGYCLCLTEVV------ASALEKSVLAHADEYLRLLLSTLS------RENIKNGKEE 107

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFV--DDIKKGNTEFVIRFMEQLIDLALRKNWIREPCL 178
            RGI            NEPLFS++F   D+I   N EF++ ++  LID+AL K WIRE  +
Sbjct: 108  RGILFGKLFGLQVLLNEPLFSQVFKAEDEI---NLEFMLTYVGTLIDVALAKTWIRESSM 164

Query: 179  FSLFQTIKMLLPFMNESTAVKILL-IYDKYDLTLTNEGLSTYLVLKYES---DESLIPST 234
            F+L+Q I+ L P M     +K LL + D   LT T+EGL+ YL L ++S     +L    
Sbjct: 165  FTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKG 224

Query: 235  L--DLR-NSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFV 291
            L  DL+ NS WKNNDPL++GNLP +   L++ +   D       + KQK   W PRLHFV
Sbjct: 225  LLEDLKLNSPWKNNDPLSKGNLPAIANALKEINSSEDL------SVKQKGI-WMPRLHFV 277

Query: 292  WDVLL-PLFGSGKLEN-TEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSER 349
            WD++L   F  G+ E+                    I+FPEFWK  VDESFFNEK+SSER
Sbjct: 278  WDIILTSFFEGGEYEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSER 337

Query: 350  KYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEE 409
            KYLGFL+ +  F   P S   +  S+N+ R LINQ   S+R L+K++Q  L +IV  C+ 
Sbjct: 338  KYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKN 397

Query: 410  DPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEK 469
             P +K  P    +    HGSI+FD+LTKS  ++ L++ K L    L  L       L   
Sbjct: 398  QP-EKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTS 456

Query: 470  RGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFE------ 523
              D     F+LD++LH++RAHK   + V  + P+L  ++   FF+   ++++ E      
Sbjct: 457  LRDHSRVRFLLDAMLHLVRAHKSAADKV-WLAPLLDSLVQQGFFELDENDRQPEVGDETF 515

Query: 524  QLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESL 583
             + +LA ERLYSIL +L I+ +  SE      W   T+ +++   K  K  L+NP+DE L
Sbjct: 516  TVSKLAVERLYSILADL-ISADYKSEKV---CWPRFTVEILMS--KLKKNKLLNPMDEEL 569

Query: 584  EKIKNEAISSLAEISK-----SNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTK 638
             +I N +I +   I           Q+ G   + S+ ++Q Y+GETDSI V+++L  F +
Sbjct: 570  TEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQ 629

Query: 639  ----HDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKAREN 694
                + + S  G  EILLS  AQKKALLRK SL++W+ F+ +   +++ +LL++L AREN
Sbjct: 630  TLEENKSGSYAGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEILPAREN 689

Query: 695  KQGFAQLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNID 754
            K+GF++LF                                                  ID
Sbjct: 690  KEGFSKLFEGDDEGGSDEEEISDELFAEEGASGDNTEEEESGPDSDDQDGEDTE---QID 746

Query: 755  KEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXXXXQLSEIF 814
            KEAT AL+KAL+LP++IVND GEV    L                         QLSEIF
Sbjct: 747  KEATSALVKALNLPESIVNDNGEVHFEDL--EDTEDEEISDEDLDDEKMMELDGQLSEIF 804

Query: 815  KRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCE-KLAIANKVENSSN 873
            KRRKEALS I TGN+RK EVKESRENVI+FKHR+VDML ++V++ E +L    + E S  
Sbjct: 805  KRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPEKSVT 864

Query: 874  LEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDKNIE--LMN 931
                 SK++  I+P++ C+R TLDKPLA+K++KLLK KI K+K  T   LD   E    N
Sbjct: 865  -----SKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKITTDTSLDGLEENLFEN 919

Query: 932  LLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGN-NALDELIDLYAATTKEW 990
             LKS HE ML  K GQ  +++FSACST+S+FL+KL+            L ++Y  T  EW
Sbjct: 920  SLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVYHKTLNEW 979

Query: 991  MLKGKFSTNVFIDFTNWLSSKKQNVLD 1017
             + GKFS N+FI+F NWLS KKQ   D
Sbjct: 980  FVGGKFSANLFIEFLNWLSIKKQQNSD 1006

