Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.336.9ON40140120810.0
Suva_5.126.9ON40140018690.0
YEL056W (HAT2)6.9ON40140018600.0
Smik_5.316.9ON42740018190.0
NDAI0K029006.9ON43841112771e-175
KNAG0E009806.9ON41440012141e-165
ZYRO0F00462g6.9ON39340012051e-164
NCAS0F001906.9ON41140612071e-164
Kpol_1045.786.9ON39240111901e-162
TDEL0G046206.9ON39240311891e-162
Ecym_30126.9ON39739511271e-152
SAKL0E00814g6.9ON39839411151e-151
KAFR0L003206.9ON39140210921e-147
KLLA0D00814g6.9ON40839510821e-145
CAGL0B03575g6.9ON41939910771e-145
ACR017W6.9ON42338510711e-144
KLTH0C11550g6.9ON39838610491e-141
TPHA0M001906.9ON39140010411e-140
Kwal_56.223456.9ON39638710201e-136
TBLA0A071206.9ON4074009951e-132
Kpol_1024.398.548ON4174183142e-31
SAKL0H09900g8.548ON4254123021e-29
TBLA0H036508.548ON4194152992e-29
TPHA0L017208.548ON4194122983e-29
KLTH0E12694g8.548ON4184122965e-29
KLLA0E23541g8.548ON4174072949e-29
YBR195C (MSI1)8.548ON4224222931e-28
CAGL0M05291g8.548ON4194232888e-28
Ecym_70428.548ON4144082842e-27
Smik_2.3358.548ON4224232843e-27
Suva_4.4498.548ON4244222834e-27
AEL250C8.548ON4174132817e-27
Skud_2.3218.548ON4224162755e-26
TDEL0B029808.548ON4124142745e-26
ZYRO0A13068g8.548ON3974062728e-26
Kwal_27.120708.548ON4184212729e-26
KAFR0I008408.548ON4134222712e-25
KNAG0A036708.548ON4264192692e-25
NDAI0C055108.548ON4194182641e-24
NCAS0B021708.548ON4144182543e-23
Suva_13.3112.401ON5103991773e-13
YMR131C (RRB1)2.401ON5113991676e-12
KAFR0A003802.401ON5164061604e-11
CAGL0K03861g2.401ON5133951571e-10
TDEL0G033402.401ON5144011571e-10
Sklu_YGOB_Anc_2.4012.401ON5204071533e-10
KLLA0F17237g2.401ON5234241524e-10
Skud_13.2912.401ON5094091516e-10
TPHA0G026502.401ON5164131498e-10
Smik_13.3292.401ON5094091499e-10
ADR242C2.401ON5212481462e-09
TBLA0B092502.401ON5263991453e-09
Kpol_1041.202.401ON5154001444e-09
KLLA0E08449g2.283ON4222081382e-08
Kwal_47.178272.401ON5234001382e-08
KNAG0E021802.401ON5174031364e-08
KLTH0E09394g2.401ON5224001364e-08
KLLA0E19515g7.356ON5721561355e-08
NCAS0F019702.401ON5114141347e-08
NDAI0H027502.401ON5124081321e-07
Ecym_60672.401ON5224181312e-07
AAR078W7.356ON5621581302e-07
ZYRO0A08690g2.401ON5164021302e-07
YLR196W (PWP1)7.356ON5761501283e-07
SAKL0F11506g7.356ON5681551276e-07
Suva_10.2927.356ON5801501267e-07
Kpol_1060.246.276ON4861991241e-06
Kwal_56.246617.356ON5611551241e-06
KNAG0B025807.356ON5801501232e-06
AEL269C7.534ON4551571222e-06
ZYRO0B02486g7.356ON5751481204e-06
KAFR0L015207.356ON5841561204e-06
NCAS0G011206.276ON4943181194e-06
TDEL0C019207.356ON5631501195e-06
Skud_12.2617.356ON5801501195e-06
TDEL0A068906.276ON4473601179e-06
Smik_12.2567.356ON5761501179e-06
KAFR0J009805.201ON4801481179e-06
CAGL0A04037g7.356ON5831521171e-05
KLTH0H01122g7.356ON5791591161e-05
TBLA0A038908.316ON3622181142e-05
KLTH0G10296g2.283ON4262281142e-05
KAFR0H033402.283ON3672021132e-05
NCAS0B036908.288ON11451221133e-05
KNAG0I010508.288ON11591571133e-05
Kwal_33.151365.201ON4731431123e-05
Kwal_27.115502.283ON4071911105e-05
SAKL0H16390g8.288ON11401531115e-05
Kpol_530.257.356ON5741521106e-05
NDAI0E044407.356ON5811501106e-05
YKR036C (CAF4)1.247ON6432171106e-05
KLTH0B03410g5.201ON4771711097e-05
ZYRO0E08184g6.276ON5063451097e-05
KLLA0F15598g5.201ON4781921098e-05
TDEL0E042805.201ON4811431089e-05
Kwal_56.236858.288ON11021461099e-05
NCAS0E028407.356ON6071481099e-05
NDAI0J011808.288ON11341201091e-04
Ecym_47177.356ON6031571071e-04
Suva_14.3112.283ON3892031062e-04
NCAS0D027305.201ON4751981062e-04
TPHA0F030307.356ON5821501062e-04
TBLA0C050107.356ON5721511052e-04
KLLA0E07085g3.25ON4522061052e-04
CAGL0H00781g6.276ON5133671052e-04
Kpol_2002.995.201ON4871411043e-04
YNL035C2.283ON3892591043e-04
Skud_11.2711.247ON6462391053e-04
TBLA0D040208.288ON11781221053e-04
KNAG0M017505.201ON4851561043e-04
Smik_6.3488.672ON4511301034e-04
SAKL0H06666g8.672ON4411491025e-04
Suva_11.2681.247ON6452391035e-04
Kpol_1003.342.283ON3881851025e-04
YPL151C (PRP46)8.672ON4511411025e-04
ZYRO0B10450g5.201ON4822151026e-04
KAFR0B055808.288ON11201221026e-04
Kwal_55.220673.25ON4511131017e-04
Skud_16.1318.672ON4511301008e-04
KLTH0C07634g3.259ON4251731008e-04
Smik_10.1261.247ON7122171019e-04
KLTH0G13068g8.288ON11011191010.001
SAKL0E07766g2.283ON398142990.001
Suva_13.3252.380ON347212990.001
TBLA0C018408.672ON423154990.001
Suva_16.606.276ON526212990.001
Ecym_42808.288ON11321601000.001
Suva_16.1598.672ON451130990.001
Kwal_56.24399na 1ON369146980.001
CAGL0M04081g3.25ON455192980.001
SAKL0A01738g6.325ON909150990.001
SAKL0D04796g1.247ON769170990.002
TBLA0H020005.201ON473138980.002
KLLA0F19734g8.288ON1133160990.002
TDEL0D010904.309ON642171980.002
TPHA0E030805.201ON488123980.002
CAGL0D05588g5.201ON477123980.002
NDAI0F012406.276ON524174980.002
KLTH0F19294g3.25ON451113970.002
Ecym_33212.283ON409197970.002
NDAI0I021805.201ON479130970.002
Skud_14.2982.283ON389195970.002
Skud_13.3072.380ON347212960.002
ZYRO0D08206g6.340ON515303970.002
AAL157C5.201ON479123970.002
Smik_11.2981.247ON662221970.002
KLTH0A06754g6.340ON514268960.003
TDEL0G021402.283ON392204960.003
KNAG0B064504.309ON634127960.003
ADL184W3.25ON449137960.003
TBLA0B059202.283ON403181950.003
AEL314W1.247ON715172960.003
Smik_6.4516.276ON523170950.003
SAKL0G12892g5.201ON476163950.003
TPHA0P014903.25ON459192950.004
Smik_13.3442.380ON347211940.004
KAFR0F010606.276ON553183950.004
YPL247C6.276ON523170950.004
NDAI0G006302.283ON397198940.005
Skud_10.1021.247ON708232940.005
ZYRO0D06556g8.288ON1147243940.006
Kpol_1028.416.340ON512265930.006
TDEL0A004403.25ON451192930.006
KAFR0H024508.672ON417194930.006
KLLA0F11231g8.672ON434141930.007
TBLA0E045704.309ON59582930.007
AER114W4.309ON633128930.007
NCAS0C044503.25ON461203930.007
Smik_14.2962.283ON389205920.008
KNAG0I028406.340ON519219920.008
NCAS0C032608.324ON983143930.008
KNAG0A032208.631ON423153920.008
TDEL0A075506.340ON515265920.009
KAFR0A033801.247ON666184920.009
TBLA0B087303.25ON461134920.009
YMR146C (TIF34)2.380ON347211910.009
KNAG0J016808.672ON398141910.010
Kpol_1001.234.309ON610135910.011
Kwal_26.87768.672ON433146910.011
TPHA0D035906.276ON598334910.012
Ecym_71055.201ON484148900.013
ZYRO0B13838g4.309ON684117910.014
YCR072C (RSA4)6.340ON515268900.014
NDAI0I004606.325ON917147910.014
TDEL0F044308.316ON367221900.014
Suva_10.645.201ON490146900.016
AGR067W8.288ON1125160900.017
Skud_4.3898.288ON1151129900.017
TBLA0F041306.340ON514303900.017
KLTH0D11132g8.672ON437146890.018
TPHA0J018906.135ON689134900.018
Suva_3.1096.340ON515268890.019
Skud_16.4827.534ON465200890.019
Smik_12.5254.309ON652128890.020
TPHA0M018306.340ON515219890.021
Kwal_26.87008.651ON381110880.022
Smik_12.525.201ON489123890.022
TBLA0E007607.534ON384124880.022
KNAG0D007406.276ON504164890.022
TDEL0E049005.139ON785190890.022
Kwal_0.2121.399ON30395880.023
KAFR0G019708.631ON425161880.023
KLLA0D02530g4.309ON707130890.023
KAFR0E012303.259ON369136880.023
Suva_3.936.325ON920147890.023
Suva_4.537.310ON1271176890.024
Skud_16.326.276ON522217880.024
TPHA0C033702.283ON413162880.024
Kwal_23.63246.340ON514222880.025
YNL317W (PFS2)3.25ON465130880.026
KLTH0H12122g1.399ON30395870.027
KLTH0H02508gna 1ON309151870.028
Smik_4.3748.288ON1152129880.028
KNAG0B016101.247ON674266880.028
Kwal_26.75702.431ON218166860.028
Ecym_20263.25ON451137870.031
CAGL0M02277g8.672ON427128870.031
Suva_14.223.25ON469130870.032
KLLA0F10791g6.135ON545132870.033
SAKL0G14432g5.139ON789201880.034
CAGL0H03729g1.399ON30388860.034
ZYRO0F07282g8.672ON427141870.034
Smik_3.1726.340ON515268870.034
YDR128W (MTC5)8.288ON1148129880.035
Kpol_487.71.399ON30388860.036
Suva_10.5454.309ON642128870.037
YLL011W (SOF1)5.201ON489130870.039
KNAG0A030808.651ON446197860.040
Smik_14.143.25ON466130860.040
TBLA0G020904.309ON640126870.041
Ecym_25236.363ON646231870.041
KLLA0C08547g6.340ON515325860.042
Skud_3.1336.325ON916147870.043
Smik_3.1576.325ON924147870.043
Kpol_1036.698.324ON936120870.043
Skud_3.1456.340ON515265860.043
KLTH0D15840g4.309ON697142870.043
TPHA0G031002.469ON509208860.044
Smik_13.2772.469ON513184860.045
AFR199C2.431ON334162850.046
ZYRO0A01804g2.283ON376106860.046
KAFR0I005004.309ON52792860.047
Kpol_1016.111.247ON669169860.047
TDEL0D013101.247ON709149860.048
TPHA0I032407.534ON477241860.048
NCAS0G038702.283ON389157860.048
TPHA0B005904.309ON588130860.049
TDEL0A061808.672ON434197860.050
KNAG0I009208.316ON381212850.051
KLTH0D10648g8.651ON449108860.051
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.33
         (401 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   806   0.0  
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   724   0.0  
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   721   0.0  
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   705   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     496   e-175
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   472   e-165
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   468   e-164
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   469   e-164
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   462   e-162
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   462   e-162
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   438   e-152
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   434   e-151
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   425   e-147
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   421   e-145
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   419   e-145
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   417   e-144
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   408   e-141
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   405   e-140
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   397   e-136
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   387   e-132
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   125   2e-31
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   120   1e-29
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   119   2e-29
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   119   3e-29
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   118   5e-29
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   117   9e-29
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   117   1e-28
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   115   8e-28
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   114   2e-27
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   114   3e-27
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   113   4e-27
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   112   7e-27
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   110   5e-26
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   110   5e-26
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   109   8e-26
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   109   9e-26
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   108   2e-25
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   108   2e-25
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   106   1e-24
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   102   3e-23
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    73   3e-13
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    69   6e-12
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    66   4e-11
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    65   1e-10
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    65   1e-10
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    64   3e-10
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    63   4e-10
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    63   6e-10
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    62   8e-10
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    62   9e-10
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    61   2e-09
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    60   3e-09
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    60   4e-09
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    58   2e-08
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    58   2e-08
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    57   4e-08
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    57   4e-08
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    57   5e-08
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    56   7e-08
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    55   1e-07
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    55   2e-07
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    55   2e-07
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    55   2e-07
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    54   3e-07
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    54   6e-07
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    53   7e-07
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    52   1e-06
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    52   1e-06
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    52   2e-06
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    52   2e-06
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    51   4e-06
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    51   4e-06
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    50   4e-06
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    50   5e-06
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    50   5e-06
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    50   9e-06
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    50   9e-06
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    50   9e-06
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    50   1e-05
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    49   1e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    49   2e-05
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    49   2e-05
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    48   2e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    48   3e-05
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    48   3e-05
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    48   3e-05
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    47   5e-05
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    47   5e-05
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    47   6e-05
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    47   6e-05
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    47   6e-05
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    47   7e-05
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    47   7e-05
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    47   8e-05
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    46   9e-05
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    47   9e-05
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    47   9e-05
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    47   1e-04
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    46   1e-04
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    45   2e-04
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     45   2e-04
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    45   2e-04
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    45   2e-04
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    45   2e-04
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    45   2e-04
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    45   3e-04
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    45   3e-04
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    45   3e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    45   3e-04
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    45   3e-04
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    44   4e-04
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    44   5e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    44   5e-04
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    44   5e-04
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    44   5e-04
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    44   6e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    44   6e-04
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    44   7e-04
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    43   8e-04
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    43   8e-04
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    44   9e-04
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    44   0.001
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    43   0.001
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    43   0.001
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    43   0.001
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    43   0.001
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    43   0.001
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    43   0.001
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    42   0.001
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    42   0.001
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    43   0.001
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    43   0.002
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    42   0.002
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    43   0.002
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    42   0.002
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    42   0.002
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    42   0.002
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    42   0.002
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    42   0.002
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    42   0.002
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    42   0.002
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    42   0.002
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    42   0.002
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    42   0.002
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    42   0.002
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    42   0.002
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    42   0.003
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    42   0.003
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    42   0.003
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    42   0.003
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    41   0.003
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    42   0.003
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    41   0.003
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    41   0.003
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    41   0.004
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    41   0.004
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    41   0.004
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    41   0.004
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    41   0.005
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    41   0.005
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    41   0.006
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    40   0.006
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    40   0.006
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    40   0.006
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    40   0.007
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    40   0.007
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    40   0.007
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      40   0.007
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    40   0.008
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    40   0.008
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    40   0.008
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    40   0.008
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    40   0.009
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    40   0.009
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    40   0.009
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    40   0.009
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    40   0.010
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    40   0.011
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    40   0.011
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    40   0.012
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    39   0.013
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    40   0.014
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    39   0.014
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       40   0.014
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    39   0.014
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    39   0.016
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    39   0.017
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.017
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    39   0.017
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    39   0.018
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    39   0.018
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    39   0.019
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    39   0.019
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    39   0.020
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    39   0.021
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    39   0.022
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    39   0.022
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               39   0.022
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    39   0.022
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    39   0.022
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    39   0.023
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    39   0.023
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    39   0.023
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    39   0.023
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    39   0.023
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    39   0.024
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    39   0.024
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    39   0.024
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    39   0.025
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    39   0.026
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    38   0.027
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    38   0.028
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    39   0.028
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    39   0.028
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    38   0.028
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    38   0.031
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    38   0.031
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    38   0.032
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    38   0.033
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    39   0.034
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    38   0.034
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    38   0.034
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    38   0.034
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    39   0.035
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    38   0.036
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    38   0.037
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    38   0.039
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    38   0.040
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    38   0.040
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    38   0.041
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    38   0.041
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    38   0.042
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    38   0.043
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    38   0.043
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    38   0.043
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    38   0.043
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    38   0.043
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    38   0.044
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    38   0.045
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    37   0.046
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    38   0.046
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    38   0.047
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    38   0.047
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    38   0.048
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    38   0.048
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     38   0.048
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    38   0.049
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    38   0.050
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    37   0.051
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    38   0.051
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      38   0.051
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    37   0.051
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    38   0.052
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    37   0.052
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    37   0.053
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    38   0.053
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    37   0.053
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    38   0.053
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    37   0.053
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    37   0.057
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    37   0.057
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    37   0.060
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    37   0.063
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    37   0.063
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    37   0.065
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    37   0.068
ACR162C Chr3 complement(637642..640224) [2583 bp, 860 aa] {ON} S...    37   0.069
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    37   0.073
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    37   0.077
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    37   0.079
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    37   0.079
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    37   0.080
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    37   0.084
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    37   0.086
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    37   0.089
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    37   0.090
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    37   0.090
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    37   0.095
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    37   0.095
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    37   0.096
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    37   0.097
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    37   0.097
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    37   0.10 
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    37   0.10 
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    37   0.11 
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    37   0.11 
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    37   0.11 
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    37   0.11 
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    37   0.12 
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    37   0.12 
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    36   0.13 
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    37   0.13 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    36   0.13 
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    37   0.13 
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    36   0.13 
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    36   0.14 
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    36   0.15 
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    36   0.15 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    36   0.15 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    36   0.15 
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     36   0.17 
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    36   0.17 
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    36   0.18 
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    36   0.19 
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    36   0.19 
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    36   0.19 
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    36   0.19 
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    36   0.20 
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    36   0.20 
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    36   0.21 
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    35   0.21 
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    35   0.21 
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     36   0.21 
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    36   0.21 
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    35   0.22 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    35   0.23 
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    36   0.23 
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    35   0.24 
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    35   0.24 
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    35   0.25 
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    35   0.26 
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    35   0.26 
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    35   0.26 
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       35   0.26 
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    35   0.26 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    35   0.27 
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    35   0.27 
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    35   0.27 
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     35   0.27 
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    35   0.27 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    35   0.28 
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    35   0.28 
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    35   0.28 
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    35   0.29 
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    35   0.30 
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    35   0.31 
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    35   0.33 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    35   0.33 
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    35   0.34 
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      35   0.37 
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    35   0.38 
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    35   0.40 
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    35   0.40 
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    35   0.40 
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    35   0.40 
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    35   0.41 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    35   0.41 
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    35   0.42 
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    35   0.43 
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    34   0.44 
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    35   0.45 
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    34   0.45 
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    34   0.45 
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    34   0.46 
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    35   0.46 
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    35   0.46 
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    34   0.47 
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    35   0.47 
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    34   0.48 
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    34   0.49 
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    34   0.50 
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    34   0.51 
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    34   0.51 
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    34   0.52 
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    34   0.52 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    35   0.52 
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    34   0.54 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    34   0.54 
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    34   0.56 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    34   0.58 
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    34   0.59 
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    34   0.59 
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    34   0.60 
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    34   0.61 
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    34   0.62 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    34   0.62 
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    34   0.63 
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    34   0.63 
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    34   0.63 
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    34   0.65 
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    34   0.65 
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    34   0.65 
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    34   0.67 
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    34   0.67 
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    34   0.67 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    34   0.68 
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    34   0.69 
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    34   0.69 
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    34   0.69 
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    34   0.70 
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    34   0.71 
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    34   0.71 
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     34   0.72 
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    34   0.72 
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    34   0.73 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    33   0.74 
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    34   0.74 
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    34   0.74 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    34   0.75 
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    34   0.76 
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    34   0.76 
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    34   0.77 
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    34   0.81 
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    33   0.81 
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    34   0.81 
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    33   0.81 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    34   0.83 
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    34   0.84 
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    34   0.84 
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    34   0.85 
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     33   0.87 
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    33   0.88 
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    34   0.91 
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    34   0.91 
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    33   0.92 
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    33   0.94 
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    34   0.95 
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    33   0.95 
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    33   0.98 
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    33   0.98 
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    33   0.99 
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    33   1.0  
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             33   1.0  
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    33   1.1  
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    33   1.1  
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    33   1.1  
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    33   1.1  
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    33   1.1  
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    33   1.2  
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    33   1.2  
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    33   1.2  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   1.2  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    33   1.2  
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    33   1.2  
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    33   1.2  
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    33   1.2  
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    33   1.3  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    33   1.4  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    33   1.4  
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    33   1.4  
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    33   1.4  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    33   1.4  
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    33   1.5  
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    33   1.6  
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    33   1.6  
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    33   1.6  
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    33   1.8  
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    32   1.8  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    33   1.9  
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    33   2.0  
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    33   2.0  
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    33   2.1  
CAGL0K11638g Chr11 complement(1124172..1125950) [1779 bp, 592 aa...    32   2.1  
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    33   2.2  
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    32   2.2  
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    32   2.3  
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    32   2.3  
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    32   2.4  
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    32   2.4  
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    32   2.4  
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    32   2.5  
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    32   2.6  
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    32   2.6  
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    32   2.6  
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    32   2.7  
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    32   2.8  
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    32   2.8  
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    32   3.0  
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    32   3.1  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    32   3.1  
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      32   3.1  
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    32   3.1  
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    32   3.1  
KLTH0H11286g Chr8 complement(965578..967500) [1923 bp, 640 aa] {...    32   3.2  
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    32   3.2  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    32   3.3  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    32   3.3  
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    32   3.4  
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    32   3.4  
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    32   3.5  
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    32   3.6  
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    32   3.8  
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    32   4.0  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    32   4.0  
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    32   4.0  
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    32   4.1  
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    32   4.2  
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    32   4.2  
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     32   4.3  
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    32   4.3  
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    32   4.3  
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    31   4.3  
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    32   4.4  
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    32   4.4  
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    32   4.4  
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    32   4.5  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    32   4.5  
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    32   4.5  
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    31   4.6  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    32   4.6  
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    31   4.6  
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    32   4.9  
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    32   4.9  
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    31   5.0  
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    31   5.3  
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    31   5.3  
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       31   5.4  
TDEL0B03120 Chr2 complement(553997..554650) [654 bp, 217 aa] {ON}      30   5.6  
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    31   5.6  
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    31   5.6  
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    31   5.6  
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    31   5.7  
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    31   5.8  
TBLA0F03430 Chr6 complement(847381..849822) [2442 bp, 813 aa] {O...    31   6.1  
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    31   6.2  
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    31   6.4  
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    31   6.5  
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    31   6.5  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    31   6.8  
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    31   7.0  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    31   7.0  
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    31   7.5  
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    30   7.8  
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    30   7.8  
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    31   8.0  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    31   8.0  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    31   8.1  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    30   8.7  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    30   8.7  
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    30   8.8  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    30   9.0  
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    30   9.0  
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    30   9.0  
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    30   9.3  
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    30   9.4  
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    30   9.4  
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    30   9.5  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    30   9.5  
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    30   9.8  
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    30   9.9  

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/401 (97%), Positives = 390/401 (97%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60
           MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI
Sbjct: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
           IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS
Sbjct: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
           DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA
Sbjct: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240

Query: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN
Sbjct: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           LEFSPH           NRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360

Query: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIVG 401
           NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIVG
Sbjct: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIVG 401

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/400 (85%), Positives = 370/400 (92%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60
           ME QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQ+P+GGFIKQELI
Sbjct: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
           IGTHTSGEEENYLKFAEINLPKE+LNNE+PQE+A   DE S P PRSNI+ITAKY+HEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           ITRARYMPQ+P  VATINGQGTVF+YSRS+GLQSTLKFH++NGYALSFSPL++G LLSGS
Sbjct: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
           DDH+VALWDV+G SDST PIRTW DLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND+R 
Sbjct: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240

Query: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           ENTT  TAKCP+PFNTLAFSHHSSN+LAAAG DSHVYLYDLRNMKEPLHHMSGHEDAVTN
Sbjct: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           LEFSPH           NRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH+SAVNDFDL
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360

Query: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
           NAQ+PWL+ASTEEENILQVWKCSHSLP+VGG PK++ D++
Sbjct: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/400 (85%), Positives = 367/400 (91%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60
           ME QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQ+  GGFIKQELI
Sbjct: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
           IGTHTSGEEENYLKFAEINLPKE+L+NE+PQE+A    ++SLP PRSNIRITAKYEHEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           ITRARYMPQDPN+VATINGQGTVFLYSRS+GLQSTLKFHKDNGYALSFS L+KG LLSGS
Sbjct: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
           DDH+VALW+V  G D T P+RTW+DLHSDI+ND+KWHNFNKDLFGTVSEDSLLKIND+RA
Sbjct: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240

Query: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
            NTTIDT KCPQPFNTLAFSHHSSN+LAAAGMDS+VYLYDLRNMKEPLHHMSGHEDAV N
Sbjct: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           LEFS H           NRL+MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRS+VNDFDL
Sbjct: 301 LEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360

Query: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
           N Q+PWL+AS EEENILQVWKCSHSLPIVGG PK+NKDI+
Sbjct: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/400 (82%), Positives = 364/400 (91%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60
           ME QEK LSVDEEYDLWKSNVPLMYDFVSETRLTWPSL+VQWLPTP+Q+ +GGFI+QELI
Sbjct: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86

Query: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
           IGTHTSGEEENYLKFAEIN+PKE+LNN++PQE+AE  D+A+L  P+SNIRITAKY HEEE
Sbjct: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           ITRARYMPQ+P+ VAT+NGQGTVFLYSRS GLQSTLKFHKDNGYALSF+ L++G LLSGS
Sbjct: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
           DDH+VALW+V   S S +P+RTW+DLHSDIVND KWHNFN+ LFGTVSEDSLLKIND+RA
Sbjct: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266

Query: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
            N TID  KCPQPFNTLAFSHHSSN+LAAAGMDSHVYLYDLRNM+EPLHHMSGHEDAVTN
Sbjct: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           +EFS H           NRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRS+VNDFDL
Sbjct: 327 IEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386

Query: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
           NAQ+PWL+AS+EEENILQVWKCSH+LPIVGG PK+NKDI+
Sbjct: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  496 bits (1277), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 240/411 (58%), Positives = 308/411 (74%), Gaps = 20/411 (4%)

Query: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP-----TPVQQPKGGFIKQE 58
           + K L++DEEYDLWKSNVPLMYDFVSET+LTWP+LTV+WLP     TPV        +QE
Sbjct: 33  ENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN------RQE 86

Query: 59  LIIGTHTSGEEENYLKFAEINLPKEVL----NNENPQEQAEMGDEASLPPPRSNIRITAK 114
           LI+GTHTSGEE+NYLK A I+LP EV+    N+   Q + +  ++     PRSNI+I  K
Sbjct: 87  LILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKK 146

Query: 115 YEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSD----GLQSTLKFHKDNGYALSFSP 170
           ++HEEEITRAR+MPQ+ +++ATING GTVF+Y++S+     L STL+FHK+NGY LSF+P
Sbjct: 147 FKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP 206

Query: 171 LIKGHLLSGSDDHSVALWDVSGGSD-STTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSE 229
             KG LLSGSDD ++ALWD+   S  +  P++ WD +H+DIVND KW+ FN ++F +VSE
Sbjct: 207 NDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266

Query: 230 DSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLH 289
           DS L+++D R +NT I++ K   PFNTLAFS HS  ++AAAG DS VYLYD RN+  PL+
Sbjct: 267 DSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLY 326

Query: 290 HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 349
            M+GHED++TNLEFSPH            R+IMWD+  IGAEQ PDDAEDG PE+IM+HA
Sbjct: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386

Query: 350 GHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
           GHRSAVNDF +N  +PWL+AS EEENI+QVWKCSH LPIVGG P+++  I+
Sbjct: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSIL 437

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  472 bits (1214), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 230/400 (57%), Positives = 292/400 (73%), Gaps = 16/400 (4%)

Query: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGT 63
           + +PL   EEYDLWKSNVP+MYDFVSETRL WPSLTVQWLP     P     +QELI+GT
Sbjct: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNP---VTRQELILGT 83

Query: 64  HTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITR 123
           HTS EE+NYLK A ++LP EV +  N  E     DE  +   RSNIR+T K++H+ E+TR
Sbjct: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTE----SDEEQV---RSNIRVTRKFKHDSEVTR 136

Query: 124 ARYMPQDPNMVATINGQGTVFLYSRS---DGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           ARYMPQDPN++ATI+G GTV++Y RS   D    TL++H DNGY L+F+PLIKGHLLSGS
Sbjct: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGS 196

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
           DD +VALWDV+  SD   P++ W+++HSDIVND +WHNF K LFGTVSEDS L+I+D R 
Sbjct: 197 DDSNVALWDVT--SDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR- 253

Query: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           E+  + T    +PFNTL+FSHHS N+LA  G++S VYLYD R ++EPLH MSGH DAVT+
Sbjct: 254 ESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           L+FS              R+I+WD+  IGAEQ  +DAED   E++M+HAGHRS +NDF +
Sbjct: 314 LDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAI 373

Query: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
           N  +PWL+AS EEENI+Q+WKCSH LP + G P +  D++
Sbjct: 374 NPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  468 bits (1205), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 292/400 (73%), Gaps = 19/400 (4%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTH 64
           EKPLS+DEEYDLWKSNVPLMYDFVSET LTWPSLT++WLP      +     QE+I+GTH
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNR-----QEMILGTH 62

Query: 65  TSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRA 124
           TS EE+NYLK A I LP EV+ +  P+E+ E+         +SN++I  K+EHE E+TRA
Sbjct: 63  TSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEV--------LKSNVKIIKKFEHENEVTRA 114

Query: 125 RYMPQDPNMVATINGQGTVFLYSRSD----GLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           RYMPQD N++ATI+G GT++LY+R++    GL ST +FH +NGY LSF+P  KG LLSGS
Sbjct: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGS 174

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
           DD ++ LWDV+G S    PI T+ D HSDIVND KWHNF++++FG+VSEDS L+++D R 
Sbjct: 175 DDSNIVLWDVTGKSQE--PILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232

Query: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
            +  ++  +  +P+NTLAFS HS+N+ AAAG DS VYLYD R   +PLH M GHEDAVT+
Sbjct: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           LEF P             R I+WDL +IGAEQ PDDA+DG PE++M+HAGHRS++NDF +
Sbjct: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352

Query: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
           N  +PWL A+ EEENI+QVWK S  LP +GG P ++  ++
Sbjct: 353 NPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL 392

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  469 bits (1207), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 294/406 (72%), Gaps = 20/406 (4%)

Query: 1   MEGQE----KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP--TPVQQPKGGF 54
           ++G+E    K LS+DEEY+LW+SNVPLMYDFVSETRLTWPSL+++WLP     Q P    
Sbjct: 11  VQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPN--- 67

Query: 55  IKQELIIGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAK 114
            +QELIIGTHTSGEE+NYLK A I+LP +++ +    E  + G+  +    +SNI+I  K
Sbjct: 68  -RQELIIGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTT----KSNIKIIKK 122

Query: 115 YEHEEEITRARYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSP 170
           ++HEEEITRARYMPQ+ N+VATING G VFLY RS     GL ST ++HK+NGY LSF+ 
Sbjct: 123 FKHEEEITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNC 182

Query: 171 LIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSED 230
              G LLSGSDD ++ALW+V+  + S  PI  W  +HSDIVND KW NF+ ++FG+VSED
Sbjct: 183 NDAGKLLSGSDDGTIALWNVNNSNSS--PIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED 240

Query: 231 SLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHH 290
           S L+++D R ++T     K   PFNTLAFS HS  + AAAG DSHVYL+D R++  PLH 
Sbjct: 241 STLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300

Query: 291 MSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAG 350
           M+GH+ AVTN+EFSP             R I+WD+  IG EQ PDDAEDG PE++M+HAG
Sbjct: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAG 360

Query: 351 HRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKIN 396
           HRSA+NDF +N  +PWL+AS+EEENI+QVWKCSH LP VGG P ++
Sbjct: 361 HRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVS 406

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  462 bits (1190), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 219/401 (54%), Positives = 294/401 (73%), Gaps = 20/401 (4%)

Query: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGT 63
           QE+PL+VD+EY+LWK+NVPLMYDFVSETRLTWPSLT QWLP   +       +Q +I+GT
Sbjct: 7   QEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED-----TRQYMILGT 61

Query: 64  HTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITR 123
           HTSGEE +YLK A ++LP EV+  E   +             +SNI+I  K+EH+ EI R
Sbjct: 62  HTSGEEVDYLKVAALDLPDEVVTGEANDDNRRT---------KSNIKIVKKFEHDGEINR 112

Query: 124 ARYMPQDPNMVATINGQGTVFLY----SRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSG 179
           ARYMP+D N++ATING+G V +Y    SRSDGL++TLK+HK+NGY LSF+P +   L+SG
Sbjct: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172

Query: 180 SDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239
           SDD ++ALWD+  GS S  P   WD++HSDIVND  WH+F+++LFG+VSEDS LK++D R
Sbjct: 173 SDDFTIALWDIDSGSKS--PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230

Query: 240 AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVT 299
           + +  I+T +    FNTLAFS HS+N+ AAAG+D+++YLYD R   +PLH M+GHEDA+T
Sbjct: 231 STSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAIT 290

Query: 300 NLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFD 359
            L+F P             R+I+WDL +IGAEQ PD+A+DG PE++M+HAGHRSA+NDF 
Sbjct: 291 CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFT 350

Query: 360 LNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
           L+  +PWL AS EE+N++QVWKCS +L  VGG P+I+  ++
Sbjct: 351 LHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  462 bits (1189), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 225/403 (55%), Positives = 286/403 (70%), Gaps = 19/403 (4%)

Query: 2   EGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII 61
           E  +KPLS+DEEY+LW+SNVPLMYDFVSET LTWP+LT++WLP      +     QELI+
Sbjct: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNR-----QELIL 58

Query: 62  GTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEI 121
           GTHTS EE NYLK A I+LP E++  +  +E+            +SNI+I  K++HE+E+
Sbjct: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGF--------TKSNIKIIKKFKHEQEV 110

Query: 122 TRARYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLL 177
           TRARYMPQD N++ATING GTVFLY RS    +GL S+L FH+DNGY LSF+P+ KG LL
Sbjct: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLL 170

Query: 178 SGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237
           SGSDD  +ALWD++  ++ST P+ TW+  H D VND KWH  N + FG+VSED  L+++D
Sbjct: 171 SGSDDSKIALWDIT--TNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228

Query: 238 IRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDA 297
            R +++  D  K    FNT+AFS HS+N+ AAAG DS +YLYD R     LH MSGHE  
Sbjct: 229 QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVND 357
           VTNLEF               R+IMWDL +IGAEQ PDDA+DG PE++M+HAGHRS VND
Sbjct: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVND 348

Query: 358 FDLNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
           F +N  +PWL+AS EEENI+QVWKCS  LP VGGLPK++  ++
Sbjct: 349 FSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVL 391

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  438 bits (1127), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 212/395 (53%), Positives = 282/395 (71%), Gaps = 28/395 (7%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPT-----PVQQPKGGFI 55
           +E  E PL+VD+EY+LWKSNV LMYDFVSET+LTWPSL++QWLP+     P++Q      
Sbjct: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ------ 60

Query: 56  KQELIIGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKY 115
            QE+I+GTHTSG+E NYLK A I+LP EV+   +    +E        P +S I++T K+
Sbjct: 61  -QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSE--------PVKSMIKVTKKF 111

Query: 116 EHEEEITRARYMPQDPNMVATINGQGTVFLY----SRSDGLQSTLKFHKDNGYALSFSPL 171
           EHE+E+ RARYMP++  ++ATING+G +F+Y    S+S+GL  TL +HKDNGY L+F+P 
Sbjct: 112 EHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQ 171

Query: 172 IKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDS 231
           I+G LLS SDD +VALWD++      + +      H+DIVNDSKWH F++++FGTVSED 
Sbjct: 172 IEGELLSASDDTTVALWDINSTDRPVSIVMN----HTDIVNDSKWHEFDENIFGTVSEDK 227

Query: 232 LLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHM 291
            L+++D R+ + +       +P N LAFS HS N++AAAG D+ VYLYDLR + EPLH M
Sbjct: 228 TLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTM 287

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH 351
           +GH+DAVT++EFS H            RL +WDL QIGAEQ  +DA+DGVPEL+M+HAGH
Sbjct: 288 AGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGH 347

Query: 352 RSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
           RSA+NDF  N QVPWLIAS EE+N++QVWK S  L
Sbjct: 348 RSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKL 382

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  434 bits (1115), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 220/394 (55%), Positives = 273/394 (69%), Gaps = 13/394 (3%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60
           +E + K LS++EEY+LWK+NVPLMYDFVSET+LTWPSLT+QWLP           KQE+I
Sbjct: 3   IEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLP-----GNSSSTKQEMI 57

Query: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
           +GTHTSGE++NYLK A I LP+++L  E  +      +       +S I+IT K +HEEE
Sbjct: 58  LGTHTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEE 117

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHL 176
           ITRAR+MPQDPN +ATING G VFL+ RS    + L S   FHKDNGY LSF+P  KG L
Sbjct: 118 ITRARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGEL 177

Query: 177 LSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236
           LS SDD ++ALW+V G + S +   T    H DIVND  WH FN++LFG+VSED  L+I+
Sbjct: 178 LSCSDDGTIALWNVMGTNTSPSKAVT---THEDIVNDCTWHEFNENLFGSVSEDKTLQIH 234

Query: 237 DIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHED 296
           D R  N+T+       PFNTL FS HS N+ AAAG DS VYLYDLRN  + LH MSGHED
Sbjct: 235 DKRT-NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHED 293

Query: 297 AVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVN 356
           +VT+LEFSPH            R+++WDL QIG+EQ  +DA DGVPEL+M+HAGH+SAVN
Sbjct: 294 SVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVN 353

Query: 357 DFDLNAQVPWLIASTEEENILQVWKCSHSLPIVG 390
           DF  N  +PWL+AS EE+NI+ VWK S  L   G
Sbjct: 354 DFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPG 387

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  425 bits (1092), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 214/402 (53%), Positives = 281/402 (69%), Gaps = 20/402 (4%)

Query: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGT 63
           +E+ LS+DEEY LWKSNVPLMYDFVSET+LTWPSLTV+WLP     P+    +QE+IIGT
Sbjct: 6   EERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLP---HDPQAPLTQQEMIIGT 62

Query: 64  HTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITR 123
           HTS +E NY+K A I LP EV++  N           S  P +SN+RIT K++ E+EITR
Sbjct: 63  HTSDQEPNYVKIASIELPNEVIDPHN----------VSDAPVKSNVRITKKFKLEKEITR 112

Query: 124 ARYMPQDPNMVATINGQGTVFLYSR--SDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSD 181
           +RYM QDPN+++TI+G GTV ++ R  SD    T  +HKDNGY LSF+P+ KG LLS +D
Sbjct: 113 SRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAAD 172

Query: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSED-SLLKINDIRA 240
           D  +A++D++  S+   P+ TW    + I+ND KWH+F+  LFGTVSE+ + L I D+R 
Sbjct: 173 DGYIAMYDINAESED--PVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT 230

Query: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           ++  + + +  QPFN+LAFS HS N+ +AAG D +VYLYDLRN ++ LH MSGHE  VTN
Sbjct: 231 KDK-VTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTN 289

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           LEF               R+I+WDL +IG+EQ  +DA+D  PEL+M+HAGHRS+VNDF L
Sbjct: 290 LEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSL 349

Query: 361 NAQVPWLIASTEEENILQVWKCSHSLP-IVGGLPKINKDIVG 401
           N+ +PWLIASTEEENI+QVWK S  LP I    P IN D++ 
Sbjct: 350 NSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLIN 391

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  421 bits (1082), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 210/395 (53%), Positives = 280/395 (70%), Gaps = 15/395 (3%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPK----GGFIK 56
           +E  E+P +++EEYDLW SNVP+MYDFVSETRLTWPSLTVQWLPT +Q P+       ++
Sbjct: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQ-PREVDGQQLLR 62