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/707 (48%), Positives = 475/707 (67%), Gaps = 35/707 (4%)

Query: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAE-EWSYVLNRLIKGLASDRNSA 62
           KVNRD F+KLASDL EER+ +AVALIKDLSAL+ PS+ E E+ YVLNRLI GL+S+RNSA
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61

Query: 63  RLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDERG 122
           RLGFSLCLTEVVNL ++    Q    L S ++FLD +   L +      KK  KGKDERG
Sbjct: 62  RLGFSLCLTEVVNLALDRKD-QPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120

Query: 123 IXXXXXXXXXXXXNEPLFSEIFVDDIKKGN-TEFVIRFMEQLIDLALRKNWIREPCLFSL 181
           I            NEPLF+++F+D  K G  ++F IRF  QL++LA+ KNW+REPCLF+L
Sbjct: 121 IMFGRMFALQALLNEPLFAKVFID--KNGKISKFAIRFQTQLVELAVLKNWLREPCLFTL 178

Query: 182 FQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNSG 241
           +QT++  +P+++ S    ++ + DKY LTLTNEGL+ YL L + + +  I S+L L + G
Sbjct: 179 YQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKK-IASSLPLESQG 237

Query: 242 WKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNA-NWNPRLHFVWDVLLP-LF 299
           WK NDPLA+GNLP LT+VL +S++        Q    Q NA NW+PRLHFVWD+LLP L 
Sbjct: 238 WKLNDPLAKGNLPTLTQVLLNSNIN-------QSETPQGNAANWSPRLHFVWDILLPILL 290

Query: 300 GSGKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDA 359
           G     N EH++             SI+F  FWKM VDESFFNEK+SSERKYLGFLII  
Sbjct: 291 GQDSTTNDEHVSKKQKSKTTS--STSIKFQSFWKMVVDESFFNEKSSSERKYLGFLIIQK 348

Query: 360 TFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCL 419
           + + VP   + S F QNV+R++INQS D++R+L+KI+Q  L SI++ACE+D   K+ P +
Sbjct: 349 SLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KITPIV 407

Query: 420 NAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFI 479
             +LFG +G+ NFDKLTK+  I+K+++IK L    L+Q+      +++     +    F+
Sbjct: 408 KVILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQFV 467

Query: 480 LDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGE 539
           LD++LH++R HK+E+N   II  +LTP+I +AFF      +E E++  +AKER +S+L E
Sbjct: 468 LDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFL-----KENERISNIAKERFFSLLSE 522

Query: 540 LTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEIS- 598
           L       +      SWQY  L LI + E S  + L   +D+ L  IK + I  L E++ 
Sbjct: 523 LA------AITTSTRSWQYTALELISNKEAS-GSPLNQEMDQDLIAIKEKGIECLKEVTK 575

Query: 599 KSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF---TKHDNNSMVGITEILLSFL 655
           KS+T Q  GL  LLSM L+QLYAG+ DS+S++E+LC F    + D+ S+VGITEILL+ L
Sbjct: 576 KSDTVQLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLALL 635

Query: 656 AQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702
           AQ+KA+L+K++L+ W+QF+  +G EE+++L+DVL ARENK+GFAQLF
Sbjct: 636 AQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  249 bits (635), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 138/278 (49%), Positives = 184/278 (66%), Gaps = 21/278 (7%)

Query: 753  IDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXX---------XX 803
            I+KE T AL KAL+LPDNI+N+ GEVD++ L G                           
Sbjct: 739  INKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEKM 798

Query: 804  XXXXXQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLA 863
                 QLSEIFKRRKEALS++++GNQRK++VKESRENVI+FKHRI+D+L  Y+KY EK+ 
Sbjct: 799  MELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858

Query: 864  IANKVENSS-NLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKI 922
             + K+E+   N E  L+ +   +  M++CI+ TLD+PLADKISKLLK K+FKI    F  
Sbjct: 859  -SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFD- 916

Query: 923  LDKNI----ELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNN---- 974
             + N+     ++  LK+ HEL++TSKPGQHAS++FS CSTSSLFLSKL  E    +    
Sbjct: 917  -NGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSY 975