Query: 57  QELIIGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYE 116
           QEL+IGT T+  E NYLK A I+LP+ V +++     ++   E  L   +S I+I  K++
Sbjct: 63  QELLIGTLTTDNEPNYLKIAAIDLPENVTSSK--PSVSDDAKENELSHRQSKIKIVRKFK 120

Query: 117 HEEEITRARYMPQDPNMVATINGQGTVFLYSRS-----DGLQSTLKFHKDNGYALSFSPL 171
           HE+E+TRARYMPQ PN++AT+NG G V+++ R+      G  ++  +HK+NGY L+F+P 
Sbjct: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180

Query: 172 IKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDS 231
           + G LLS SDD +VALWDV+  ++ + P +T+D +H+DIVND KWH F   LFGTVSED+
Sbjct: 181 VSGQLLSASDDGTVALWDVTSTANKS-PSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDN 238

Query: 232 LLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHM 291
            L I+D  ++   I        FNTLAFS  S N+LAAAG DS+VYLYDLR +++PLH M
Sbjct: 239 TLIIHDTNSDRA-IQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSM 297

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH 351
           +GHED+VT+LEFSPH            R+IMWDL  IGAEQ PDDA DGVPEL M+H GH
Sbjct: 298 AGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGH 357

Query: 352 RSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
           RS VN+F  N+ VPWL+ S EEEN+LQ+WK ++ +
Sbjct: 358 RSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKI 392

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  419 bits (1077), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/399 (50%), Positives = 285/399 (71%), Gaps = 10/399 (2%)

Query: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHT 65
           +P++VDEEY+LWKSNVP++YDFVSETRLTWP+LTV+WLP   +       +Q+LI+GTHT
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ--KNLVAARTRQQLILGTHT 83

Query: 66  SGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRAR 125
           SGEE+NYLK   ++LP EV  N     + +  DE  +    SN++I  K+ H+ EITRAR
Sbjct: 84  SGEEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMV---LSNVKIVKKFPHDGEITRAR 140

Query: 126 YMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLLSGSD 181
           YMPQD N++ATING+G +F+Y RS    + L STL++H +NGY L+F+   K  LLSGSD
Sbjct: 141 YMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD 200

Query: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAE 241
           D ++ALWD+S    +  P  T++D H+DI+ND KWH+    +FG+VSEDS +K+ D R+ 
Sbjct: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS- 259

Query: 242 NTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNL 301
           +  I      +P+NTLAFS  SSN+ AAAG D+ VYLYD+R++  PL+ M+GHEDAVT +
Sbjct: 260 SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAI 319

Query: 302 EFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLN 361
           EF P+            R I+WDL++IGAEQT D+ EDG PE++M+HAGH++++ND  +N
Sbjct: 320 EFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVN 379

Query: 362 AQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400
             + WL+AS EE+NI+Q+WKCS ++P +GG P+++  I+
Sbjct: 380 PNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  417 bits (1071), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/385 (52%), Positives = 262/385 (68%), Gaps = 20/385 (5%)

Query: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHT 65
           + L+V+EEY+LW SNVP+MY+FVSET+LTWPSLT+QWLP+  Q P+     Q LI GTHT
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPE-----QSLIFGTHT 94

Query: 66  SGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRAR 125
           +GEE NYLK A INLP  +   +   E+ E  D +S         I  K+ H EE+ RAR
Sbjct: 95  AGEEVNYLKVATINLPAGIAGLDQGDEEDEANDHSSFA-------IANKFPHIEEVIRAR 147

Query: 126 YMPQDPNMVATINGQGTVFLYSR----SDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSD 181
           YMP + N++ATING+GT+ ++ R    S    STL FHK+NGY L+F+P I G LLSGSD
Sbjct: 148 YMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSD 207

Query: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAE 241
           D +VALWD+       + + +    H DIVND KWH F  ++FGTVSED  L+++D R  
Sbjct: 208 DTTVALWDIEAAKKPKSILTS----HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263

Query: 242 NTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNL 301
              +       PFNTL+FS HS N+LAAAG+DS +YLYD+R+M  PLH MSGH+D+VT +
Sbjct: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323

Query: 302 EFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLN 361
           EFSPH            R I+WDL QIGAEQ+ DDA+DG PEL+M+HAGHRS VN+F  N
Sbjct: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383

Query: 362 AQVPWLIASTEEENILQVWKCSHSL 386
            Q+PWL+ASTEE+N++Q WK S  L
Sbjct: 384 PQIPWLLASTEEDNVIQAWKVSMKL 408

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 205/386 (53%), Positives = 270/386 (69%), Gaps = 13/386 (3%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTH 64
           E  +SVDEEYDLWKSNVPLMYDFVSET+L WPSLT+QWLP+  +  +     QELI+GTH
Sbjct: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-----QELILGTH 61

Query: 65  TSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRA 124
           TSG E+NYLK A ++LP EV+++      +    + S   P+S I+I  K+EH +E+TRA
Sbjct: 62  TSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRA 121

Query: 125 RYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           RY P +PN++ATI+G G VFLY RS      L +   FHK+NGY L+FS +  G LLS S
Sbjct: 122 RYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCS 181

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
           DD S+A+WDV  G +  TP++  D  H++IVN+ KWH  +  LFG+VS+DS L I+D R 
Sbjct: 182 DDGSIAIWDVCSGKN--TPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238

Query: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           +   +   +  +P+NTLAFS HSSN+ AAAG DS V LYDLR  + P+H MSGH D+VT+
Sbjct: 239 DKPVVKILQS-EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           LEF+PH            R+++WDL QIGAEQ  +DA+DGVPEL+M+HAGH+S VNDF  
Sbjct: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC 357

Query: 361 NAQVPWLIASTEEENILQVWKCSHSL 386
           +  +PWL+AS EEEN++Q+WK S  L
Sbjct: 358 SPNIPWLMASVEEENVVQIWKASKKL 383

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  405 bits (1041), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 197/400 (49%), Positives = 270/400 (67%), Gaps = 21/400 (5%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60
           +E QE+PL+VD+EYDLWKSNVPL+YDFVSETRLTWPSLT+QWLP           +Q LI
Sbjct: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTS-----TRQHLI 58

Query: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
           +GT TSG E +YLK A ++LP E++  +   +             +SN+++  K+ H+ E
Sbjct: 59  LGTLTSGAETDYLKIAALDLPDEIIIGKKSDKVV-----------KSNLKVVKKFAHDGE 107

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYS----RSDGLQSTLKFHKDNGYALSFSPLIKGHL 176
           I RARYMPQ+ N++AT+NG+GT+F+Y     +   L STLK+HKDN Y L+F+P  +G L
Sbjct: 108 INRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGEL 167

Query: 177 LSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236
           +SGSDD ++ALWD +       PI+ W   HSDIVND +WH FN ++FG+VSEDS L++ 
Sbjct: 168 ISGSDDSTIALWDATN-DKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226

Query: 237 DIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHED 296
           D R    +         +N++AFS  S N+ AAAG  +++YLYD+RN  + LH M+GHE+
Sbjct: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286

Query: 297 AVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVN 356
            VT+LEFS              R+IMWDL +IGAEQ PD+A+DG+PE++M+HAG RSA+N
Sbjct: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346

Query: 357 DFDLNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKIN 396
           D   +  +PWL AS EE NI+QVWKCS  LP + G P+++
Sbjct: 347 DISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVS 386

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  397 bits (1020), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 206/387 (53%), Positives = 270/387 (69%), Gaps = 17/387 (4%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTH 64
           E+ LS+D+EYDLWKSNVPLMYDFVSETRL WPSLT+QWLP           +QEL++GTH
Sbjct: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS-----TEQELLVGTH 61

Query: 65  TSGEEENYLKFAEINLPKEVLNNENPQEQAEM-GDEASLPPPRSNIRITAKYEHEEEITR 123
           TS  E+NYLK AEINLP+E+L+NE P  Q +  G +  +P   S I+I  K++HE E+TR
Sbjct: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVP---SKIKIIKKFKHENEVTR 118

Query: 124 ARYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLLSG 179
           ARY P D N++ATI+G GTVFLY R+    + L+    +HK+NGY L+FS    G L+S 
Sbjct: 119 ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISC 178

Query: 180 SDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239
           SDD S+A+WD+  G    T + +   LHSDIVN+ KWH  + +++G+VSEDS L I+D R
Sbjct: 179 SDDGSIAIWDIKSGKTVPTSVNS---LHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR 235

Query: 240 AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVT 299
           +E   +      +PFNT+AFS HSSN+ AAAG D+ VYL+D R   E LH MSGH++AVT
Sbjct: 236 SEKP-LQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVT 294

Query: 300 NLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFD 359
           +LEF+ H            R+++WDL QIG EQ  +DA+DG PEL+M+HAGH+SA+NDF 
Sbjct: 295 SLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFS 354

Query: 360 LNAQVPWLIASTEEENILQVWKCSHSL 386
            +  VPWL+AS EEENI+Q+WK S  L
Sbjct: 355 FSPNVPWLMASVEEENIVQIWKPSRKL 381

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  387 bits (995), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 198/400 (49%), Positives = 271/400 (67%), Gaps = 31/400 (7%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPT--PVQQPKGGFIKQE 58
           ++ +E+PL+ D+EY+LWKSNVPL+YDFVSET+L WPSLTV+WLP+      P     +Q 
Sbjct: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSN---EQR 69

Query: 59  LIIGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHE 118
           L++GTHTSGEE+NYLK AEI LP +++N        E  ++ S    +SNIRI  K++HE
Sbjct: 70  LLLGTHTSGEEQNYLKIAEITLPDQIIN--------EKTEDNSDKHVKSNIRIIKKFKHE 121

Query: 119 EEITRARYMPQDPNMVATINGQGTVFLY------SRSDGLQSTLKFHKDNGYALSFSPLI 172
            E+TRA YMPQD  ++ATING GTVF+Y      ++S+ + S L  HK+NGY L+F+PL 
Sbjct: 122 LEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLD 181

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           KG LLS SDD SVA W++      + P+ T  +  + I+ND +W+ FN++LFG V+E S 
Sbjct: 182 KGKLLSSSDDGSVAYWNIQ----KSIPLLTLQE--TSIINDVRWNQFNQNLFGYVTESSC 235

Query: 233 LKINDIRAENTTIDTA-----KCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEP 287
           L + D+R  N  +        K P  FN +AFS HS  ++AA+G DS +YLYD RN+ +P
Sbjct: 236 LNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQP 295

Query: 288 LHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDG-VPELIM 346
           LH+M GHED+VT+L+F               R+ +WDLKQIG EQT D+ EDG VPEL+M
Sbjct: 296 LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLM 355

Query: 347 VHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
           +HAGHRS +NDF ++  + WL AS EE+NI+QVWK ++SL
Sbjct: 356 IHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  125 bits (314), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 99/418 (23%), Positives = 182/418 (43%), Gaps = 60/418 (14%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTS 66
           P    + Y  WK N  L+Y++++     WPSLT Q+ P    +         +++ + TS
Sbjct: 18  PKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDS----HRILLSSFTS 73

Query: 67  G--EEENYLKFAEINLPKEV----LNNENPQEQAEMGDEAS--LPPPRSNIRITAKYEHE 118
               E+  L    I+  K +    LNN +  E     D ++  LPP      +  ++ + 
Sbjct: 74  SLVPEDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPNG 133

Query: 119 EEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLI------ 172
           +   RARY+PQ+P+++A  +  G+V+++ R+     T    + +G+  S+   +      
Sbjct: 134 D-CNRARYLPQNPDLIAAASSDGSVYIFDRTK--HGTAMHSRQSGFTQSYQAKLAVNNNS 190

Query: 173 ------------------KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWD---DLHSDIV 211
                             +GHL+    D  V  WD++    S   I+  +    L     
Sbjct: 191 QSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGC 250

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQP--FNTLAFSHHSSNILAA 269
           ND+ W   +  LF   SED+ L + D R E+  ID +        N   F+  +S +LA+
Sbjct: 251 NDAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLAS 310

Query: 270 AGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQI 328
                ++ L+D+R  + P++ +  H  +++ +E++P+           + L+ +WD    
Sbjct: 311 GDSIGNICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA--- 366

Query: 329 GAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
                      G  + + +H GH   VND   N   PWL+ S  ++N +Q+WK +H+L
Sbjct: 367 -----------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  120 bits (302), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 99/412 (24%), Positives = 182/412 (44%), Gaps = 49/412 (11%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTS 66
           P  V   Y  WK N  L+YD+++     WPSLT Q+ P           +  L++ + TS
Sbjct: 27  PEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTND----QHRLLLSSFTS 82

Query: 67  GE--EENYLKFAEIN----LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
            +  E+  +  + ++    LP   LNN +  E     D +S  P ++ I+         +
Sbjct: 83  SQLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGD 142

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNG----------------- 163
              ARY+PQ+P+++A  +  G+++++ R+    +  K H D G                 
Sbjct: 143 CNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLH-DGGSMFELEFQSSSLEEHQE 201

Query: 164 -YALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHS---DIVNDSKWHNF 219
             +L+++   +G L +      V +WDV   S +   I   D  H+      ND  W   
Sbjct: 202 VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVN 261

Query: 220 NKDLFGTVSEDSLLKINDIRAE----NTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
           +  +     E + + + D RA+    ++T DT    +  N+  F++H+  +L +      
Sbjct: 262 HASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGR 321

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTP 334
           V L+D+R+++ PL  +  H  +++  +++P+           + L+ +WD+ Q   E   
Sbjct: 322 VNLWDIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE--- 377

Query: 335 DDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
                   EL+ VH GH   VND   N   PWL+ S   +N +Q+W+ + +L
Sbjct: 378 --------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  119 bits (299), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 96/415 (23%), Positives = 180/415 (43%), Gaps = 61/415 (14%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGE- 68
           + + Y  WK N  L+YD+++     WPSLT Q+ P   +          L++ T TS + 
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSND----THRLLLSTFTSSQI 68

Query: 69  ---EENYLK-FAEIN-LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITR 123
              E  Y+   + +N L    LNN +  E     D     P ++ I   +    E +  +
Sbjct: 69  PDDESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNK 128

Query: 124 ARYMPQDPNMVATINGQGTVFLYSRSD----------------------GLQSTLKFHKD 161
           ARYMPQ+P+++   +  G ++++ R+                        L    KF  +
Sbjct: 129 ARYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIE 188

Query: 162 NG--------YALSFSPLIKGHLLSGSDDHSVALWDVS---GGSDSTTPIRTWDDLHSDI 210
           +G         +++++P  +G LLS   + ++ LWD        +       WD    D+
Sbjct: 189 DGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDL 248

Query: 211 -VNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNIL 267
             N+  W N +  +F T  E++ + + D R E    +I+        N+  F++ ++ +L
Sbjct: 249 GCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLL 308

Query: 268 AAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLK 326
           A+   +  + L+D+R + +P+ ++  H  +++ +E+SP            + L+ +WD  
Sbjct: 309 ASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD-- 365

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
            I  E+ P          I +H GH   +ND   +   PWL+ S   +N +Q+WK
Sbjct: 366 -ISNEEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWK 409

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 100/412 (24%), Positives = 182/412 (44%), Gaps = 55/412 (13%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSG-- 67
           + E Y  WK N  L+YD+++     WPSL+ Q+     Q          +++ + TSG  
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFF----QDVNTKNDSHRILLSSFTSGLM 78

Query: 68  ---EEENYLKFAEI-NLPKEVLNNENPQEQAEMGDE-ASLPPPRSNIRITAKYEHEEEIT 122
              E  N +  + + ++P   LNN +  E     D    LPP   +   T  + + +   
Sbjct: 79  PEQESINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGD-CN 137

Query: 123 RARYMPQDPNMVATINGQGTVFLYSRS---DGLQSTLKFHK------------------- 160
           RARY+PQ+ +++A  +  GTV++++R+     L+ T  F                     
Sbjct: 138 RARYLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNP 197

Query: 161 DNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDD---LHSDIVNDSKWH 217
           +   ++ ++   +G L +   D  +  WD+   S++ T I T      + ++  ND  W 
Sbjct: 198 NEALSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWM 257

Query: 218 NFNKDLFGTVSEDSLLKINDIRA--ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
             +  L     E + L I DIR   E+TTI +       N   F++ ++ I+A+A    +
Sbjct: 258 PLHDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGN 317

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTP 334
           V+++D+R   E +  +  H  +++ +E++P+           + L+ +WD+         
Sbjct: 318 VHIWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD------- 369

Query: 335 DDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
                   ELI  H GH   VND   N   PWL+ S   +N +Q+W+ +H+L
Sbjct: 370 -------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  118 bits (296), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 100/412 (24%), Positives = 178/412 (43%), Gaps = 57/412 (13%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGE--E 69
           + Y  WK N  L YD+++     WPSLT Q  P           +  +++ + TS +  E
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFP----DLDLATDEHRILLSSFTSSQVPE 78

Query: 70  ENYLKFAEIN----LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRAR 125
           +  L  A ++    +P   LNN + +E+    D +   P +S +          +  +AR
Sbjct: 79  DESLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKAR 138

Query: 126 YMPQDPNMVATINGQGTVFLYSRSD--------------------GLQSTLKFHKDNGYA 165
           Y P +P+++ + +  G+++++ R+                      L ++L+ HK+   +
Sbjct: 139 YCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVS 198

Query: 166 LSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTP-------IRTWDDLHSDIVNDSKWHN 218
           L+++   +G L +      V +WD+    D  +P       + T D   S   N+  W  
Sbjct: 199 LAWNWQRQGLLATSYSHGQVCVWDLEK-YDKNSPTLINPLAMSTVDPRGS---NEVSWMV 254

Query: 219 FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQ---PFNTLAFSHHSSNILAAAGMDSH 275
            +  L    SED+L+ I DIR       +   P      NT  F++H   +L +A     
Sbjct: 255 RHDSLLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGR 314

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTP 334
           + L+D+RN  +PL  +  H D+++ L+++P              L+ +WDL Q   +   
Sbjct: 315 INLWDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ--- 370

Query: 335 DDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
                   ELI  H GH   VND   +    W++ S   +N +QVW+ S+SL
Sbjct: 371 --------ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  117 bits (294), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 95/407 (23%), Positives = 187/407 (45%), Gaps = 43/407 (10%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGE- 68
           V + Y  WK N  L+YD+++     WPSL+ Q+ P           KQ +++ + TS + 
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTND----KQRILLSSFTSQQL 75

Query: 69  ---EENYL-KFAEINLPKEVLNNENPQEQAEMGDEASLP----PPRSNIRITAKYEHEEE 120
              E  Y+   + +N  K    N    ++ E   + SL          +RIT     + +
Sbjct: 76  PQDESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYP---DGD 132

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRS---DGLQSTLKFH----------KDNGYALS 167
             R RYMPQ+P+++ T +  G+V+++ R+   + + +  KF           +D   +L+
Sbjct: 133 CNRCRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLA 192

Query: 168 FSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDD---LHSDIVNDSKWHNFNKDLF 224
           ++  ++G L +   +  V +WD++    S   +   +    + ++ VND  W   +  + 
Sbjct: 193 WNYQLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSIL 252

Query: 225 GTVSEDSLLKINDIRAENTTIDT---AKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDL 281
            +  E +++ + DIR ++T +DT          N + F++ +  IL        + ++D+
Sbjct: 253 ASCGESNVIGLIDIR-QDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDI 311

Query: 282 RNMKEPLHHMS-GHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPDDAED 339
           R+ KEP+     G +D ++ ++++P            + L+ +WD      EQ   +AE+
Sbjct: 312 RDFKEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD---ASGEQEDSNAEN 368

Query: 340 GVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
            +  L+ VH GH   VND   +   PW + S   +N + +WK + +L
Sbjct: 369 NM--LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  117 bits (293), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/422 (23%), Positives = 182/422 (43%), Gaps = 61/422 (14%)

Query: 2   EGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII 61
           E    P+ + E Y  WK N  L+YD+++     WPSLT Q+ P           +  +++
Sbjct: 11  EASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSD----EHRILL 66

Query: 62  GTHTSGE--EENYLKFAEINLPKEV----LNNENPQEQAEMGDEASLPPPRSNIRITAKY 115
            + TS +  E+  +  ++I+    +    LNN +  E     + ++  P +  +   + +
Sbjct: 67  SSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIF 126

Query: 116 EHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHK--------------- 160
               E  RARY+PQ+P+++A  +  G ++++ R+    + ++  K               
Sbjct: 127 FPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGV 186