Query: 975  ALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKK 1012
            A  +LID+Y   +K+W+LKG+F   VF+DF NWL+SKK
Sbjct: 976  AFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/745 (45%), Positives = 470/745 (63%), Gaps = 84/745 (11%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60
           M  K+NRDLF+KLASDLQEER+ AA++LIK+L++LE  ++  EW YVLNRLIKGL+S+RN
Sbjct: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58

Query: 61  SARLGFSLCLTEVVNLGINMPSGQRPKG-LESKNEFLDTLSSILDIYVNDGSKKPVK-GK 118
           SARLGFSLCLTEV+++ +        KG L S  E++  L S L        K+ VK GK
Sbjct: 59  SARLGFSLCLTEVLSVALE-------KGYLNSIEEYIQLLQSTL-------LKETVKNGK 104

Query: 119 DERGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCL 178
           +ERG+            NEPL S+IF+D     N  F++ FM +L+ +AL K WIREPCL
Sbjct: 105 EERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCL 164

Query: 179 FSLFQTIKMLLPFMNESTAVK-ILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPST--- 234
           F+LFQ ++ L PF+N++  ++ I  + D   L+LTNEGL+ YL L +     L P T   
Sbjct: 165 FTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIH-----LCPGTSKF 219

Query: 235 ---------LDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWN 285
                    L+L NS WKNNDPL +GNLP L+ VL+D S + D+  K       +  +W 
Sbjct: 220 IKKSGLLKNLEL-NSQWKNNDPLTKGNLPTLSAVLKDVSPVEDSGLK-------QKGSWA 271

Query: 286 PRLHFVWDVLLPLFG---SGKLENTEHITXXXXXXXXXXVQ-NSIQFPEFWKMAVDESFF 341
           PRLHFVW+++LP+       +  + EHIT          VQ   I+FPEFWK  VDESFF
Sbjct: 272 PRLHFVWNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFF 331

Query: 342 NEKASSERKYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLE 401
           NEK+S ERKYLGFLI++A FK VP S +   FS+N+MRTLINQS DS+RIL+KI+Q  L 
Sbjct: 332 NEKSSGERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLA 391

Query: 402 SIVKACEEDPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISA 461
           SI++ CE  P  K VP + AMLF  +G+INFDKLTK+  +  L+A   +    L+ L+  
Sbjct: 392 SILELCESHP-DKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDL 450

Query: 462 FLLQL-QEKRGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHA---- 516
           F+  L  +   +   T F+LDS+LH++R HK  ++D   +KP++T +I M FFK +    
Sbjct: 451 FVSHLPDDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKV 509

Query: 517 ---------TDEQEFEQLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDI 567
                    TD  EF+     A+ERLYSIL +L     ++ +     SW Y+TL ++L  
Sbjct: 510 DQENQDDDHTDGFEFQ-----ARERLYSILADLI---PLSKQSIHSASWPYITLQVLLSQ 561

Query: 568 EKSYKADLINPLDESLEKIKNEAISSLAEISKS-----NTTQSWGLSTLLSMCLIQLYAG 622
           E+S   +LI+PLD+ L KIK +A++ L  I +      + +Q +GL  LLSM ++Q+Y G
Sbjct: 562 EQS--KELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGG 619

Query: 623 ETDSISVIEELCEF-----TKHDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDV 677
           +T+S+SV+E+L  F        + NS++G+ EILL+ LAQKKALLR+LSL++W+ F++ V
Sbjct: 620 DTESLSVLEDLVTFYHSMRDSSEENSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKV 679

Query: 678 GLEELQILLDVLKARENKQGFAQLF 702
           G  EL++L D+L ARENK+GF  LF
Sbjct: 680 GTPELEVLFDILSARENKEGFTALF 704

 Score =  221 bits (564), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 167/267 (62%), Gaps = 11/267 (4%)

Query: 753  IDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXXXX---Q 809
            IDKE T AL KAL+LPD I+N+ GEV+ N+L                            Q
Sbjct: 782  IDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMELDDQ 841

Query: 810  LSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVE 869
            LS+IF+RRKEALS ISTGN+RK+E KESRENVI+FKH++VDML V+VK+ E+ +     +
Sbjct: 842  LSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTS-----K 896

Query: 870  NSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDKNIEL 929
            N    E  L  +     P++KC+++T DK LADK+SKL+K ++ K+K         +IE 
Sbjct: 897  NKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIEE 956

Query: 930  MNL--LKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNNAL-DELIDLYAAT 986
            + +  L + H LML  K GQ  +++FS CS  SLFLSKL  +   N+++ D LID+Y +T
Sbjct: 957  LTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDSIYDRLIDIYLST 1016

Query: 987  TKEWMLKGKFSTNVFIDFTNWLSSKKQ 1013
             K+W  KGKF T+ F DF NWL+SKKQ
Sbjct: 1017 MKKWFSKGKFGTSFFFDFINWLASKKQ 1043

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  525 bits (1351), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 320/714 (44%), Positives = 453/714 (63%), Gaps = 37/714 (5%)

Query: 3   GKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRNSA 62
            KVNRD F+KLASDL EERL AAV +IKDLSALE+P + EEW+Y +NRL+KGL S RNSA
Sbjct: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61

Query: 63  RLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDERG 122
           RLGFS+CL+E +NL +++   + P+GL S   +L  L+  L    ++G K+  KGKDERG
Sbjct: 62  RLGFSMCLSEALNLALSL-GDKAPEGLNSIENYLKILNETLGADFDEGKKR--KGKDERG 118

Query: 123 IXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFSLF 182
           I            NEPLFS +FV   K G + FV  F++++I+L+  KNWIREP LFSL+
Sbjct: 119 ILFGKLFGLQALLNEPLFSNVFV--TKDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176

Query: 183 QTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDE--SLIPSTLDLRNS 240
           QT++ L+  +++S    ++   D+ +LT+TNEGL+ YL+L  ES++      + + L+N 
Sbjct: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236

Query: 241 GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLF- 299
           GWK+NDPLA+GNLP LTKVL D+  +       Q  K++  ANWNPRLHFVW+ LL    
Sbjct: 237 GWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQ-RKQKGGANWNPRLHFVWEKLLSTII 295

Query: 300 -GSGKLENTE--HITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLI 356
            GS  L N E  H++             SI+F EFW+M VDE++FN+KASSERKYLGFLI
Sbjct: 296 NGSHSL-NVEDKHVSKKRKKNNTIA---SIKFHEFWQMVVDETYFNDKASSERKYLGFLI 351

Query: 357 IDATFKTVPG-SCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKL 415
               F  +     +     QN +R+LINQ  + +R LNKIA  T+E IV++CE D   K+
Sbjct: 352 FQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT-KI 410

Query: 416 VPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPH 475
           +P    + FG  GSI FD+L+K+ ++S+L+ IK +   VL++L      QL  K  +   
Sbjct: 411 LPVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEKSF 470

Query: 476 THFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYS 535
           + FILDS+LH++R  K E++ + + + VL  I+ +AFF         E L E++KERL+S
Sbjct: 471 SQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDN-----ETLQEMSKERLFS 525

Query: 536 ILGELTINKEVNSEDPQINSWQYLTLNLILD-IEKSYKADLINPLDESLEKIKNEAISSL 594
           IL EL  N    SE  +I   QY+ + L+   IE   K  + + LD+ L + ++ A+  L
Sbjct: 526 ILSEL--NSLHLSESQEIP--QYVVIKLVQQHIEGGEK--MTSELDDELRETESSALRIL 579

Query: 595 AEISKSNTTQSW--GLSTLLSMCLIQLYAGETDSISVIEELCEFTKH----DNNSMVGIT 648
           AEI+K+ T + +  GL +L + CL+QLY G+++S+  ++EL +  +     D   +  IT
Sbjct: 580 AEIAKA-TDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPLSSIT 638

Query: 649 EILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702
           EILLS LAQKKALL+K S+ +W+Q +  V  +EL +LLD+L ARENKQGFAQLF
Sbjct: 639 EILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLF 692

 Score =  220 bits (561), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 170/267 (63%), Gaps = 6/267 (2%)

Query: 750  VVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXX-XX 808
            V NIDKE T AL KAL LP +I+N  GEVD+ +L                          
Sbjct: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDD 812

Query: 809  QLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKV 868
            QLSEIFKRRKEALSNI TGN+RK EVKESRE+VI+FKHRIVD+L VY+K+ EK+     V
Sbjct: 813  QLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQREDV 872

Query: 869  ENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDKNIE 928
            + +S  +  L+ L+ F +PM+KCI++TLDK LA+K++KLLK ++FKI+    K+     +
Sbjct: 873  DENSKAD-KLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTGIKL--DTAD 929