Query: 161 --------------DNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRT-WDD 205
                         +   +L+++   +  LLS   +  V +WD+   S     I      
Sbjct: 187 IQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVS 246

Query: 206 LHSD--IVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDT--AKCPQPFNTLAFSH 261
           ++SD   VND  W   +  LF   +E + + + D+R +   + +   K     N+  F++
Sbjct: 247 INSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNY 306

Query: 262 HSSNILAAAGMDSHVYLYDLRNM-KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
            +S ILA+A  +  + L+D+RNM K P+  M  H  +V+ LE+SP+           + L
Sbjct: 307 KNSLILASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGL 365

Query: 321 I-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQV 379
           + +WD                  E I  H GH   VND   +A  PWL+ S   +N + +
Sbjct: 366 VKLWDT--------------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHI 411

Query: 380 WK 381
           WK
Sbjct: 412 WK 413

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  115 bits (288), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 103/423 (24%), Positives = 187/423 (44%), Gaps = 68/423 (16%)

Query: 4   QEKPLS-----VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQE 58
           +E+P+S     V   Y  WK N  L+YD+++     WPSLT Q+ P           +  
Sbjct: 10  EEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSD----QHR 65

Query: 59  LIIGTHTSGE--EENYLKFAEINLPKEV----LNNENPQEQAEMGD-EASLPPPRSNIRI 111
           L++ + TS +  E+  +  ++I+  K +    LNN +  E     D    LPP      +
Sbjct: 66  LLLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEV 125

Query: 112 TAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGY------- 164
           + ++ + +   R+RY+PQ+P+++A  +  G+V++++++    S L+    + +       
Sbjct: 126 SIRFPNGD-CNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSG 184

Query: 165 --------------ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIR------TWD 204
                         +LS++   +G L          +WDV   S S   I       T+D
Sbjct: 185 SHDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFD 244

Query: 205 DLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR----AENTTIDTAKCPQPFNTLAFS 260
              S+  ND  W   +  +F    E + L + D+R     E  +I   K     NT  F+
Sbjct: 245 ---SNGCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFN 301

Query: 261 HHSSNILAAAGMDSHVYLYDLRNM-KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNR 319
             +S ++A+A     + L+D+R + +EP+  M  H  +++ +E++P+           + 
Sbjct: 302 PGNSLLVASADTCGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDG 360

Query: 320 LI-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQ 378
           L+ +WD   +G E             I VH GH   VND   +   PWL+AS   +N +Q
Sbjct: 361 LVKLWD-ASVGKE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQ 406

Query: 379 VWK 381
           +W+
Sbjct: 407 IWR 409

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  114 bits (284), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 100/408 (24%), Positives = 188/408 (46%), Gaps = 55/408 (13%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTS 66
           P  + + Y  WK N  L+Y++++     WPSLT Q++P           K  +++ + TS
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMP----DMDIASDKHRILLSSFTS 73

Query: 67  GE--EENYLKFAEINLPKEV----LNNENPQE-QAEMGDEASLPPPRSNIRITAKYEHEE 119
            +  E+  +  +EI+  K +    LNN + +E + ++ ++  L     N+  T K +  E
Sbjct: 74  AQLPEDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKL---SKNLTETIKIQFPE 130

Query: 120 -EITRARYMPQDPNMVATINGQGTVFLYSRSDG-------LQSTLKFHKD---------- 161
            +  RARYMPQ+P+++A+ +  G+V+++ R+         L +T K+  +          
Sbjct: 131 GDCNRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNY 190

Query: 162 NGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDS----TTPIRTWDDLHSDIVNDSKWH 217
              +L+++    G L +   D  V +WD++  + +    T P   W  +  +  N+  W 
Sbjct: 191 EASSLAWNYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQ-VDKEGANEVSWM 249

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDTAK--C-PQPFNTLAFSHHSSNILAAAGMDS 274
             +  +     E + L I D R   TT  T +  C     N + F++ +  +L +A  + 
Sbjct: 250 VHHSSILAVCGEGNGLTILDTRTP-TTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEG 308

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQT 333
            + + D+R ++ P+   S H DAV+ ++++P            + L+ +WDL Q   E  
Sbjct: 309 TLNICDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ---EDD 364

Query: 334 PDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           P         L+ +H GH   VND   N   PW++ S   +N + +WK
Sbjct: 365 P---------LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWK 403

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  114 bits (284), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 184/423 (43%), Gaps = 63/423 (14%)

Query: 2   EGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII 61
           E    P ++ E Y  WK N  L+Y++++     WPSLT Q+ P           +  +++
Sbjct: 11  EASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFP----DLDTTLDEHRILL 66

Query: 62  GTHTSGE--EENYLKFAEINLPKEV----LNNENPQEQAEMGDEASLPPPRSNIRITAKY 115
            + TS +  E+  +  ++I+    +    LNN +  E     + ++  PP+  +   + +
Sbjct: 67  SSFTSSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIF 126

Query: 116 EHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHK--------------- 160
               E  RARY+PQ+P+++A  +  G ++++ R+    + ++  K               
Sbjct: 127 FPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGV 186

Query: 161 --------------DNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRT-WDD 205
                         +   +++++   +  LLS   +  V +WD+   S     I      
Sbjct: 187 IQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVS 246

Query: 206 LHSDI--VNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQ---PFNTLAFS 260
           ++SD   VND  W   +  LF   +E + + + D+R +   +  + C       N+  F+
Sbjct: 247 INSDGSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKL-KSNCRSHNGGVNSCKFN 305

Query: 261 HHSSNILAAAGMDSHVYLYDLRNMKE-PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNR 319
           + +S ILA+A  +  + L+D+RNM + PL  M  H  +V+ LE+SP+           + 
Sbjct: 306 YRNSLILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDG 364

Query: 320 LI-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQ 378
           L+ +WD  +               E I  H GH   VND   +A  PWL+ S   +N + 
Sbjct: 365 LVKLWDTSR--------------EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVH 410

Query: 379 VWK 381
           +WK
Sbjct: 411 IWK 413

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  113 bits (283), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 93/422 (22%), Positives = 184/422 (43%), Gaps = 61/422 (14%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTS 66
           P+ + E Y  WK N  L+YD+++     WPSLT Q+ P           +  +++ + TS
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTLDEHRILLSSFTS 71

Query: 67  GE--EENYLKFAEINLPKEV----LNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
            +  E+  +  ++I+    +    LNN +  E     +  +  PP   +   + +    +
Sbjct: 72  SQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGD 131

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDN------------------ 162
             RARY+PQ+P+++A  +  G ++++ R+    + ++  K++                  
Sbjct: 132 CNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVE 191

Query: 163 -----------GYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRT-WDDLHSDI 210
                        +L+++   +  LLS   +  V +WD+   S     I +    + SD 
Sbjct: 192 AMDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDA 251

Query: 211 --VNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQP--FNTLAFSHHSSNI 266
             VND  W   +  LF   +E +++ + D+R +   + + +       N+  F++ +S +
Sbjct: 252 SGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLV 311

Query: 267 LAAAGMDSHVYLYDLRNMKE-PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWD 324
           LA+A  +  + L+D+R M E P+  M  H  +++ LE++P+           + L+ +WD
Sbjct: 312 LASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVKLWD 370

Query: 325 LKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSH 384
             +               E I  H GH   VND   +   PWL+ S   +N + +WK + 
Sbjct: 371 TAR--------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAE 416

Query: 385 SL 386
           +L
Sbjct: 417 NL 418

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  112 bits (281), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 185/413 (44%), Gaps = 56/413 (13%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGE- 68
           + + Y  WK N  L+YD+++     WPSLT Q++P  ++ P     K  L++ + TS + 
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPD-LEVPTD---KHRLLLSSFTSSQL 76

Query: 69  -EENYLKFAEIN----LPKEVLNNENPQE-QAEMGDEASLPPPRSNIRITAKYEHEE-EI 121
            E+  +  +E++    +P   LNN +  E + ++ ++A LP    N+  T + +    + 
Sbjct: 77  PEDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLP--NKNLVETVRIQFPSGDC 134

Query: 122 TRARYMPQDPNMVATINGQGTVFLYSRSD---------GLQSTLKFH---------KDNG 163
            RA YMPQ+P+++  I   G V ++ R+          G  ++ +            D+ 
Sbjct: 135 NRACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSA 194

Query: 164 YALSFSPLIK--GHLLSGSDDHSVALWDVSGGSDSTTPI-----RTWDDLHSDIVNDSKW 216
            ALS +   +  G + S   +  + +WD++    S   I     R   D      ND  W
Sbjct: 195 EALSLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAG--TNDVSW 252

Query: 217 HNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQP--FNTLAFSHHSSNILAAAGMDS 274
              +  +     E + + + D RA +    T   P     N L F++ +  +L AA  + 
Sbjct: 253 MVHHSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNG 312

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQT 333
            + L+D R   +PL  +  H D+V+ L+++P+           + LI +WD       + 
Sbjct: 313 GIALWDCRAFSKPLS-VFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD-----TSRE 366

Query: 334 PDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
           P+D+      L+ VH GH   VND   N   PWL+ S   +N + VWK + +L
Sbjct: 367 PEDS------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  110 bits (275), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 95/416 (22%), Positives = 176/416 (42%), Gaps = 65/416 (15%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGE- 68
           + E Y  WK N  L+YD+++     WPSLT Q+ P           +  +++ + TS + 
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTLNEHRILLSSFTSSQK 74

Query: 69  -EENYLKFAEINLPKEV----LNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITR 123
            E+  +  + I+    +    LNN +  E     +  +  P +  +     +    E  R
Sbjct: 75  PEDETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNR 134

Query: 124 ARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHK----------------------- 160
           ARY+PQ+P+++A  +  G ++++ R+    + ++  K                       
Sbjct: 135 ARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMD 194

Query: 161 ------DNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDST----TPIRTWDDLHSDI 210
                 +   +L+++   +  LLS   +  + +WD+   S        P+ + D   S  
Sbjct: 195 TSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSS- 253

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCP---QPFNTLAFSHHSSNIL 267
           VND  W   +  LF   +E + + + D+R +   +  + C       N+  F++ +S IL
Sbjct: 254 VNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKL-KSNCKIHGGGVNSCKFNYKNSLIL 312

Query: 268 AAAGMDSHVYLYDLRNMKE-PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDL 325
           A+A  +  + L+D+RNM E P+  M  H  +V+ LE+SP+           + L+ +WD 
Sbjct: 313 ASADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDT 371

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
            +               E I  H GH   VND   +   PWL+ S   +N + +WK
Sbjct: 372 TR--------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  110 bits (274), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 97/414 (23%), Positives = 183/414 (44%), Gaps = 63/414 (15%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGE--E 69
           + Y  WK N  L+YD+++     WPSLT ++ P              L++ + TS +  E
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDS----HRLLLSSFTSSQLPE 72

Query: 70  ENYLKFAEINLPKEV----LNNENPQEQAEMGDEASLPPPRS-----NIRITAKYEHEEE 120
           +  +  + I+  K +    LNN +  E     + ++  PPR+     +IRI +      +
Sbjct: 73  DESIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSG-----D 127

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGY---------------- 164
             RARY+PQ+P++++  +  G+++++ R+    +  +      Y                
Sbjct: 128 SNRARYLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSP 187

Query: 165 ----ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDST----TPIRTWDDLHSDIVNDSKW 216
               +L ++   +G L S      + +WD+S    S     TPI + DD      ND  W
Sbjct: 188 NEVVSLDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITW 247

Query: 217 HNFNKDLFGTVSEDSLLKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS 274
              +  L     E + + I D R+++  + I         N+  F+ H+  +LA+A    
Sbjct: 248 MPSHDSLLAACGESNTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIG 307

Query: 275 HVYLYDLRNM-KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQ 332
            V+++D+R + ++P+  +S H  +++ ++++P+           + L+ +WD        
Sbjct: 308 TVHMWDIRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD-------- 358

Query: 333 TPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
               A +G  +LI  H GH   VND   NA  PWL+ S   +N + +W+ S  L
Sbjct: 359 ----ASNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  109 bits (272), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 96/406 (23%), Positives = 173/406 (42%), Gaps = 51/406 (12%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGE--E 69
           + Y LWK N  L+YD+++     WPSL+ Q+ P              L+  + TS +  +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSD----THRLLFTSFTSSQLPQ 65

Query: 70  ENYLKFAEIN----LPKEVLNNENPQEQAEMGDEAS-LPPPRSNIRITAKYEHEEEITRA 124
           +  +  A I+    +P   LNN +  E     D ++ LPP    I++T  + H  +  RA
Sbjct: 66  DENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDCNRA 124

Query: 125 RYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHK----------DNG------YALSF 168
            Y+PQ+P++++T +  G+V+++ R+   +S +   +          +NG       AL +
Sbjct: 125 TYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDW 184

Query: 169 SPLIKGHLLSGSDDHSVALWDVSGGSDS----TTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
           +  I+G L S   +  + +WD+          + P   + D  S   ND  W   +  L 
Sbjct: 185 NRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLL 244

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKC---PQPFNTLAFSHHSSNILAAAGMDSHVYLYDL 281
               ED+++ + D R       T          N   F+     ++A A  D  V L+D+
Sbjct: 245 SIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDI 304

Query: 282 RNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPDDAEDG 340
           R +  P+  ++  E  ++ LE++P            + L+ +W            +A +G
Sbjct: 305 RKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLW------------NASNG 351

Query: 341 VPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
             +L+  H GH   VND   +    WL+ S   +N   +WK +  L
Sbjct: 352 --QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  109 bits (272), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 102/421 (24%), Positives = 187/421 (44%), Gaps = 65/421 (15%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTS 66
           P    + Y  WK N  L+Y++++     WPSLT Q  P           +  +++ + TS
Sbjct: 18  PEDRQQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFP----DLDLAGDEHRILLSSFTS 73

Query: 67  GE--EENYLKFAEIN----LPKEVLNNENPQE-QAEMGDEASLPPPRSNIRITAKYEHEE 119
            +  E+  +  A ++    +P   LNN +  E + +M +   LPP      +  K+    
Sbjct: 74  SQLPEDEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFP-AG 132

Query: 120 EITRARYMPQDPNMVATINGQGTVFLYSRSD--------------------GLQSTLKFH 159
           +  +ARY P +P+++++ +  G+V+++ R+                      L ++L+  
Sbjct: 133 DCNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEER 192

Query: 160 KDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF 219
           ++    L+++   +G L +      V +WD++   D  +P  T  D HS ++ D +  N 
Sbjct: 193 QNEALNLAWNWQQQGLLATCYSGGEVCVWDLAK-YDKASP--TLIDPHSSLLADPQGSN- 248

Query: 220 NKDLFGTVSEDSLLKI----NDIRAENTTIDTAKCPQPF---------NTLAFSHHSSNI 266
             D+   V+ DSLL      N +   +T I T + PQ F         N   F+++   +
Sbjct: 249 --DISWMVNHDSLLAYCGEGNALGVLDTRI-TKQPPQSFSNPHHSNGVNACQFNYYKDLL 305

Query: 267 LAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDL 325
           L +A     + L+D+R+   P+  +  H  +V+ L+++PH           + L+ +WDL
Sbjct: 306 LCSADSAGRINLWDIRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDL 364

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHS 385
            Q      P D E     L   H GH   VND   +   PW++ S   +N +Q+WK S +
Sbjct: 365 SQ------PVDQE-----LKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQN 413

Query: 386 L 386
           L
Sbjct: 414 L 414

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  108 bits (271), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 96/422 (22%), Positives = 186/422 (44%), Gaps = 56/422 (13%)

Query: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60
           +E    P  + E Y  WK N  L+Y +++     WPSLT Q+ P              ++
Sbjct: 7   IEPSSIPDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTD----THRIL 62

Query: 61  IGTHTSGE--EENYLKFAEINLPKEV----LNNENPQEQAEMGDEASLPPPRS-NIRITA 113
           + T TS +  E+  L  A ++    +    LNN +  E     D ++  P ++ N+ I+ 
Sbjct: 63  LSTFTSSQLPEDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISI 122

Query: 114 KYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSD---------------GLQSTLKF 158
            + + +   RARY+PQ+P+++A  +  G++++++R+                 L ST K 
Sbjct: 123 PFPNGD-CNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKM 181

Query: 159 -----HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWD---DLHSDI 210
                + +   +++++    G L S     S+ +WD++  S S   +R  +       + 
Sbjct: 182 DENFTNSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEG 241

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDIRAE----NTTIDTAKCPQPFNTLAFSHHSSNI 266
            N+  W   +  +F   SE + L + D+R +      T +        N+  F++++  +
Sbjct: 242 CNEVTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDML 301

Query: 267 LAAAGMDSHVYLYDLRNM-KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWD 324
           LA+A     + ++D+R + KEP+     H  +++ LE++P+           + L+ +WD
Sbjct: 302 LASADSTGKINMWDIRKLDKEPIKSF-NHNSSISTLEWNPNLETILVTAGQDDGLVKIWD 360

Query: 325 LKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSH 384
                             + I VH GH   VND   +   PWL++S   +N + VWK + 
Sbjct: 361 TAN--------------GQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPAT 406

Query: 385 SL 386
           +L
Sbjct: 407 NL 408

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  108 bits (269), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 180/419 (42%), Gaps = 72/419 (17%)

Query: 13  EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGE--EE 70
            Y  WK N  L+YD+++     WPSLT Q+ P              +++ ++TS +  E+
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFP----DVDANTDTHRILLSSYTSCQLPED 73

Query: 71  NYLKFAEIN----LPKEVLNNENPQEQAEMGDEASLPPPR---SNIRITAKYEHEEEITR 123
             +  A I+    L    LNN +  E     D  +  PP+   +N+ IT       +  R
Sbjct: 74  ENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFP---RGDCNR 130

Query: 124 ARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHK----------------------- 160
           ARYMPQ+P+++A  +  G V++++R+      ++ H                        
Sbjct: 131 ARYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEA 190

Query: 161 -----DN-GYALSFSPLIKGHLLSGSDDHSVALWDVSG-GSDSTTPIRT-WD--DLHSDI 210
                DN   +L+++   +G L       +V +WD+     D+TT   T W+  +  S  
Sbjct: 191 RRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRG 250

Query: 211 VNDSKWHNFNKDLFGTVSEDS-LLKINDIRAENTTIDTAKCPQPF-----NTLAFSHHSS 264
           VND  W + +  +     E S  L + D RA+N     AK    F     N   F+  ++
Sbjct: 251 VNDVSWMSQHDSILAACGERSDSLALFDTRAQNAV---AKIRNQFKSEGINACKFNWENN 307

Query: 265 NILAAAGMDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-M 322
            +LA+        L+D+R +  EP+ H   H  +V+ LE++PH           + LI +
Sbjct: 308 LLLASTDSTGRTNLWDVRKLSAEPIVHFD-HGGSVSTLEWNPHDHSVLATAGQSDGLIKI 366

Query: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           WD        T  + ED   + I VH+GH   VND   +   PWL+ S   +N + VWK
Sbjct: 367 WD--------TSLEIED---KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWK 414

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 96/418 (22%), Positives = 184/418 (44%), Gaps = 57/418 (13%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTS 66
           P  + + Y  WK N  L+YD+++     WPSLT Q+ P              ++I + TS
Sbjct: 14  PNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSD----THRILISSFTS 69

Query: 67  GE--EENYLKFAEINLPKEV----LNNENPQEQAEMGDEASLPPPRSNI--RITAKYEHE 118
            +  E+  +  ++I+  K +    +NN +  ++ E   + +L  P  ++   +T K+ + 
Sbjct: 70  SQLPEDEAIHISKISTLKHLNWASVNNFD-MDEMEFKPDTNLKLPSKHLVNDLTIKFPNG 128

Query: 119 EEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKD----------------- 161
           +   RARY+PQ+P+++A  +  G+V+++ R+    S ++  K+                 
Sbjct: 129 D-CNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVEE 187

Query: 162 ------NGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI----V 211
                    +L+++   +G L S      V +WD+     S  P+     L+       V
Sbjct: 188 LHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSN-PVLDKPVLNIQFDALGV 246

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDIR--AENTTIDTAKCPQPFNTLAFSHHSSNILAA 269
           ND  W   +  LF    E   L + D R   E + I   +     N+  F++ ++ +LA+
Sbjct: 247 NDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLAS 306

Query: 270 AGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQI 328
           A  +  V ++D+RN+ +       H  +++ +E++P+           + L+ +WD+   
Sbjct: 307 ADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDVSNT 366

Query: 329 GAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
             E            L+ VH GH   VND   +    WL+ S   +N +Q+WK +H+L
Sbjct: 367 DNE------------LLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 92/418 (22%), Positives = 182/418 (43%), Gaps = 60/418 (14%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTS 66
           P  + + Y  WK N  L+YD+++     WPSLT Q+                +++   TS
Sbjct: 15  PEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFF----HDLDTTSDTHRILLSAFTS 70

Query: 67  GE--EENYLKFAEINLPKEV----LNNENPQEQAEMGDEASLPPPRSNIR--ITAKYEHE 118
            +  E+  +  A+++  K +    +NN +  ++ E   E ++  P  N+   I+ ++  +
Sbjct: 71  SQLPEDEAIYIAKLSTLKHLEWASINNFD-MDEMEFKPENNIKLPSKNLTNDISIRFP-D 128

Query: 119 EEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKD----------------- 161
            +   ARY+PQ+P+++A  +  G+++++ R+      ++  K+                 
Sbjct: 129 GDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGIEN 188

Query: 162 -----NGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDST----TPIRTWDDLHSDIVN 212
                   ++S++   +G L S      + LWD+   S+S     TP+    D  +  VN
Sbjct: 189 VENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLN-VDFDALGVN 247

Query: 213 DSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQ--PFNTLAFSHHSSNILAAA 270
           D  WH  +  +     E +++ + D R     + + +       N+  F+ H  ++L + 
Sbjct: 248 DVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISG 307

Query: 271 GMDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQI 328
             +  + L+DLR +  EP+  +  H  +++ LE++P+           + L+ +WD+   
Sbjct: 308 DSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLWDV--- 363

Query: 329 GAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386
                         EL+  H GH   VND   N    WL+ S   +N +QVWK +H+L
Sbjct: 364 -----------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNL 410

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 95/399 (23%), Positives = 169/399 (42%), Gaps = 45/399 (11%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +   +  + +  L+   T +S ++EN L   A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 80  LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATING 139
           L K +L ++N ++  E  DE  + P   N  I  +            +     + AT++ 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 233

Query: 140 QGTVFLY---SRSDGLQS--------------TLKFHKD-NGYALSFSPLIK-GHLLSGS 180
            G V++Y   ++S    +              T+K H +  GY L +SPLIK G LLSG 
Sbjct: 234 NGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 293

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
               + L      S   T  +++   +++ + D +W      +F T + D  ++I D R+
Sbjct: 294 CSGQIYLTQ-RHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTRS 352

Query: 241 EN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK-------EPLHHM 291
           +     I         N +++S     +LA+   +    ++DLR          +P+   
Sbjct: 353 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQY 412

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAEDGVP 342
             H+ A+T++ F+P            N + +WDL         KQ  AE    + +D  P
Sbjct: 413 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETK--ELQDIPP 470

Query: 343 ELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           +L+ VH   +  V D   + Q+P  + ST  +  L VWK
Sbjct: 471 QLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWK 506

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 96/399 (24%), Positives = 165/399 (41%), Gaps = 45/399 (11%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +   +  + +  L+   T +S ++EN L   A  N
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 80  LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATING 139
           L K +L ++N  E  E  DE  + P   N  I  +            +     + AT++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 140 QGTVFLYS--------RSDGLQ---------STLKFHKD-NGYALSFSPLIK-GHLLSGS 180
            G V++Y+         + G Q          T+K H +  GY L +SPLIK G LLSG 
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSG- 293

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240
           D      +     S   T  + +   ++  + D +W      +F T   D  ++I D R+
Sbjct: 294 DCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRS 353

Query: 241 EN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK-------EPLHHM 291
           +     I         N +++S     +LA+   +    ++DLR          +P+   
Sbjct: 354 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQY 413

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAEDGVP 342
             H+ A+T++ F+P            N + +WDL         KQ  AE    + ++  P
Sbjct: 414 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETK--ELQEIPP 471

Query: 343 ELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           +L+ VH   +  V D   + Q+P  + ST  +  L VWK
Sbjct: 472 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 507

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 92/406 (22%), Positives = 165/406 (40%), Gaps = 58/406 (14%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +YD +    + WP LT+  +P  +   +  + +  L+   T  S ++EN L    ++ 
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 80  LPKEVLNNENPQEQAEMGDEASLPPP---RSNIRITAKYEHEEEITRARYMP----QDPN 132
           L K ++ +++     E  ++     P     NI +       +   R R  P        
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISL------RDTTNRLRVSPFAQSNKEV 232

Query: 133 MVATINGQGTVFLYS--------RSDGLQS---------TLKFHKD-NGYALSFSPLIK- 173
           + AT++  G V+++          S G Q          T+K H +  GYAL +SPLIK 
Sbjct: 233 LTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKT 292

Query: 174 GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           G LL+G     + L      S   T  + +   ++  V D +W      +F +   D  +
Sbjct: 293 GALLTGDCSGQIYL-TQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFASCGCDGYV 351

Query: 234 KINDIRAE--NTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLR-------NM 284
           +I D R++     +         N ++++     +LA+   +    ++DLR       N 
Sbjct: 352 RIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNINN 411

Query: 285 KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPD 335
            +P+     H+ A+T++ F+P            N + +WDL         KQ  AE    
Sbjct: 412 VQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK-- 469

Query: 336 DAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           + E   P+L+ VH   +  V D   + Q+P  + ST  +  L +WK
Sbjct: 470 ELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 84/395 (21%), Positives = 162/395 (41%), Gaps = 39/395 (9%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEI-N 79
           P +Y+ +    + WP L++  +P  +   +  + +  L+   T  S ++EN L    + N
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 80  LPKEVLNNENPQEQAEM---------GDEASLPPPRSNIRITAKYEHEEEITRARYMPQD 130
           L K +L +E  +E+ E           +  +L    + I+++      +E+  A      
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSENG 238

Query: 131 PNMVATINGQGTVF------LYSRSDGLQSTLKFHKD-NGYALSFSPLIK-GHLLSGSDD 182
              +  I  Q   F      +  +S     T++ H +  GY L +SPLIK G LLSG   
Sbjct: 239 EVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDCS 298

Query: 183 HSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN 242
             + L      S   T  + +   ++  + D +W      +F T   D  +++ D R++ 
Sbjct: 299 GQIYL-TQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKK 357

Query: 243 --TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK-------EPLHHMSG 293
               I         N ++++     +LA+   +    ++DLR          +P+   + 
Sbjct: 358 HKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNF 417

Query: 294 HEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG-----AEQTPDDAE--DGVPELIM 346
           H+ A+T++ F+P            N + +WDL          +QT +  E  +  P+L+ 
Sbjct: 418 HKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLF 477

Query: 347 VHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           VH   +  + D   + Q+P  + ST  +  L +WK
Sbjct: 478 VH--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 89/401 (22%), Positives = 168/401 (41%), Gaps = 49/401 (12%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI-IGTHTSGEEEN---YLKFAE 77
           P +Y+ +    + WP LT+  +P  +   +  + +  L+   T  S ++EN    LK ++
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 78  INLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATI 137
           +N  K ++ ++  +E+ +  DE +   P       +  +    +  + +      + AT+
Sbjct: 178 LN--KTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATM 235

Query: 138 NGQGTVFLYS--------RSDGLQ---------STLKFHKD-NGYALSFSPLIK-GHLLS 178
           +  G V+++          + G Q          T++ H +  GY L +SPLIK G LL+
Sbjct: 236 SENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLT 295

Query: 179 GSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDI 238
           G     V L      S   T  + +   ++  + D +W      +F T   D  ++I D 
Sbjct: 296 GDCSGQVYL-TQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIRIWDT 354

Query: 239 RAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK-------EPLH 289
           R++     I T       N ++++     +LA+   D    ++DLR +        +P+ 
Sbjct: 355 RSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQPVA 414

Query: 290 HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAEDG 340
               H+ A+T++ F+P            N + +WDL         KQ  AE    + +  
Sbjct: 415 QYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK--ELQQI 472

Query: 341 VPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
            P+L+ VH   +  V D   + Q+P  + ST  +  L VWK
Sbjct: 473 PPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 510

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 168/407 (41%), Gaps = 59/407 (14%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    + WP +T+  +P  +   +  + +  L+   T  S +++N L   +++ 
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 80  LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPN------M 133
           L K +   +N +++ E  D+ ++ P   N  I  +    +   R +  P   +      +
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLR----DTTNRLKVSPFASSSNSQEIL 237

Query: 134 VATINGQGTVFLYSRSDGLQS-----------------TLKFHKD-NGYALSFSPLIK-G 174
            AT++  G V+++  +  +++                 T+K H +  GYAL +SPLIK G
Sbjct: 238 TATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTG 297

Query: 175 HLLSGSDDHSVALWD--VSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
            LL+G     V L     S       P       ++  V D +W      +F +   D  
Sbjct: 298 ALLTGDCSGQVYLTQRHTSKWISDKEPFTV---ANNQSVEDIQWSRTESTVFASCGCDGY 354

Query: 233 LKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLR-------N 283
           +++ D R++     I         N +++S     +LA+   +    ++DLR       N
Sbjct: 355 IRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPSNSN 414

Query: 284 MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTP 334
              P+     H+ A+T++ F+P            N + +WDL         KQ  AE   
Sbjct: 415 NTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAET-- 472

Query: 335 DDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
            + +   P+L+ VH   +  V D   + Q+P  + ST  +  L +WK
Sbjct: 473 KELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWK 516

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 171/424 (40%), Gaps = 67/424 (15%)

Query: 6   KPLSVDE--EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGT 63
           KPL  DE  E D      P +Y+ +    + WP +T+  +P  +   +  +  Q L++ T
Sbjct: 115 KPLGPDEVLEAD------PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNY-PQSLLMAT 167

Query: 64  HTSGEEEN-----YLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHE 118
            T   ++N      LK ++  L K ++  +  + + E  DE    P   N  I+ K    
Sbjct: 168 ATQASKKNQNELMVLKMSQ--LAKTLVKEDEDENEGEDEDEDGTDPVIENENISLK---- 221

Query: 119 EEITRARYMP----QDPNMVATINGQGTVFLYSRSDGLQS-----------------TLK 157
           +   R +  P        + +T++  G V+++  +  +++                 T++
Sbjct: 222 DTTNRLKVSPFANAAQEVLCSTMSENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVR 281

Query: 158 FHKD-NGYALSFSPLIK-GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSK 215
            H    GYA  +SP+IK G +LSG     V L      S   T  + +   ++  + D +
Sbjct: 282 NHGSVEGYANDWSPIIKTGAMLSGDCSGQVFL-TQRHTSKWITDKQAFTVANNKSIEDLQ 340

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMD 273
           W      +F +   D  ++I D R++     I         N +++S     +LA+   D
Sbjct: 341 WSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDD 400

Query: 274 SHVYLYDLRNM-------KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL- 325
               ++DLR           P+     H+ A+T++ F+P            N + +WDL 
Sbjct: 401 GTWGVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLS 460

Query: 326 --------KQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENIL 377
                   KQ  AE    + +   P+L+ VH   +  V D   + Q+P  + ST  +  L
Sbjct: 461 VEADDEEIKQQAAE--TKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-L 515

Query: 378 QVWK 381
            VWK
Sbjct: 516 NVWK 519

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 92/409 (22%), Positives = 166/409 (40%), Gaps = 66/409 (16%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI-IGTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +   +  + +  L+   T +S + EN L   A  N
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 80  LPKEVLNNENPQEQAEM----------GDEASLPPPRSNIRITAKYEHEEEITRARYMPQ 129
           L K +L ++N ++  E            +   L    + ++++      +E+        
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEV-------- 225

Query: 130 DPNMVATINGQGTVFLYS--------RSDGLQ---------STLKFHKD-NGYALSFSPL 171
              + AT++  G V++Y          + G Q          T+K H +  GY L +SPL
Sbjct: 226 ---LTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPL 282

Query: 172 IK-GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSED 230
           IK G LLSG D      +     S   T  + +   ++  + D +W      +F T   D
Sbjct: 283 IKTGALLSG-DCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCD 341

Query: 231 SLLKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK--- 285
             ++I D R++     I         N +++S     +LA+   +    ++DLR      
Sbjct: 342 GYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSN 401

Query: 286 ----EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQ 332
               +P+     H+ A+T++ F+P            N + +WDL         KQ  AE 
Sbjct: 402 ADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAET 461

Query: 333 TPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
              + ++  P+L+ VH   +  V D   + Q+P  + ST  +  L VWK
Sbjct: 462 --KELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 93/413 (22%), Positives = 167/413 (40%), Gaps = 72/413 (17%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    L WP LT+  +P  +   +  + +  L+   T  S +++N L   +++ 
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 80  LPKEVLNNENPQEQAE-----------MGDEASLP--PPRSNIRITAKYEHEEEITRARY 126
           L K ++ +++  +  +           + +  SLP     + +RI+     ++EI     
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEI----- 233

Query: 127 MPQDPNMVATINGQGTVFLYS--------RSDGLQ---------STLKFHKD-NGYALSF 168
                 + +T++  G VF+Y          + G Q          T++ H +  GY L +
Sbjct: 234 ------LTSTMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDW 287

Query: 169 SPLIK-GHLLSGSDDHSVALWD--VSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFG 225
           SPLIK G LL+G     V L     S      TP    ++     + D +W      +F 
Sbjct: 288 SPLIKTGALLTGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKS---IEDIQWSRTESTVFA 344

Query: 226 TVSEDSLLKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
           T   D  ++I D R++     I T       N ++++     +LA+        ++DLR 
Sbjct: 345 TAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQ 404

Query: 284 MKE------PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQI 328
                    P+     H+ A+T++ F+P            N + +WDL         KQ 
Sbjct: 405 FSPNSEKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQ 464

Query: 329 GAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
            AE    + E   P+L+ VH   +  V D   + Q+P  + ST  +  L VWK
Sbjct: 465 KAE--IKELEQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 94/409 (22%), Positives = 167/409 (40%), Gaps = 66/409 (16%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +   +  + +  L+   T +S ++EN L   A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 80  LPKEVLNNENPQEQAEM----------GDEASLPPPRSNIRITAKYEHEEEITRARYMPQ 129
           L K +L +EN +E  E            +   L    + ++++      +E+        
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQEV-------- 225

Query: 130 DPNMVATINGQGTVFLYS--------RSDGLQ---------STLKFHKD-NGYALSFSPL 171
              + AT++  G V++Y          + G Q          T+K H +  GY L +SPL
Sbjct: 226 ---LTATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPL 282

Query: 172 IK-GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSED 230
           IK G LLSG D      +     S   T  + +   ++  + D +W      +F T   D
Sbjct: 283 IKTGSLLSG-DCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSESTVFATAGCD 341

Query: 231 SLLKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK--- 285
             ++I D R++     I         N +++S     +LA+   +    ++DLR      
Sbjct: 342 GYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSN 401

Query: 286 ----EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQ 332
               +P+     H+ A+T++ F+P            N + +WDL         KQ  AE 
Sbjct: 402 ADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAET 461

Query: 333 TPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
              + ++  P+L+ VH   +  V D   + Q+P  + ST  +  L VWK
Sbjct: 462 K--ELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 106/248 (42%), Gaps = 25/248 (10%)

Query: 153 QSTLKFHKD-NGYALSFSPLIK-GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI 210
           Q T+K H +  GY L +SPLIK G LL+G     V L   +  S   T  + +   ++  
Sbjct: 276 QYTIKNHGNVEGYGLDWSPLIKTGALLTGDCSGRVFLTQRTS-SKWITDKQPFTVDNNKS 334

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDIRAE--NTTIDTAKCPQPFNTLAFSHHSSNILA 268
           + D KW      +F T   D  ++I DIR++     +         N ++++   S +LA
Sbjct: 335 IEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLA 394

Query: 269 AAGMDSHVYLYDLRNMK------EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIM 322
               +    ++DLR          P+     H+ A+T++ F+P            N + +
Sbjct: 395 TGDDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTL 454

Query: 323 WDL---------KQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEE 373
           WDL         KQ  AE    + +   P+L+ VH   +  V D   + Q+P  + ST  
Sbjct: 455 WDLSVEADDEEIKQQAAEVK--ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGT 510

Query: 374 ENILQVWK 381
           +  L VWK
Sbjct: 511 DG-LNVWK 517

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 86/399 (21%), Positives = 167/399 (41%), Gaps = 46/399 (11%)

Query: 24  MYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEINLPK 82
           +Y+ +    L+WP +++  +P  +   +  + +  L+   T  S +++N L   +++   
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 83  EVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPN-----MVATI 137
           + L  E+  +  +  DE         I   A     +   R +  P   N     + AT+
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILTATM 248

Query: 138 NGQGTVFLYSRSDGLQS-----------------TLKFHKD-NGYALSFSPLIK-GHLLS 178
           +  G V+++   + ++S                 T++ H +  G+ L +SPLIK G LL+
Sbjct: 249 SENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSGALLT 308

Query: 179 GSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDI 238
           G     + L      S   T  +++   ++  + D +W    + +F T   D  ++I D 
Sbjct: 309 GDCSGEIFL-TSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDT 367

Query: 239 RAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVY-LYDLRNMK------EPLH 289
           R++     I T       N ++++     +LA+ G D  V+ ++DLR          P+ 
Sbjct: 368 RSKKHKPAISTRASNVDVNVISWNEKMEYLLAS-GDDKGVWGVWDLRQFSPSQENASPVA 426

Query: 290 HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG-----AEQTPD--DAEDGVP 342
               H+ A+T++ F+P            N + +WDL          +QT +  + E   P
Sbjct: 427 QYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKELEQIPP 486

Query: 343 ELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           +L+ VH   +  V D   + Q+P  + ST  +  L VWK
Sbjct: 487 QLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 522

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 86/400 (21%), Positives = 165/400 (41%), Gaps = 48/400 (12%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    L WP +T+  +P      +  + +  L+   T  + +++N L   +++ 
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 80  LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPN----MVA 135
           L K ++     +E+ E   +    P   +  +  K    +   R R  P   +    + A
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPILEDENVPLK----DTTNRLRVSPFASSGQEVLTA 235

Query: 136 TINGQGTVFLY-----SR---SDGLQ---------STLKFHKD-NGYALSFSPLIK-GHL 176
           T++  G V+++     SR   + G Q          T++ H +  GYAL +SPLI+ G L
Sbjct: 236 TMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGAL 295

Query: 177 LSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236
           L+G D      +     S   T  + +   ++  + D +W      +F T   D  +++ 
Sbjct: 296 LTG-DCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVW 354

Query: 237 DIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK------EPL 288
           D R++     I T       N ++++     +LA+   +    ++DLR         +P+
Sbjct: 355 DTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPV 414

Query: 289 HHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG-----AEQTPDDAEDGV-- 341
                H+ A+T++ F P            N + +WDL          +QT +  E     
Sbjct: 415 AQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKELAQIP 474

Query: 342 PELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           P+L+ VH   +  V D   + Q+P  + ST  +  L +WK
Sbjct: 475 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 511

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 25/208 (12%)

Query: 156 LKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSK 215
            ++ ++N + L   PL +  L++   D SV L D  G   + + I+     H+  +ND K
Sbjct: 8   CRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDW-GNLKTISSIQC----HTTSINDMK 62

Query: 216 WHNFNKD---LFGTVSEDSLLKINDIRAENTTIDTAK-CPQPFNTLAFSHHSSNILAAA- 270
             N + D   +F T +ED + K+ DIRA N           PF +L   H   N+LA   
Sbjct: 63  VINSDFDTGAVFATAAEDGV-KVWDIRARNNVASLQNDKASPFFSLDSRH---NMLACGT 118

Query: 271 ---GMDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
                D+ +++YD+RN  +P+   +  H D +T+++F P              + ++DL 
Sbjct: 119 ELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLT 178

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHRSA 354
           Q       DD ED + ++I   + H   
Sbjct: 179 Q-------DDEEDALHQVINFASIHSCG 199

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/400 (20%), Positives = 166/400 (41%), Gaps = 47/400 (11%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    L WP L++  +P  +   +  + +  L+   T  S +++N L   +++ 
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 80  LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDP-NMVATIN 138
           L K ++  +   ++ +  ++    P   N  I  + +    +  + +  + P  + A+++
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLR-DTTNRLKVSPFASESPEKLTASMS 245