Query: 929  LMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGG--NNALDELIDLYAAT 986
            ++   +  H+  L +KPGQ   +++S CS++SL+ SK+  +         + L+D Y+ T
Sbjct: 930  VVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYSTT 989

Query: 987  TKEWMLKGKFSTNVFIDFTNWLSSKKQ 1013
             KEW+   KF  ++F+DF NWL+SKKQ
Sbjct: 990  IKEWLKDTKFPHSIFLDFVNWLASKKQ 1016

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
           Ashbya gossypii ACR020C
          Length = 1027

 Score =  517 bits (1331), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 308/734 (41%), Positives = 453/734 (61%), Gaps = 64/734 (8%)

Query: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRNSAR 63
           +VNRDLF++LASD++EER+ AAV ++ +LS +    + +EW YVL RLIKGLAS R  AR
Sbjct: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 64  LGFSLCLTEVVNLGINMPSGQRPKG-LESKNEFLDTLSSILDIYVNDGSKKPVKGKDERG 122
           LGFS+CL+EVV LG+        KG LES   ++  L   L     DG  K   GK+ERG
Sbjct: 63  LGFSMCLSEVVTLGLE-------KGRLESVEVYIGQLFEKL----ADGHVK--NGKEERG 109

Query: 123 IXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFSLF 182
           +            NEPLF  IF+D  K  + +F + FM+ L+ LAL K W+REPCLF+L+
Sbjct: 110 LVFGKLFGLQALLNEPLFGRIFMDG-KVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLY 168

Query: 183 QTIKMLLPFMNESTAVK-ILLIYDKYDLTLTNEGLSTYLVLKYESDE-------SLIPST 234
           Q I+ L     E   ++ I  + D + LTLTNEGL+ YL+L YE  E       S I S 
Sbjct: 169 QLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSK 228

Query: 235 LDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDV 294
           + LR S WKNNDPL++GN+ +L+ VL+D  ++P     ++D   ++  +W PRLHFVWD+
Sbjct: 229 ITLR-SCWKNNDPLSKGNVTILSSVLKD--IIP-----VEDNVMKQKGSWAPRLHFVWDI 280

Query: 295 LLPLFGS-----GKLENTEHITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSER 349
           L+P+        G  E+               V+  + F EFW++ VDESFFN KASSER
Sbjct: 281 LIPILCRQQEIPGAAEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSER 340

Query: 350 KYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEE 409
           KYLG LII+   + VP S + S FS+N+MRTLINQS +S R L+KI+   L++IV  CE 
Sbjct: 341 KYLGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICES 400

Query: 410 DPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEK 469
           DP  K++P +N++ FGP+GSINFD LTKS  +  +IA++ L S  LA L++  + ++ ++
Sbjct: 401 DPT-KVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKE 459

Query: 470 RGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDE---------- 519
              +    ++LD LLHI++AHK++  D+   KP+L+ I+ ++FF     +          
Sbjct: 460 SSPVSKVRYLLDILLHIVQAHKLKA-DMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHA 518

Query: 520 ---QEFEQLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLI 576
               E +++  L++ERL+SILG+L    + N + P   +W Y+TL ++  I + ++  LI
Sbjct: 519 DADAESKKIPVLSRERLFSILGQLIPTSKQNVDGP---TWPYVTLQIV--IAEEHRRSLI 573

Query: 577 NPLDESLEKIKNEAISSLAEISKSN-----TTQSWGLSTLLSMCLIQLYAGETDSISVIE 631
             LDE L++ K  A+ ++ +I K +      ++  GL  LL + ++Q+Y+G+ +S S++E
Sbjct: 574 FKLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILE 633

Query: 632 ELCEFTKHDN---NSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDV 688
           EL  F K  +   N +VGITEILLS +AQKKA+LR+L+LI+W+  I+ +  +EL +L D+
Sbjct: 634 ELTTFYKSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDI 693

Query: 689 LKARENKQGFAQLF 702
           L  RENKQGFA LF
Sbjct: 694 LSVRENKQGFAALF 707

 Score =  206 bits (524), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 118/263 (44%), Positives = 163/263 (61%), Gaps = 9/263 (3%)