Query: 139 GQGTVFLYS---RSDGLQS--------------TLKFHKD-NGYALSFSPLIK-GHLLSG 179
             G V+++    +  G ++              T+K H +  GYAL +SPL K G LL+G
Sbjct: 246 ENGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTG 305

Query: 180 SDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239
                V L      S   T    +   ++  + D ++      +F T   D  ++I D R
Sbjct: 306 DCSGRVYLTQ-RHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTR 364

Query: 240 AEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK-------EPLHH 290
           ++     I         N ++++     +LA+   +    ++DLR           P+  
Sbjct: 365 SKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQ 424

Query: 291 MSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAEDGV 341
            S H+ A+T++ F+P            N + +WDL         KQ  AE    + +   
Sbjct: 425 YSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK--ELQQIP 482

Query: 342 PELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           P+L+ VH   +  V D   + Q+P  + ST  +  L +WK
Sbjct: 483 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 519

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 90/403 (22%), Positives = 169/403 (41%), Gaps = 52/403 (12%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    L WP +T+  +P  +   +  + +  L+   T  S ++EN L    ++ 
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 80  LPKEVLNNENPQEQAEMGDEASLPPP---RSNIRITAKYEHEEEITRARYMPQDPN-MVA 135
           L K ++ +E  +++ E  DE     P     NI++    +    +  + +   D   + A
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLN---DTTNRLKVSPFASTDKEVLTA 236

Query: 136 TINGQGTVFLYS--------RSDGLQ---------STLKFHKD-NGYALSFSPLIK-GHL 176
           T++  G V+++          + G Q          T++ H +  GYAL +SP+IK G L
Sbjct: 237 TMSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGAL 296

Query: 177 LSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236
           L+G D      +     S   T  + +   ++  V D +W      +F +   D  ++I 
Sbjct: 297 LTG-DCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIW 355

Query: 237 DIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLR-------NMKEP 287
           D R++     +         N +++S     +LA+   +    ++DLR       N  +P
Sbjct: 356 DTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQP 415

Query: 288 LHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAE 338
           +     H+ A+T++ F+P            N + +WDL         KQ  AE    + E
Sbjct: 416 VAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETK--ELE 473

Query: 339 DGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
              P+L+ VH   +  V D   + Q+P  + ST  +  L +WK
Sbjct: 474 KIPPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWK 513

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 83/400 (20%), Positives = 169/400 (42%), Gaps = 47/400 (11%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    L WP L++  +P  +   +  + +  L+   T  S +++N L   +++ 
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 80  LPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDP-NMVATIN 138
           L K ++ ++N +E+ +  ++    P   N  I  K +    +  + +  + P  + AT++
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLK-DTTNRLKVSPFASESPEKLTATMS 244

Query: 139 GQGTVFLYSRSDGLQS-----------------TLKFHKD-NGYALSFSPLIK-GHLLSG 179
             G V+++     +++                 T++ H +  GYAL +SPL K G LL+G
Sbjct: 245 ENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTG 304

Query: 180 SDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239
                V L      S   T    +   ++  + D ++      +F +   D  ++I D R
Sbjct: 305 DCSGRVYLTQ-RHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTR 363

Query: 240 AEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK-------EPLHH 290
           ++     I         N ++++     +LA+   +    ++DLR           P+  
Sbjct: 364 SKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTSPVAQ 423

Query: 291 MSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAEDGV 341
            + H+ A+T++ F+P            N + +WDL         KQ  AE    + ++  
Sbjct: 424 YNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETR--ELQEIP 481

Query: 342 PELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
           P+L+ VH   +  V D   + Q+P  + ST  +  L +WK
Sbjct: 482 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 518

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 77/156 (49%), Gaps = 15/156 (9%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +L+ +   +  L S S DH+V LWD+    ++ T  R+  ++HS+  V+ S+WH
Sbjct: 287 HTDAILSLAHNKQFRAVLASTSADHTVKLWDL----NTATAARSLINIHSNTNVSASQWH 342

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDTAK-----CPQPFNTLAFSHHSSNILAAAGM 272
             N  +  T   DS   ++D+R EN   D +K       +    + F+    NI      
Sbjct: 343 PSNGSVLLTAGYDSRAALSDVRIENDN-DMSKYWNVSSGEEIECVRFA--DENIFICGTD 399

Query: 273 DSHVYLYDLRNMKE--PLHHMSGHEDAVTNLEFSPH 306
           + +VY +D+RN  E  P+  +  H+  V+++E + H
Sbjct: 400 NGNVYSFDIRNGAESKPVWTLKAHDAGVSSVEINRH 435

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 87/414 (21%), Positives = 169/414 (40%), Gaps = 72/414 (17%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHT--SGEEENYLKFAEI- 78
           P +Y+ +    + WP +T+  +P  +   +  +  Q L++ T T  S ++EN L    + 
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNY-PQSLLMATATQASRKKENELMVLSLS 170

Query: 79  NLPKEVLNNENPQEQAEM--------------GDEASLPPPRSNIRITAKYEHEEEITRA 124
           NL K ++ ++  +E+ ++               +   L    + ++I+     +EE+   
Sbjct: 171 NLVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEV--- 227

Query: 125 RYMPQDPNMVATINGQGTVFLYS---RSDGLQS--------------TLKFHKD-NGYAL 166
                   + AT++  G V+++    +S    +              T+K H +  GYAL
Sbjct: 228 --------LAATMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYAL 279

Query: 167 SFSPLIK-GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFG 225
            +SPL K G LL+G D      +     S   T  + +   ++  + D +W      +F 
Sbjct: 280 DWSPLTKTGALLTG-DCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFA 338

Query: 226 TVSEDSLLKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
           +   D  ++I D R++     I         N +++S     +LA+   +    ++DLR 
Sbjct: 339 SAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQ 398

Query: 284 MK-------EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQ 327
                    +P+     H+ A+T++ F+P            N + +WDL         KQ
Sbjct: 399 FSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQ 458

Query: 328 IGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
             AE    + +   P+L+ VH   +  V D   + Q+P  + ST  +  L +WK
Sbjct: 459 QAAETK--ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 507

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 169/408 (41%), Gaps = 58/408 (14%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEI-N 79
           P +Y+ +    + WP LT+  +P  +   +  + +  L+   T  S ++EN L    + N
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 80  LPKEVLNNENPQEQAEMGDEASLP---PPRSNIRITAKYEHEEEITRARYMP----QDPN 132
           L K ++N +   ++ E  ++       P   N  I  +    +   R +  P        
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLR----DTTNRLKVSPFANSSKEV 228

Query: 133 MVATINGQGTVFLYS---RSDGLQS--------------TLKFHKD-NGYALSFSPLIK- 173
           + AT++  G V+++    +S    +              T+K H +  GYAL +SP I+ 
Sbjct: 229 LTATMSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQT 288

Query: 174 GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           G LL+G D      +     S   T  + +   ++  + D +W      +F +   D  +
Sbjct: 289 GALLTG-DCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYI 347

Query: 234 KINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVY-LYDLR-------N 283
           +I D R++     I         N +++S     +LA+ G D+ V+ ++DLR       N
Sbjct: 348 RIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLAS-GDDNGVWGVWDLRQFSPDTAN 406

Query: 284 MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTP 334
             +P+     H+ A+T++ F+P            N + +WDL         KQ  AE   
Sbjct: 407 SVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETK- 465

Query: 335 DDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKC 382
            + +   P+L+ VH   +  V D   + Q+P  + ST  +  L +WK 
Sbjct: 466 -ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDG-LNIWKT 509

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/418 (22%), Positives = 176/418 (42%), Gaps = 54/418 (12%)

Query: 6   KPLSVDE--EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-G 62
           KPL  DE  E D      P +Y+ +    L W  +T+  +P  +   +  + +  L+   
Sbjct: 113 KPLGPDEVLEAD------PTVYEMLHNVNLPWSCMTLDIIPDLLGSERRNYPQSILMTTA 166

Query: 63  THTSGEEENYLKFAEINLPKEVL--NNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120
           T  S +++N L   +++   + L    E+  ++ E  ++  L P   N  I+ K +    
Sbjct: 167 TQASKKKDNELLVLKMSQLTKTLVKEEEDENDEEEDNEDNDLDPIIENESISLK-DTTNR 225

Query: 121 ITRARYMPQDPN-MVATINGQGTVFLYS--------RSDGLQ---------STLKFHKD- 161
           I  + +  + P  + AT++  G  ++Y          S G Q          +++ H + 
Sbjct: 226 IKISPFAAESPEVLAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNV 285

Query: 162 NGYALSFSPLIK-GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFN 220
            GY L +SPLIK G +L+G     V L   +  S   T  + +   ++  + D +W    
Sbjct: 286 EGYGLDWSPLIKTGSILTGDCSGRVYLTQRTA-SRWVTDKQPFTVGNNKSIEDIQWSRAE 344

Query: 221 KDLFGTVSEDSLLKINDIRAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVY- 277
             +F T   D  ++I D R++     +         N ++++     +LA+ G DS  + 
Sbjct: 345 MTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLAS-GDDSGTWG 403

Query: 278 LYDLRNMKE-------PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG- 329
           ++DLR           P+   + H+ A+T++ F+P            N + +WDL     
Sbjct: 404 VWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEAD 463

Query: 330 ----AEQTPDDAE--DGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
                +QT + AE     P+L+ VH   +  V D   + Q+P  + ST  +  L +WK
Sbjct: 464 DEEIKQQTAETAELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWK 518

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 77/158 (48%), Gaps = 9/158 (5%)

Query: 153 QSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHS-DIV 211
           Q     H D   +L+ +   +  L S S DH+V LWD++ G       R+ D +HS   V
Sbjct: 264 QHVATHHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGR----AARSLDAVHSATAV 319

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDIR-AENTTIDTAKCPQPFNTLAFSHHSSNILAAA 270
           + S+WH  +  +  T   DS + ++D+R A +  +           +  +   S  +  A
Sbjct: 320 SSSQWHPSDGSILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFLA 379

Query: 271 GMDS-HVYLYDLRNMKE--PLHHMSGHEDAVTNLEFSP 305
           G DS +VY +DLRN ++  PL  ++ H+  +++L  SP
Sbjct: 380 GTDSGNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVSP 417

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 79/402 (19%), Positives = 157/402 (39%), Gaps = 49/402 (12%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    + WP +T+  +P  +   +  + +  L+   T  + +++N L   +++ 
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 80  LPKEVLNNENPQEQAEM-------------GDEASLPPPRSNIRITAKYEHEEEITRARY 126
           L K ++ ++  +   +               +  +L    + ++++    H +E+  A  
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEVLTATM 237

Query: 127 MPQDPNMVATINGQGTVF------LYSRSDGLQSTLKFHKD-NGYALSFSPLIK-GHLLS 178
                  V  +  Q   F      +   S     T++ H +  GY L +SPLIK G LL+
Sbjct: 238 CENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLT 297

Query: 179 GSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDI 238
           G     + L      S   T  + +   ++  V D +W      +F T   D  ++I D 
Sbjct: 298 GDCSGQIFL-TQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDT 356

Query: 239 RAEN--TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK-------EPLH 289
           R++     I T       N ++++     +LA+   +    ++DLR          +P+ 
Sbjct: 357 RSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEGVQPVA 416

Query: 290 HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGV-------- 341
               H   +T++ F+P            N + +WDL     E   D+ +           
Sbjct: 417 QYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDL---SVEADDDEIQQQTKEYKELQK 473

Query: 342 --PELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWK 381
             P+L+ VH   +  V D   + Q+P  + ST  +  L VWK
Sbjct: 474 IPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 54/138 (39%), Gaps = 7/138 (5%)

Query: 247 TAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSP 305
           TA   Q    + +S   S + A +G D +V ++D R+ K +P          V  + ++ 
Sbjct: 322 TAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNE 381

Query: 306 HXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVP 365
                           +WDL+Q     +P ++E   P  +  +  HR  +     N    
Sbjct: 382 KLGYLLASGDDNGSWGVWDLRQF----SPANSEGVQP--VAQYDFHRGPITSISFNPLDD 435

Query: 366 WLIASTEEENILQVWKCS 383
            ++A   E+N + +W  S
Sbjct: 436 SVVAVASEDNTVTLWDLS 453

>YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Protein
           with WD-40 repeats involved in rRNA processing;
           associates with trans-acting ribosome biogenesis
           factors; similar to beta-transducin superfamily
          Length = 576

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 75/150 (50%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +++ +   +  L S S DH+V LWD++ G+      R+   +HS+  V+ S+WH
Sbjct: 285 HTDAVLSMAHNKYFRSVLASTSADHTVKLWDLNSGN----AARSLASIHSNKNVSSSEWH 340

Query: 218 NFNKDLFGTVSEDSLLKINDIR----AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMD 273
             N  +  T   DS + + D+R    ++ +   +A   +   T+ F+  S NI+      
Sbjct: 341 MLNGSILLTGGYDSRVALTDVRISDESQMSKYWSAMAGEEIETVTFA--SENIILCGTDS 398

Query: 274 SHVYLYDLRN--MKEPLHHMSGHEDAVTNL 301
            +VY +D+RN   ++P+  +  H+  ++ L
Sbjct: 399 GNVYSFDIRNNENRKPVWTLKAHDAGISTL 428

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 81/155 (52%), Gaps = 13/155 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +LS +   +  L S S DH+V LWD++ G       R+   +H++  V+ S+WH
Sbjct: 278 HTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNG----IAARSIASIHNNKNVSSSQWH 333

Query: 218 NFNKDLFGTVSEDSLLKINDIR-AENTTID---TAKCPQPFNTLAFSHHSSNILAAAGMD 273
           + +  +  T   DS + ++D+R A+++ +    +    +   ++ F+  S N++      
Sbjct: 334 STDGSILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEEIESVRFA--SENVIMCGTDS 391

Query: 274 SHVYLYDLRNMK--EPLHHMSGHEDAVTNLEFSPH 306
            +VY +D+RN +  +PL  +  H+  +++L+ + H
Sbjct: 392 GNVYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQH 426

>Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 73/150 (48%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +++ +   +  L S S DH+V LWD++ GS      R+ D +HS+  V+ S+WH
Sbjct: 289 HTDAVLSMAHNRHFRSVLASTSADHTVKLWDLNSGS----AARSLDSIHSNKNVSSSEWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTID----TAKCPQPFNTLAFSHHSSNILAAAGMD 273
             N  +  T   DS + + D+R  + +      +    +   T+ F+    NI+      
Sbjct: 345 MLNGSVLLTGGYDSRVALTDVRISDESQMSKHWSVMSGEEIETVTFADE--NIILCGTDS 402

Query: 274 SHVYLYDLRN--MKEPLHHMSGHEDAVTNL 301
            +VY +D+RN   ++P+  +  H+  ++ L
Sbjct: 403 GNVYSFDIRNNESRKPVWTLKAHDAGISTL 432

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 82/199 (41%), Gaps = 27/199 (13%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
           +  ++P+    L+S S D +  +WD+     S+  +RT    H   V D K+   +  LF
Sbjct: 227 SFHWNPIDTNLLISSSIDTTCIVWDL----QSSNYVRTQLIAHDSEVFDVKFLAHSTQLF 282

Query: 225 GTVSEDSLLKINDIRA----------------ENTTIDTAKCPQPFNTLAFSHHSSNILA 268
            +   D  +++ D+R+                 +T  D  K P     L  S    N++A
Sbjct: 283 ASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMA 342

Query: 269 AAGMDSH-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQ 327
              +DS  + + D+RN   P+  + GH  AV  +++ P             +++ WDL +
Sbjct: 343 TFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

Query: 328 ------IGAEQTPDDAEDG 340
                 + A +   +A DG
Sbjct: 403 WLSPTSLSANENKVNANDG 421

>Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]
           {ON} YLR196W (PWP1) - similar to beta-transducin
           superfamily [contig 161] FULL
          Length = 561

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 80/155 (51%), Gaps = 15/155 (9%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +LS S   +  L S S DH+V LWD++ G       R++  +HS+  V+ S+WH
Sbjct: 274 HTDAVLSLSHSKQFRAVLASTSADHTVKLWDLNAG----IAARSFASIHSNKNVSSSQWH 329

Query: 218 NFNKDLFGTVSEDSLLKINDIR-AENTTID---TAKCPQPFNTLAFSHHSSNILAAAGMD 273
           + +  +  T   DS + + D+R A+++ +    +    +    + F+  ++ +    G D
Sbjct: 330 STSGSVLLTGGYDSRIALTDVRIADDSQMSKYWSVMSGEEVECVQFADENTIM---CGTD 386

Query: 274 S-HVYLYDLRNMK--EPLHHMSGHEDAVTNLEFSP 305
           S +VY YD+R  +  +PL  ++ H+  ++ L  +P
Sbjct: 387 SGNVYSYDIRQGEGSKPLWTLNAHDAGISTLNVNP 421

>KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.356
           YLR196W
          Length = 580

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +L+ + L +  L S S DH+V LWD++  S     +R++D +HS   V+ S+WH
Sbjct: 278 HTDAVLSLAHNKLFRSVLASTSADHTVKLWDLNNAS----VVRSFDSIHSGKNVSASEWH 333

Query: 218 NFNKDLFGTVSEDSLLKINDIRAEN----TTIDTAKCPQPFNTLAFSHHSSNILAAAGMD 273
             N  +  T   DS + + D+R+ +    +   +    +   +  F     NI+      
Sbjct: 334 QSNGSILLTAGYDSRIALTDVRSNDAKNLSKYWSVSSGEEIESATFVDE--NIILCGTDT 391

Query: 274 SHVYLYDLRNMKE--PLHHMSGHEDAVTNL 301
            +VY +D+RN  E   +  +  H+  ++ L
Sbjct: 392 GNVYSFDIRNNAESKSVWTLKAHDSGISAL 421

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 78/157 (49%), Gaps = 10/157 (6%)

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           HLLSG  D+ V LWD++  S+S   +R     H+  V+  K H   + L  + S D    
Sbjct: 229 HLLSGGGDNLVKLWDMT--SNSFEELRG----HAGRVSRVKVHPSGR-LAASASFDLTWI 281

Query: 235 INDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGH 294
           + D+  +          +   T+AF    + +LA+AG+D+   ++DLR+  EP+  + GH
Sbjct: 282 LWDLERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAIWDLRS-GEPIMKLEGH 339

Query: 295 EDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
             A++ +++SP+             + +WD++ +G E
Sbjct: 340 AGAISGVDWSPNGYQLATAGADGT-VRVWDIRNVGTE 375

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 74/148 (50%), Gaps = 9/148 (6%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +L+ +   +  L S S DH+V LWD++ G    T  R+   +HS   V+ S+WH
Sbjct: 287 HTDAILSLALNKHFRAVLASTSADHTVKLWDLNNG----TAARSLASIHSGKNVSSSEWH 342

Query: 218 NFNKDLFGTVSEDSLLKINDIR-AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS-H 275
             N  +  T   DS + ++D+R ++ + +       P   +  S  +   +  +G DS +
Sbjct: 343 KTNGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEEVESSTFADENIILSGTDSGN 402

Query: 276 VYLYDLRN--MKEPLHHMSGHEDAVTNL 301
           VY +D+RN    +P+  ++ H+  ++ L
Sbjct: 403 VYAFDIRNNSGSKPVWTLNAHDAGISCL 430

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 75/156 (48%), Gaps = 13/156 (8%)

Query: 153 QSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-V 211
           Q     H D   +LS +   +  L S S DH+V LWD++ G+      R+   +H++  V
Sbjct: 282 QHITSHHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSGN----AARSMASIHNNKNV 337

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDIRAEN----TTIDTAKCPQPFNTLAFSHHSSNIL 267
           + S+WH+ N  +  T   DS + + D+R  N    +   +    +   T+ F+    NI+
Sbjct: 338 SSSQWHHGNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFA--DENII 395

Query: 268 AAAGMDSHVYLYDLRNM--KEPLHHMSGHEDAVTNL 301
            A     ++Y +D+RN    +P+  +  H+  +++L
Sbjct: 396 LAGTDSGNIYSFDIRNNAGSKPVWTLKAHDAGISSL 431

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 128/318 (40%), Gaps = 51/318 (16%)

Query: 23  LMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGEEENYLKFAEINLPK 82
           L +D ++E  +T+    +QWLP+ V   K     + L I +    +EEN ++  +INL  
Sbjct: 141 LTWDKIAECNVTYSISNIQWLPSHVNPRKIATSSESLRIWSF--NDEENTIQ-EQINLSL 197

Query: 83  EVLNNENPQEQAEMGDE---ASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMV--ATI 137
              N ++  +Q     E    ++  P SN    +       IT   + P D N++  ++I
Sbjct: 198 CKYNKQHHHQQQPAPSETPGGTVIDPLSN----SVLGELPPITSFHWNPIDTNLLISSSI 253

Query: 138 NGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDST 197
           +    V+    S+ +++ L  H    Y + F         S   D SV ++D+   +   
Sbjct: 254 DTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLA--- 310

Query: 198 TPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTL 257
                    HS I+ +    + N D     S+ +LL++               P P    
Sbjct: 311 ---------HSTIIYEPPVSDLNPD----TSQFALLRLE--------------PSP---- 339

Query: 258 AFSHHSSNILAAAGMDSH-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
               H  N++A    DS+ + + D+RN + PL  + GH  +V  +++ P           
Sbjct: 340 ----HDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGD 395

Query: 317 XNRLIMWDLKQIGAEQTP 334
             +++ WDL +  A   P
Sbjct: 396 DCQVLYWDLNKCTASSDP 413

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKF---HKDNGYALSFSPLIKGHLL 177
           + R    P DPN++AT        L       +S L     H  +   + + P+ +  LL
Sbjct: 332 LLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLL 391

Query: 178 SGSDDHSVALWDVSGGSDSTTPIRTWDD 205
           SG DD  V  WD++  + S+ P+ T  D
Sbjct: 392 SGGDDCQVLYWDLNKCTASSDPVATTKD 419

>TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.356
           YLR196W
          Length = 563

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 75/150 (50%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +L+ +   +  L S S DH+V LWD+    +S T  R+   +HS   V+ S+WH
Sbjct: 271 HTDAVLSLTHNKQFRSVLASTSADHTVKLWDL----NSATAARSMASIHSGKNVSSSEWH 326

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDT---AKCP-QPFNTLAFSHHSSNILAAAGMD 273
             N  +  T   DS + ++D+R  + T  +   +  P +   T+ F+    NI+      
Sbjct: 327 TTNGSVLLTGGYDSRIALSDVRIPDETKMSKYWSVVPGEDVETVTFADE--NIMLCGTDS 384

Query: 274 SHVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
            ++Y +D+RN +  +P+  +  H+  +++L
Sbjct: 385 GNIYSFDIRNNENSKPVWTLKAHDAGISSL 414

>Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 74/150 (49%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +++ +   +  L S S DH+V LWD++ G+      R+   +HS+  V+ S+WH
Sbjct: 289 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSGN----AARSLASIHSNKNVSSSEWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDIR----AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMD 273
             N  +  T   DS + + D+R    ++ +   +    +   T+ F++   NI+      
Sbjct: 345 MLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETVTFANE--NIILCGTDS 402

Query: 274 SHVYLYDLRN--MKEPLHHMSGHEDAVTNL 301
            +VY +D+RN   ++P+  +  H+  ++ L
Sbjct: 403 GNVYSFDIRNNENRKPVWTLKAHDAGISTL 432

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 75/360 (20%), Positives = 136/360 (37%), Gaps = 65/360 (18%)

Query: 23  LMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGEEENYLKFAEINLPK 82
           L +D V+E  +T+P  T+QW P    QP+      + +    +  E+E  ++  +INL  
Sbjct: 129 LSWDRVAECNVTFPVSTIQWQPA-RAQPRTFATCSDSLXXFWSLTEDETAIQ-EQINLSL 186

Query: 83  EVLNNENPQEQAEM----GDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMV--AT 136
              N +  ++  E+    G    LPP                IT   + P DPN++  ++
Sbjct: 187 CKHNKQQSEKGKELVGTNGVLGELPP----------------ITSFHWNPTDPNLLISSS 230

Query: 137 INGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDS 196
           I+    V+    ++ +++ L  H    + + F         S   D SV ++D+   +  
Sbjct: 231 IDTTCIVWDLQSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLA-- 288

Query: 197 TTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNT 256
                     HS I+ +    +   DL       +LL++               P PF+ 
Sbjct: 289 ----------HSTIIYEPTIPDGAPDLPSPTVPPALLRLE--------------PSPFD- 323

Query: 257 LAFSHHSSNILAAAGMDS-HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
                   N++A   +DS  V + D+R+   PL  +  H   +  +++ P          
Sbjct: 324 -------PNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSAS 376

Query: 316 XXNRLIMWDLK-QIGAEQTPDDAEDGVPELI-----MVHAGHRSAVNDFDLNAQVPWLIA 369
              +++ WDL   + +E T D   D  P+       M +A     VN+     Q  W  A
Sbjct: 377 DDCQVLYWDLNTHLDSESTKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

>Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196W
           (REAL)
          Length = 576

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 73/150 (48%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +++ +   +  L S S DH+V LWD++ G+      R+   +HS+  V+ S+WH
Sbjct: 285 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSGN----AARSLASIHSNKNVSSSEWH 340

Query: 218 NFNKDLFGTVSEDSLLKINDIR----AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMD 273
             N  +  T   DS + + D+R    ++ +   +    +   T  F+  S NI+      
Sbjct: 341 MLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETATFA--SENIILCGTDS 398

Query: 274 SHVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
            +VY +D+RN +  +P+  +  H+  ++ L
Sbjct: 399 GNVYSFDIRNSENCKPVWTLKAHDAGISTL 428

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 60/148 (40%), Gaps = 29/148 (19%)

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH-------NFNK---DLF 224
           H   G D H  A   V+GG+     I  WD   S  +++  W         FN+   D+ 
Sbjct: 173 HAFQGIDHHREASTFVTGGAQ----IHLWDSNRSKPISNLSWGADNITSVKFNQNEVDIL 228

Query: 225 GTVSEDSLLKINDIRAENTT---IDTAK----CPQPFNTLAFSHHSSNILAAAGMDSHVY 277
            +   D+ + + D+R  + T   I T +    C  P     F          A  D + Y
Sbjct: 229 ASTGSDNAIVLYDLRTNSPTQKIIQTMRTNAICWNPMEAFNF--------VIANEDHNAY 280

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            YD+RNM   LH    H  AV +++FSP
Sbjct: 281 YYDMRNMSRALHVFKDHVSAVMDVDFSP 308

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 74/152 (48%), Gaps = 17/152 (11%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +L+ +   +  L S S DH+V LWD+    ++ T  R+  ++HS+  V+ S+WH
Sbjct: 289 HTDAVLSLAHNRQFRTVLASTSADHTVKLWDL----NNATAARSMANIHSNKNVSSSQWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTL------AFSHHSSNILAAAG 271
             N  +  T   DS   + D+R      D A+  + ++ L        +  S NI+    
Sbjct: 345 MQNASILLTAGYDSRAALTDVRIS----DEAQMSKYWSVLPGEEIETATFASENIILCGT 400

Query: 272 MDSHVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
              +VY +D+RN +  +P+  +  H+  +++L
Sbjct: 401 DAGNVYSFDIRNNEGSKPVWTLKAHDAGISSL 432

>KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} similar
           to uniprot|P21304 Saccharomyces cerevisiae YLR196W PWP1
          Length = 579

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 81/159 (50%), Gaps = 15/159 (9%)

Query: 155 TLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VND 213
            L  H D   +L+ S   +  L S S DH+V LWD++ G       R+   +HS+  V+ 
Sbjct: 288 VLTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLNEG----IAARSVASIHSNKNVSS 343

Query: 214 SKWHNFNKDLFGTVSEDSLLKINDIR-AENTTID---TAKCPQPFNTLAFSHHSSNILAA 269
           S+WH+ +  +  T   DS + ++D+R AE++ +    +    +    + F+  ++ +   
Sbjct: 344 SQWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTGEDVECVQFADENTFM--- 400

Query: 270 AGMDS-HVYLYDLRNMK--EPLHHMSGHEDAVTNLEFSP 305
            G DS +VY +D+R  +  +PL  ++ H+  ++ L  +P
Sbjct: 401 CGTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISALNVNP 439

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 49/218 (22%)

Query: 130 DPNMVATINGQGTVFLYSRSDGLQST--LKFHKDNGYALSFSPLIKGHLLSGSDDHSVAL 187
           +P  V    G GT+ L+  ++ LQ     K H    ++ +++ L +   +SGS D  V +
Sbjct: 72  NPTQVLVAQGDGTLTLFDLTNKLQQIQIYKEHYSEVFSCNWNMLTRRTFISGSWDGKVKI 131

Query: 188 WDVSGGSDSTTPIRTWDDL-----------------HSDIVNDSKWHNFNKDLFGTVSED 230
           WD +  S+S   +R    L                 + D +  + +   + ++    S +
Sbjct: 132 WDCAR-SESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIYQALFSPHDPNMAMCCSGN 190

Query: 231 SLLKINDIRAEN--------TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLR 282
           S L   D+R  N        + ++T  C        ++ + S I+A+AG+D  + ++DLR
Sbjct: 191 SYLTFFDLRQPNQQNSILAHSGLETLSCD-------YNKYRSYIVASAGVDKAIRIWDLR 243

Query: 283 NMKEPLHHM--------------SGHEDAVTNLEFSPH 306
            +K   H+M              + HE A+  + +SPH
Sbjct: 244 MIKNKPHNMFADISSYNCTNEVVNAHELAIRKILWSPH 281

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 105/228 (46%), Gaps = 25/228 (10%)

Query: 132 NMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVS 191
           N++ + + + +   YS S     +++F  +N + L   P+    LL+   +  V L D +
Sbjct: 4   NLLISQSSRTSRTTYSMSYSKLESIEFGPNN-WCLKLQPIYNSGLLTSLSNGRVELIDWA 62

Query: 192 GGSDSTTPIRTWDDLHSDIVNDSKWHN---FNKDLFGTVSEDSLLKINDIRAENTTIDTA 248
               S   I+T    H+  VND    N    N  L  T +ED++ KI D+++ N  + T 
Sbjct: 63  THK-SILQIQT----HATSVNDMVIINNDRMNGSLIATAAEDAV-KIYDLKS-NDCVATL 115

Query: 249 KCPQ--PFNTLAFSHHSSNILAA----AGMDSHVYLYDLRNMKEPLHHM-SGHEDAVTNL 301
           K  +  PF +L   H    +L      +G+D+ +++YD+R+ ++PL  +   H D +T++
Sbjct: 116 KNGKSAPFLSLDSRH---GLLGCGTELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSI 172

Query: 302 EFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 349
           +F P              + ++DL Q    Q  DDA   V     +H+
Sbjct: 173 KFHPSDPNVLLSGSTDGYVNIYDLTQ----QEEDDALHQVINFASIHS 216

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 90/202 (44%), Gaps = 25/202 (12%)

Query: 158 FHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH 217
           F  DN + L F PL    LL+   +  V L D     ++  P+R +  +    +N  K  
Sbjct: 11  FGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDW----ETLNPVRNFK-IDQVSINSMKLI 64

Query: 218 NF---NKDLFGTVSEDSLLKINDIRAENT--TIDTAKCPQPFNTLAFSHHSSNILAAA-- 270
           N    N  LF T + +S+ KI DI++ +   TI   K   PF +L   H   ++LA    
Sbjct: 65  NNDYNNASLFATATLNSV-KIYDIKSNDCIATITNDK-KSPFLSLDSRH---DMLACGTE 119

Query: 271 --GMDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQ 327
             G+D+ +Y+YD+RN   P+   +  H D +T+++F P                ++DL Q
Sbjct: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179

Query: 328 IGAEQTPDDAEDGVPELIMVHA 349
               Q  DDA   V     +H+
Sbjct: 180 ----QEEDDALYQVINYASIHS 197

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 2/122 (1%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQP-FNTLAFSHHSSN 265
           HS  + D  ++  N D+  T S D+ +   D+R+ +    T    +   + + +++  SN
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSN 175

Query: 266 ILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           ILA+A  +  +Y++DLR    PLH + GH+ +V +++F+               +  WD+
Sbjct: 176 ILASAHSND-IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDI 234

Query: 326 KQ 327
            +
Sbjct: 235 SK 236

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 60/127 (47%), Gaps = 14/127 (11%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+  + +ILA   +D++V+ +D+R+   P +  S      + ++++ +          
Sbjct: 123 INFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWN-YKDSNILASAH 181

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            N + +WDL+ +G+  TP      + +L+    GH S+VN  D N      I S+  +  
Sbjct: 182 SNDIYIWDLR-MGS--TP------LHKLV----GHDSSVNSIDFNRFKSSEIMSSSNDGT 228

Query: 377 LQVWKCS 383
           ++ W  S
Sbjct: 229 VKFWDIS 235

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTT 198
           H  +  ++ F+      ++S S+D +V  WD+S GSD+ T
Sbjct: 203 HDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDISKGSDNCT 242

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 62/131 (47%), Gaps = 19/131 (14%)

Query: 254 FNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEP---LHHMSGHEDAVTNLEFSPHXXXX 310
           FN ++ +    +++ A+   + +Y+ DL +   P   L H++  +  V ++++SPH    
Sbjct: 30  FNAVSINPSGRDVVLAS--RNGLYIIDLDDPFSPPRWLQHITPWQ--VADVQWSPHPAKP 85

Query: 311 XXXXXXXN-RLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIA 369
                  N + ++W+L +     T  DA D V     +H GH  A+ D + N + P ++A
Sbjct: 86  YWVVSTSNQKALIWNLAR-----TSSDAIDHV-----LH-GHSRAITDINFNPENPDILA 134

Query: 370 STEEENILQVW 380
           +   +  +  W
Sbjct: 135 TCSVDTYVHAW 145

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 74/157 (47%), Gaps = 6/157 (3%)

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           K H +  + +    +W+++    S+  I      HS  + D  +++ + D+  T S D+ 
Sbjct: 82  KPHWIVSTSNQKAIIWNLN--KPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTY 139

Query: 233 LKINDIRAENTTI-DTAKCPQPFNTLAFSHHSSNILAAA-GMDSHVYLYDLRNMKEPLHH 290
           +   D+R+ +     T+      + + ++   SNILA++ G D  V+++DLR+   PLH 
Sbjct: 140 VHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSNILASSHGND--VFIWDLRHGSTPLHK 197

Query: 291 MSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQ 327
           ++GH   V +++FS               +  WDL +
Sbjct: 198 LTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSK 234

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+    +ILA   +D++V+ +D+R+   P +  S    + + ++++            
Sbjct: 121 INFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWN-FKDSNILASSH 179

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            N + +WDL+      TP          +    GH S VN  D +      I S+  +  
Sbjct: 180 GNDVFIWDLRH---GSTP----------LHKLTGHNSGVNSIDFSRFEENKIMSSSNDGT 226

Query: 377 LQVWKCS 383
           ++ W  S
Sbjct: 227 VKFWDLS 233

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 61/143 (42%), Gaps = 19/143 (13%)

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH-------NFNK---DLF 224
           H   G D H      V+GG++    I  WD   S  + +  W         FN+   D+F
Sbjct: 175 HAFLGIDHHRSNSNFVTGGAE----INLWDSTRSRPITNLSWGADNVSTVKFNQNETDIF 230

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPF--NTLAFSHHSSNILAAAGMDSHVYLYDLR 282
            +   D+ + + D+R   T   T K  Q    N L ++   +     A  D + Y YD+R
Sbjct: 231 ASAGSDNSVVLYDLR---TNSPTQKFVQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMR 287

Query: 283 NMKEPLHHMSGHEDAVTNLEFSP 305
           N+   LH    H  AV +++FSP
Sbjct: 288 NLSRALHVFKDHVSAVMDVDFSP 310

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 90/191 (47%), Gaps = 23/191 (12%)

Query: 146 YSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDD 205
           YS+ D    ++ F  DN + L   PL    LL+   + SV L D        + I+    
Sbjct: 3   YSKVD----SINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDWVKNK-QISQIQAHGT 56

Query: 206 LHSDIV--NDSKWHNFNKDLFGTVSEDSLLKINDIRAENT--TIDTAKCPQPFNTLAFSH 261
             SD+V  N+ + + F   L  T +EDS+ KI D+R+ +T  T+   K   PF +L   H
Sbjct: 57  TISDMVVLNNDRNNGF---LIATAAEDSV-KIFDLRSSDTVATLKNEKS-APFLSLDSRH 111

Query: 262 HSSNILAA----AGMDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXX 316
               +LA     +G+D+ +++YD++   +PL  +   H D +TN++F P           
Sbjct: 112 ---GMLACGTELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGST 168

Query: 317 XNRLIMWDLKQ 327
              + ++DL Q
Sbjct: 169 DGYVNIYDLTQ 179

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 72/153 (47%), Gaps = 4/153 (2%)

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           K + +  + +    +W++S   +ST  I      H   + D  +H  + ++  T S D+ 
Sbjct: 81  KPYWVVSTSNQKAMVWNLS--RNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTY 138

Query: 233 LKINDIRA-ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHM 291
           +   D+R+ +     T++     + + ++  +SNI+A++  D HV ++DLR    PL+ +
Sbjct: 139 VLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSNIMASSHSD-HVCIWDLRKGCTPLYTL 197

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
            GHE +V N++F+               +  WD
Sbjct: 198 QGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWD 230

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 53/129 (41%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F  H   ILA   +D++V  +D+R+ + P +  S      + ++++            
Sbjct: 120 INFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWN-FRNSNIMASSH 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            + + +WDL++            G   L  +  GH  +VN+ D N      I S+  +  
Sbjct: 179 SDHVCIWDLRK------------GCTPLYTLQ-GHEGSVNNIDFNKAKETEIMSSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSVS 234

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 73/152 (48%), Gaps = 17/152 (11%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +L+ +   +  L S S DH+V LWD++ G    T  R+   +HS+  V+ S+WH
Sbjct: 285 HTDAVLSLAHNKHFRSVLASTSADHTVKLWDLNSG----TAARSIASIHSNKNVSASEWH 340

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTL------AFSHHSSNILAAAG 271
             +  +  T   DS L + D+R      D +   + ++ +      A +  S N++    
Sbjct: 341 MSHGSILLTGGYDSRLALTDVRIS----DESNMSKYWSVMGGEEIEAATFASENLILCGT 396

Query: 272 MDSHVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
              +VY +D+RN +  +P+  +  H+  ++ L
Sbjct: 397 DSGNVYSFDIRNNEGSKPVWTLKAHDAGISTL 428

>NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON}
           Anc_7.356 YLR196W
          Length = 581

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +LS +   +  L S S DH+V LWD++ G  +    R+   +HS   V+ S+WH
Sbjct: 290 HTDAILSLSHNKQFRAVLASTSADHTVKLWDLNNGQTA----RSLASVHSGKNVSASEWH 345

Query: 218 NFNKDLFGTVSEDSLLKINDIRAEN----TTIDTAKCPQPFNTLAFSHHSSNILAAAGMD 273
             N  +  T   DS + ++D+R  N    +   +    +      F++   NI+      
Sbjct: 346 PTNGSILLTGGYDSRVALSDVRISNEKEMSKYWSVMSGEEIECTTFANE--NIILCGTDS 403

Query: 274 SHVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
            ++Y +D+RN +  +P+  +  H+  ++ L
Sbjct: 404 GNIYSFDIRNNENSKPVWTLKAHDAGISTL 433

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 86/217 (39%), Gaps = 39/217 (17%)

Query: 156 LKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSK 215
            + HKD   ALSF       L+SGS D  +  WD++ G         +   HSDI   ++
Sbjct: 420 FELHKDEITALSFDS---EALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPAR 476

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
             N    L GT              E   I   +C   +N+          LA    D  
Sbjct: 477 SLNNGACLLGT--------------EAPMIGALQC---YNS---------ALATGTKDGI 510

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK-----QIGA 330
           V L+DLR + +P+  + GH D +T+L+F              N + +WDL+      + A
Sbjct: 511 VRLWDLR-VGKPVRLLEGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSILDVIA 566

Query: 331 EQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWL 367
              P  + D   +LI V A +   VN F++     W+
Sbjct: 567 YDLPVSSLDFDGKLITVGA-NEGGVNVFNMERDEHWM 602

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 70/171 (40%), Gaps = 34/171 (19%)

Query: 147 SRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDL 206
           S +DGL  T  FH D  +              G D H    + V+ G++    I  WD  
Sbjct: 161 SSTDGLIKT--FHGDYAFL-------------GIDHHRSKPYFVTAGAE----INLWDSS 201

Query: 207 HS----------DIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPF-- 254
            S          D V+  K++    D+F +   D+ + + D+R   T   T K  Q    
Sbjct: 202 RSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLR---TNSPTQKFTQRMRT 258