Query: 753  IDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXXXXXXXXXQLSE 812
            I+KE T AL  AL LP+N++++ G+V                              QLSE
Sbjct: 768  INKETTSALADALKLPENMIDENGDVGFEDF--DDGDEEEEEEESMDDEAMMELDGQLSE 825

Query: 813  IFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSS 872
            IFKRRKEALS + TGN+RK+EV+ESRE+VISFKHR++DML +Y KY  +LA  ++   +S
Sbjct: 826  IFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQCEAS 885

Query: 873  NLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFK-ILDKNIELMN 931
             L    S     I P+LKCI++T+D+PLA+K +KLLK  I K+K   FK  +D+  E++ 
Sbjct: 886  KLLNIHS----MIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVF 941

Query: 932  L-LKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNN-ALDELIDLYAATTKE 989
            L L++ H  ML  KPGQ   ++F ACSTSSLFL K+      +    + +ID+Y+ + K 
Sbjct: 942  LSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKN 1001

Query: 990  WMLKGKFSTNVFIDFTNWLSSKK 1012
            W +KGKF  N FIDF NWL+SK+
Sbjct: 1002 WTVKGKFGPNFFIDFINWLASKR 1024

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  504 bits (1298), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 306/717 (42%), Positives = 445/717 (62%), Gaps = 52/717 (7%)

Query: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAE-EWSYVLNRLIKGLASDRNSA 62
           +V+RDLF+KLASD+ EER+ + V ++ +L  L +  + E EW YV++RL+KGL S+RNSA
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 63  RLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYV--NDGSKKPVKGKDE 120
           RLGFS+CLTE ++L ++    +RP+ L+   ++L  + S   +       +K  VKGKDE
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 121 RGIXXXXXXXXXXXXNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180
           RG             NEPLFS +F       + +F+I F E++I L   KNW+ EPC FS
Sbjct: 122 RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174

Query: 181 LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240
           L+Q I+ LLP +++  A   +   D++ LT+TNEGLS YL+L     +    S   L NS
Sbjct: 175 LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA----KKFTLSDFTLENS 230

Query: 241 GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300
            WK NDPL +GNL ++ KV+ D++V          A    N NW PRLH++WD++L  F 
Sbjct: 231 AWKANDPLQKGNLSVMAKVMLDTNV--------DGANSNTNKNWAPRLHYIWDIILREFF 282

Query: 301 SGKLENTE--HITXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIID 358
             +   ++  H+            Q  ++F  FW+  VDESFFN+KAS ERKY G+LI  
Sbjct: 283 DNEQHGSDAKHVYQKKKHDKSKNPQR-VEFKSFWQAVVDESFFNDKASPERKYQGYLIFQ 341

Query: 359 ATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPC 418
              ++VP S +  CF+QN+MR++INQ+ DS+R+LNK++Q TL ++V  CE +P  KL P 
Sbjct: 342 KAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEP-AKLTPV 400

Query: 419 LNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFL--LQLQEKRGDL--- 473
           L A+LF   GS+NFD LTKS  +S+L+A K+     LA LI  F   L + +K  +L   
Sbjct: 401 LTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEEL 460

Query: 474 -PHTHFILDSLLHIIRAHKVEI-NDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKE 531
            P   FILDSLL++IR+ K  +  D  I+  +L   I +AFF     +++ E ++ +AKE
Sbjct: 461 NPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFF-----QKDNEYINNIAKE 515

Query: 532 RLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAI 591
           RL S+L EL +   + S D    SW YL L +I+  EKS    LI+ LD+SL  +K E++
Sbjct: 516 RLSSMLAELIV---LPSTD---GSWPYLALEIIVTKEKS--ETLIDSLDDSLVAVKAESL 567

Query: 592 SSLAEIS--KSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF----TKHDNNSMV 645
             L +IS  KS ++Q  G+ +L+SM LIQLY+G+ +SI +IE+L  F    + H+  +  
Sbjct: 568 DILKKISELKSKSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFT 627

Query: 646 GITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702
           G+TEILLS LAQ+K+LLRKLSL++W+QFI+ +G EE+ +LL+ L ARENK+GF+ LF
Sbjct: 628 GVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684

 Score =  232 bits (591), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 175/278 (62%), Gaps = 14/278 (5%)

Query: 750  VVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGXXXXXXXXXXXXXXXX------XX 803
            +  IDKE T AL KAL+LPDNI+N+ GEV++N L G                        
Sbjct: 744  ISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKM 803

Query: 804  XXXXXQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLA 863
                 QLSEIFKRRK+ALS +STGNQRK++VKESRENVI+FKHRI+DML +Y+K+ E+L+
Sbjct: 804  MELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863

Query: 864  I----ANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANT 919
            +      KV  +   E  L+ ++  +     C+++TLDKPL +KI KL KG+  KI+   
Sbjct: 864  LNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923

Query: 920  FKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYF----EIGGNNA 975
            F+ ++ + E+MN L+  H  + T+KPGQ ++ ++  CS++SL+L +       E      
Sbjct: 924  FEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKM 983

Query: 976  LDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQ 1013
             ++L+D+YAATTK WM +GK+   +F+DF NWL+SKKQ
Sbjct: 984  FEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021

>ABR142W Chr2 (664880..670759) [5880 bp, 1959 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR271W (SLH1)
          Length = 1959

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 12/79 (15%)

Query: 383 NQSIDSQRILNKIAQITLESIVKACEEDPIKKLV----------PCLNAMLFGPHGSINF 432
           N    + R+  K+ Q+  ES + + EE+ +K+LV           CLN +LF   GS N 
Sbjct: 87  NDQAKAVRVYKKLFQLLDESTLHSSEEEVVKQLVVILKTHGEGWECLNRLLFDCLGSENI 146

Query: 433 DKLTKSNIISKLIAIKELP 451
           + L  S +I +   +K+LP
Sbjct: 147 ELL--SYVIQQQAVLKQLP 163

>Kwal_56.23671 s56 (649753..651726) [1974 bp, 657 aa] {ON} YLR103C
           (CDC45) - Chromosomal DNA replication initiation protein
           [contig 175] FULL
          Length = 657

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 47/89 (52%), Gaps = 12/89 (13%)

Query: 19  EERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLAS--DRNSARLGFSLCLTEVVNL 76
           ++RLH   A +     + L +  E W Y+ NR+ K L S  D+N  R G    L ++V  
Sbjct: 367 KKRLHKIFARM----GISLSTAQENWLYMDNRIKKELGSIFDKNLERYG----LQDIVRD 418

Query: 77  GINMPSGQRPKGLESKNEFLDTLSSILDI 105
           G     G R  G  S +EF+++++++L++
Sbjct: 419 GFVRTFGYR--GAISASEFVESITALLEV 445

>KLTH0A02684g Chr1 complement(227861..234283) [6423 bp, 2140 aa]
           {ON} similar to uniprot|P43583 Saccharomyces cerevisiae
           YFL007W BLM3 Protein involved in assembly of proteasomal
           core particles in the nucleus required for normal
           resistance to bleomycin may be involved in protection
           against oxidative damage
          Length = 2140

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 52/128 (40%), Gaps = 19/128 (14%)

Query: 7   RDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGL----------- 55
           R L F +      E L     L+K +     PS+   W+ V+ + + G            
Sbjct: 489 RPLVFSMNGSRNHEFLDKLQGLVKSIETFAHPSNNGPWTKVIAKFVHGFIKMYHERVKME 548

Query: 56  ----ASDRNSARLGFSLCLTEVVNLGINMPS-GQRPKGLESKNEFLDTLSSILDIYVNDG 110
               A+ R   +L  S C T VVN+   +   G + K  E  N ++  L+ +LDI  N G
Sbjct: 549 KNPKANHRCHLKLN-SACHTRVVNIFQEVIFLGAQNKNSEMANYYISCLAYLLDI--NPG 605

Query: 111 SKKPVKGK 118
           +K  V  K
Sbjct: 606 NKDLVFSK 613

>KLTH0G12980g Chr7 (1112178..1114091) [1914 bp, 637 aa] {ON} highly
           similar to uniprot|Q08032 Saccharomyces cerevisiae
           YLR103C CDC45 DNA replication initiation factor
          Length = 637

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 12/89 (13%)

Query: 19  EERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLAS--DRNSARLGFSLCLTEVVNL 76
           ++RLH   A +     + L +  E W Y+ NR+ K L S  D+N  R G    L ++V  
Sbjct: 347 KKRLHKIFARM----GIPLSTAQENWLYMDNRIKKELGSIFDKNLERYG----LQDIVRD 398

Query: 77  GINMPSGQRPKGLESKNEFLDTLSSILDI 105
           G     G R  G  S +EF++ ++++L++
Sbjct: 399 GFVRTFGYR--GAVSASEFVEAITALLEV 425

>KLLA0B10032g Chr2 (879469..880047) [579 bp, 192 aa] {OFF} conserved
           hypothetical protein
          Length = 192

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 21/105 (20%)

Query: 900 LADKISKLLK---------GKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHAS 950
           L   +SKLLK          K++ I +N F ILD   +L        +++L+S  G+ AS
Sbjct: 45  LVKNVSKLLKQLVRGRSMDSKVYDIGSNYFTILDPTFQLFG------KILLSSDLGKIAS 98

Query: 951 VFFSACSTSSL------FLSKLYFEIGGNNALDELIDLYAATTKE 989
           ++    STS+        + K++  +  +N   +L+  Y A T E
Sbjct: 99  IYLHHVSTSAYSQDLRQLILKIWEFLDHDNFQCDLMVFYIANTIE 143

>Klac_YGOB_OAZ1 Chr2 (879228..879488,879490..880047) [819 bp, 272
           aa] {ON} ANNOTATED BY YGOB - Uncertain about exact site
           of ribosomal frameshift. Replaces KLLA0B100032g
          Length = 272

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 21/105 (20%)

Query: 900 LADKISKLLK---------GKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHAS 950
           L   +SKLLK          K++ I +N F ILD   +L        +++L+S  G+ AS
Sbjct: 125 LVKNVSKLLKQLVRGRSMDSKVYDIGSNYFTILDPTFQLFG------KILLSSDLGKIAS 178

Query: 951 VFFSACSTSSL------FLSKLYFEIGGNNALDELIDLYAATTKE 989
           ++    STS+        + K++  +  +N   +L+  Y A T E
Sbjct: 179 IYLHHVSTSAYSQDLRQLILKIWEFLDHDNFQCDLMVFYIANTIE 223

>Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222C
           (REAL)
          Length = 704

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 5/93 (5%)

Query: 546 VNSEDPQINSWQYLTL---NLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISKSNT 602
           ++ E+  +N+ +YL+      IL    SY+A L    D +  K + E I  + ++S+++ 
Sbjct: 96  IHKEENPLNNMRYLSSKHNRHILYGPTSYRAILATQTD-TFTKYR-EKIWKVLKLSRNSW 153

Query: 603 TQSWGLSTLLSMCLIQLYAGETDSISVIEELCE 635
            +    STL  +  I+  + +TDS SVIE LCE
Sbjct: 154 KREHHYSTLSEISSIEAVSPQTDSQSVIESLCE 186

>Suva_10.334 Chr10 complement(582909..583895) [987 bp, 328 aa] {ON}
           YLR239C (REAL)
          Length = 328

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 354 FLIID-ATFKTVPGSCIGSCFSQNVMRTLINQSI--DSQRILNKIAQITLESIV 404
           ++I+D  TF   P  C+ SC  Q  ++TL+N  +  DS + LN  A  T E+ V
Sbjct: 177 YIILDLKTFHNFPAKCLVSCIEQATIQTLMNTKMNNDSGKPLNLDAVTTKETGV 230

>YLR239C Chr12 complement(616332..617318) [987 bp, 328 aa] {ON}
           LIP2Lipoyl ligase, involved in the modification of
           mitochondrial enzymes by the attachment of lipoic acid
           groups
          Length = 328

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 354 FLIID-ATFKTVPGSCIGSCFSQNVMRTLINQSI--DSQRILNKIAQITLESIV 404
           ++I+D  TF++ P  C+ SC  Q  +RTL N  +  D+ + LN  A  T ++ V
Sbjct: 177 YIILDLKTFQSFPAKCLVSCIEQATIRTLKNTKMCDDTDKPLNLDAMTTKDTGV 230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,801,846
Number of extensions: 4160934
Number of successful extensions: 13579
Number of sequences better than 10.0: 58
Number of HSP's gapped: 13747
Number of HSP's successfully gapped: 85
Length of query: 1019
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 899
Effective length of database: 39,721,479
Effective search space: 35709609621
Effective search space used: 35709609621
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)