Query: 255 NTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
           N L ++   +     A  D + Y YD+RN+   LH    H  AV +++FSP
Sbjct: 259 NALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSP 309

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 80/345 (23%), Positives = 125/345 (36%), Gaps = 76/345 (22%)

Query: 23  LMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGEEENYLKFAEINLPK 82
           L +D V+E  +T+P  T+QW P+     +       L I +    EEE  L+  +INL  
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRFATCSDSLRIWSFC--EEERNLQ-EQINL-- 204

Query: 83  EVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGT 142
             L   + Q+Q                R+ A       I   R  PQ          QG 
Sbjct: 205 -SLCKYDKQQQGAS-------------RVNAAAGGSGSI---RTNPQQ--------QQGL 239

Query: 143 VFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRT 202
           +        L     FH        ++P+    L+S S D +  +WD+     S+  +RT
Sbjct: 240 I------GELPPITSFH--------WNPVDPNLLISSSIDTTCIVWDL----QSSNYVRT 281

Query: 203 WDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR--AENTTI-DTAKCPQ------- 252
               H   V D ++      LF +   D  +++ D+R  A +T I +    P        
Sbjct: 282 QLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTA 341

Query: 253 -------------PFNTLAFSHHSSNILAAAGMDS-HVYLYDLRNMKEPLHHMSGHEDAV 298
                        P   L  S    N++A   +DS  V + D+RN   P+  + GH  AV
Sbjct: 342 AGSSSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAV 401

Query: 299 TNLEFSPHXXXXXXXXXXXNRLIMWDLKQI----GAEQTPDDAED 339
             + + P             +++ WDL         +Q PD A D
Sbjct: 402 NQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVD 446

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 81/192 (42%), Gaps = 22/192 (11%)

Query: 128 PQDPNMVATINGQGTVFLYS-RSD---GLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDH 183
           PQ  N + +     TV L+S  SD    ++   + + D G   +F      H     D H
Sbjct: 125 PQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHG---EHAFQSLDHH 181

Query: 184 SVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH-------NFNK---DLFGTVSEDSLL 233
                 V+GG+     I  WD   S  +++  W         FN+   D+  +   D+ +
Sbjct: 182 RQKSNFVTGGAQ----IELWDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSV 237

Query: 234 KINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSG 293
            + D+R  + T    +  +  N++ ++   +     A  D + Y YD+RNM + LH    
Sbjct: 238 VLYDLRTNSPTQKIVQTMRT-NSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKD 296

Query: 294 HEDAVTNLEFSP 305
           H  AV +++FSP
Sbjct: 297 HVSAVMDVDFSP 308

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 61/143 (42%), Gaps = 19/143 (13%)

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH-------NFNK---DLF 224
           H   G D H V    V+GG      I+ WD   S  +++  W         FN+   D+ 
Sbjct: 174 HAFQGIDHHKVKTTFVTGGP----TIQLWDTARSKPLSNLSWGADNITSVKFNQTETDIL 229

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPF--NTLAFSHHSSNILAAAGMDSHVYLYDLR 282
            +   D+ + + D+R   T   T K  Q    N + ++   +     A  D + Y YD+R
Sbjct: 230 ASTGSDNSIVLYDVR---TNSPTQKIVQRLRTNAICWNPMEAFNFVTANEDHNAYYYDMR 286

Query: 283 NMKEPLHHMSGHEDAVTNLEFSP 305
           NM   L+    H  AV +++F+P
Sbjct: 287 NMSRALNVFKDHVSAVMDVDFAP 309

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 180 SDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239
           + +    LW++S   +S+  I      HS  + D  +H  + ++  T S D+ +   D+R
Sbjct: 88  TSNQKALLWNLS--RNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMR 145

Query: 240 AENTTIDTAKC-PQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAV 298
           +      +A       + + +++ +SN++A+A  +  VY++DLR    PLH + GH ++V
Sbjct: 146 SPRRAYYSASVWSAGASQVKWNYKNSNVMASAHSND-VYIWDLRKGCTPLHVLQGHVNSV 204

Query: 299 TNLEFSPHXXXXXXXXXXXNRLIMWD 324
            +++FS               +  WD
Sbjct: 205 NSIDFSKFDETEIMSSSNDGTVKFWD 230

>NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.356
           YLR196W
          Length = 607

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 74/148 (50%), Gaps = 9/148 (6%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +LS +   +  L S S DH+V LWD+    ++ T  R+   +H++  V+ S+WH
Sbjct: 322 HTDAVLSLSHNKQFRAVLASTSADHTVKLWDL----NTATAARSLASIHNNKNVSSSEWH 377

Query: 218 NFNKDLFGTVSEDSLLKINDIR-AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS-H 275
             N  +  T   DS + ++D+R ++   +       P   +  +  +   +   G D+ +
Sbjct: 378 VSNGSILLTGGYDSRIALSDVRISDEKQMSKYWSVMPGEEIECTTFADENIILCGTDAGN 437

Query: 276 VYLYDLRNMK--EPLHHMSGHEDAVTNL 301
           +Y +D+RN +  +P+  +  H+  +++L
Sbjct: 438 IYSFDIRNNENSKPVWTLKAHDAGISSL 465

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 58/120 (48%), Gaps = 4/120 (3%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTI-DTAKCPQPFNTLAFSHHSSN 265
           HS  + D  ++  N D+  T S D+ +   D+R+ +     T+      + + ++   SN
Sbjct: 112 HSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWNFKDSN 171

Query: 266 ILAAA-GMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           ILA++ G D  V+++DLRN   PL  + GHE +V +++FS               +  WD
Sbjct: 172 ILASSHGND--VFIWDLRNGSTPLCQLVGHESSVNSIDFSRFKSTEIMSSSNDGTVKFWD 229

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+  + +ILA   +D++V+ +D+R+  +P +  S    + + ++++            
Sbjct: 119 INFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWN-FKDSNILASSH 177

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            N + +WDL+            +G   L  +  GH S+VN  D +      I S+  +  
Sbjct: 178 GNDVFIWDLR------------NGSTPLCQL-VGHESSVNSIDFSRFKSTEIMSSSNDGT 224

Query: 377 LQVWKCS 383
           ++ W  S
Sbjct: 225 VKFWDYS 231

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 74/157 (47%), Gaps = 27/157 (17%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHS-DIVNDSKWH 217
           H D   +LS +   +  L S S D ++ LWD++ G    T +R+   +H+   V+ S+WH
Sbjct: 309 HTDAVLSLSHNKQYRVVLASTSADQTIKLWDLNQG----TAVRSIASIHNGTTVSSSQWH 364

Query: 218 NFNKDLFGTVSEDSLLKINDIRAEN----------TTIDTAKCPQPFNTLAFSHHSSNIL 267
             +  +  T + DS + ++D+R  N           T +  +C    N   F        
Sbjct: 365 PSDGSIILTGAYDSRVALSDVRISNDSEMSKYWSVMTGEEVECVSFVNDNEF-------- 416

Query: 268 AAAGMDS-HVYLYDLRNMKE--PLHHMSGHEDAVTNL 301
             AG DS ++Y +DLRN ++  PL  +  H+  ++++
Sbjct: 417 -LAGTDSGNIYSFDLRNGEKSSPLWTLKAHDSGISSM 452

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 82/203 (40%), Gaps = 31/203 (15%)

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWDVSGGS------DSTTPIRTWDDLHSDIVNDSKWH 217
           + L   P  K  LL+G  +  + L D + G        S T I     + SD V      
Sbjct: 17  WCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDMKIIDSDFVA----- 71

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAG-----M 272
               +L  + S DS+ K+ DIR+ +     AK     N+   S  S + L A G     +
Sbjct: 72  ---GNLISSASIDSV-KVFDIRSNDCV---AKINNETNSPFLSLDSRHGLLACGTELQGI 124

Query: 273 DSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
           D+ +++YD+R    PL  +   H D VT ++F P                ++DLKQ    
Sbjct: 125 DAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ---- 180

Query: 332 QTPDDAEDGVPELIMVHAGHRSA 354
              DD ED + ++I   + H   
Sbjct: 181 ---DDEEDALHQVINYASIHSCG 200

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 79/198 (39%), Gaps = 36/198 (18%)

Query: 129 QDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHL----LSGSDDHS 184
           ++ N + + +   TV L+S +    + LK  +D   A   S L+K +       G D H 
Sbjct: 127 KNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTA---SGLLKTYYSDFAFQGIDHHR 183

Query: 185 VALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH-------NFNK---DLFGTVSEDSLLK 234
                V+GG+     I+ WD   S  + D  W         FN+   D+  +   D+ L 
Sbjct: 184 SKSNFVTGGA----KIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLV 239

Query: 235 INDIRAEN-------TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEP 287
           + D+R  +       T    A C  P     F          A  D + Y YD+RNM   
Sbjct: 240 LYDLRTNSPTQKIVQTMRTNAICWNPMEAFNF--------VVANEDHNAYYYDMRNMSRA 291

Query: 288 LHHMSGHEDAVTNLEFSP 305
           L+    H  AV +++FSP
Sbjct: 292 LNVFKDHVSAVMDVDFSP 309

>TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {ON}
           Anc_7.356 YLR196W
          Length = 582

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWH 217
           H D   +LS +   +  L S S DH+V +WD++ G       R+   +H++  V+ S+WH
Sbjct: 289 HTDAILSLSHNKHFRSVLASTSADHTVKIWDLNSGD----AARSLASIHNNTNVSSSEWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDIR----AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMD 273
             N  +  T   DS + ++D+R    ++ +   +    +   T  F+    NI+      
Sbjct: 345 WTNGSILLTSGYDSRVALSDVRISDESQMSKYWSVMGGEDIETATFADE--NIILCGTDA 402

Query: 274 SHVYLYDLRN--MKEPLHHMSGHEDAVTNL 301
            +VY +D+RN    +P+  +  H+  ++ L
Sbjct: 403 GNVYSFDVRNGDASKPVWTLKAHDAGISTL 432

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 73/151 (48%), Gaps = 16/151 (10%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDL-HSDIVNDSKWH 217
           H D   +L+ + L +  L S S D +V LWD++ G    T  R+ + + H   V+ S+WH
Sbjct: 292 HTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSG----TAARSLNQVHHGSRVSSSQWH 347

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLA-----FSHHSSNILAAAGM 272
             +  +  T   DS + + D+R      D     + +N ++      +   ++    AG 
Sbjct: 348 QTDGSILLTAGYDSKIALTDVRIS----DEKNMSKYWNVMSGEEIETASFINDYTVLAGT 403

Query: 273 DS-HVYLYDLRNMK-EPLHHMSGHEDAVTNL 301
           D+ +VY +D+R+++ +PL  +  H+  +  L
Sbjct: 404 DNGNVYSFDVRSVESKPLWTLKAHDAGIAGL 434

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 88/206 (42%), Gaps = 12/206 (5%)

Query: 105 PRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNG 163
           P  N+       H E +    + P D   V+  +    + +++ S+G Q   L  H  + 
Sbjct: 152 PNFNMVKVMDQAHMECVREISFSPTDQKFVS-CSDDNVLKIWNFSNGQQERVLSGHHWDV 210

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDL 223
            +  + P + G ++SGS D+ +  WD   GS  +T +         I++ +K+     +L
Sbjct: 211 KSCDWHPKM-GLIVSGSKDNLIKFWDPRSGSCVSTML----GFKHTIIS-TKFQPKQGNL 264

Query: 224 FGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
              +S+D   K+ DIR +   + + +    + TL +      +      D  +  +DL  
Sbjct: 265 LSVISKDKTCKVYDIRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQ 324

Query: 284 MKE---PLHHM-SGHEDAVTNLEFSP 305
             +   P H++   HE  VT+L +SP
Sbjct: 325 ENQPNKPTHNIPYAHEKCVTSLAYSP 350

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 74/367 (20%), Positives = 135/367 (36%), Gaps = 84/367 (22%)

Query: 2   EGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELII 61
           E     L V    DL+K      +D V+E  + +P   +QW+P+  +  K       L I
Sbjct: 130 EDSRNKLQVIHSPDLFK------WDNVAECDVIYPVSNIQWMPSAFRSRKIATASDSLRI 183

Query: 62  GTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEI 121
            +  +  EEN L+  ++NL     + ++P  +A +G  + +P   S++  +   E    I
Sbjct: 184 WSLNT--EENKLE-EQLNLSLCKFHKQHPNNKAFVG-LSQIPTKTSDVNPSVLGEFPP-I 238

Query: 122 TRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSD 181
           T   + P D N+                                          L+S S 
Sbjct: 239 TSFHWNPVDTNI------------------------------------------LISSSI 256

Query: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR-- 239
           D +  +WD+     S+  ++T    H   V D ++   +  LF +   D  +++ D+R  
Sbjct: 257 DTTCIVWDL----QSSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCL 312

Query: 240 AENTTIDTAKCPQP------------------FNTLAFSHHSSNILAAAGMDSH-VYLYD 280
           A +T I      +P                     L  S H  N+LA   + S+ + + D
Sbjct: 313 AHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILD 372

Query: 281 LRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQ------IGAEQTP 334
           +RN   PL  ++GH  ++  +++ P             +++ WD+        +    TP
Sbjct: 373 MRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDISSYFDQGAVSHTTTP 432

Query: 335 DDAEDGV 341
             A  G 
Sbjct: 433 RPAASGA 439

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 15/141 (10%)

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHS----------DIVNDSKWHNFNKDLF 224
           H   G D H      V+GG+     I+ WD   S          D V + K++    D+ 
Sbjct: 174 HAFQGLDHHRNNSTFVTGGA----QIQLWDSSRSKPISNLTWGADNVTNVKFNQTETDIL 229

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM 284
            +   D+ + + D+R  + T    +  +  N + ++   +     A  D + Y YD+RNM
Sbjct: 230 ASTGSDNSIVLYDLRTNSPTQKIVQSMRS-NAICWNPMEAFNFVIANEDHNAYYYDMRNM 288

Query: 285 KEPLHHMSGHEDAVTNLEFSP 305
              L+    H  AV +++FSP
Sbjct: 289 SRALNVFKDHVSAVMDVDFSP 309

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 101/259 (38%), Gaps = 40/259 (15%)

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDL 223
           + L   P  K  LL+G  +  + L D S G  S   I+         +ND K    +   
Sbjct: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGK-SVQKIKA----SETAINDMKVIGSDFSA 71

Query: 224 FGTVSEDSL--LKINDIRAENTTIDTA-KCPQPFNTLAFSHHSSNILAAA----GMDSHV 276
              VS  S+  +K+ DIR  +       +   PF +L   H    +LA      G+D+ V
Sbjct: 72  GHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRH---GLLACGTELQGIDAAV 128

Query: 277 YLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPD 335
           Y+YD+R    PL  +   H D VT ++F P                ++DLKQ       D
Sbjct: 129 YIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------D 181

Query: 336 DAEDGVPELI---MVH-AGHRSAVNDFDLNAQVPWLIASTEEE-------------NILQ 378
           + ED + ++I    +H  G  S    F L+    + I    ++             ++ +
Sbjct: 182 EEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVRE 241

Query: 379 VWKCSHSLPIVGGLPKINK 397
           +W C + + I  GL    K
Sbjct: 242 IWNCDYVVDIYPGLIATGK 260

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 93/239 (38%), Gaps = 41/239 (17%)

Query: 156 LKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSK 215
            + H D   ALSF       L+SGS D  +  WD++ G         +   H+D    ++
Sbjct: 423 FELHNDEITALSFDS---EALISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTKTSTR 479

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
                  L GT              E   I   +C   +N+          LA    D  
Sbjct: 480 SGKNGTYLLGT--------------EAPMIGALQC---YNS---------ALATGTKDGV 513

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK-----QIGA 330
           V L+DLR + +P+  + GH D +T+L+F              N + +WDL+      + A
Sbjct: 514 VRLWDLR-IGKPVRSLEGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSIVDVIA 569

Query: 331 EQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSLPIV 389
              P  + D   +LI V A  R  VN F++     W+  + E  N L+  + S  + IV
Sbjct: 570 YDLPVTSLDFDDKLITVGANER-GVNIFNMERDEHWM--TPEPPNSLKRDELSERIAIV 625

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 91/215 (42%), Gaps = 38/215 (17%)

Query: 66  SGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRAR 125
           +G ++  LK  ++NL KE+  + +P  Q    +E  + P   N  +     H +EIT   
Sbjct: 382 TGSKDATLKMWDLNLSKELYLDHSPLRQNM--EETIITPCIHNFEL-----HNDEITALS 434

Query: 126 YMPQ--------------DPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYAL-SFSP 170
           +  +              D      +     +F  + +D   ST +  K+  Y L + +P
Sbjct: 435 FDSEALISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTKTST-RSGKNGTYLLGTEAP 493

Query: 171 LI------KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
           +I         L +G+ D  V LWD+  G     P+R+ +  H+D +   K   F+ +  
Sbjct: 494 MIGALQCYNSALATGTKDGVVRLWDLRIGK----PVRSLEG-HTDGITSLK---FDSEKL 545

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAF 259
            T S D+ ++I D+R  ++ +D      P  +L F
Sbjct: 546 VTGSMDNSVRIWDLRT-SSIVDVIAYDLPVTSLDF 579

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1178

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 2/122 (1%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTI-DTAKCPQPFNTLAFSHHSSN 265
           HS  V D  ++  + DL  T S D+ +   D+R+ N     T       + + +++  SN
Sbjct: 113 HSRAVTDITFNFDHPDLLATCSIDTYIHAWDMRSPNRPFYTTTDWHSGASQVQWNYKQSN 172

Query: 266 ILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           ILA+A   + V ++DLR    PL+ +S H  +V N++F+ H             +  WD 
Sbjct: 173 ILASA-QGNDVCIWDLRMGSTPLYKLSDHSGSVNNIDFNKHRGTEIMTSSNDGTVKFWDY 231

Query: 326 KQ 327
            +
Sbjct: 232 SK 233

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/129 (17%), Positives = 57/129 (44%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+    ++LA   +D++++ +D+R+   P +  +      + ++++ +          
Sbjct: 120 ITFNFDHPDLLATCSIDTYIHAWDMRSPNRPFYTTTDWHSGASQVQWN-YKQSNILASAQ 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            N + +WDL+ +G+  TP          +   + H  +VN+ D N      I ++  +  
Sbjct: 179 GNDVCIWDLR-MGS--TP----------LYKLSDHSGSVNNIDFNKHRGTEIMTSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSKS 234

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 62/156 (39%), Gaps = 15/156 (9%)

Query: 160 KDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH-- 217
           K NG           H   G D H      V+GG+     I  WD+  S  + +  W   
Sbjct: 165 KTNGSGALLKTFYGEHAFQGIDHHREKPLFVTGGA----KIELWDNNRSTPLTNLSWGAD 220

Query: 218 -----NFNK---DLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAA 269
                 FN+   D+  +   D+ + + D+R  + T    +  +  N + ++         
Sbjct: 221 NITSLKFNQSETDIVASAGSDNSVVLYDLRTNSPTQKIVQSMRT-NAICWNPMEPFNFVV 279

Query: 270 AGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
           A  D + Y YD+RNM   L+    H  AV +++FSP
Sbjct: 280 ANEDHNAYYYDMRNMSRSLNVFKDHVSAVMDVDFSP 315

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 65/130 (50%), Gaps = 8/130 (6%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D ++ +WD++ G      +RT    H   V D    + +  LF +VSED  +K 
Sbjct: 155 FITGSNDTTMKVWDLATGK-----LRTTLAGHVMTVRDIAISDRHPYLF-SVSEDKTVKC 208

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295
            D+       D         T++  H + +++A AG DS + L+D+R  + P+  + GH+
Sbjct: 209 WDLEKNQIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDIRT-RVPVITLVGHK 266

Query: 296 DAVTNLEFSP 305
             +  ++ +P
Sbjct: 267 GPINQVQCTP 276

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 16/149 (10%)

Query: 162 NGYA--LSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTT---PIRTWDDLHSDIVNDSKW 216
           NG+   ++  P+      +GS+D ++ +WD++ G    T    I T  D     +  SK 
Sbjct: 129 NGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKD-----ICISKR 183

Query: 217 HNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHV 276
           H +   +F + SED L+K  D+       D        +T+   H + N++A AG DS V
Sbjct: 184 HPY---MF-SASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDI-HPTLNLIATAGRDSVV 238

Query: 277 YLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            L+D+R  K P+  M+GH+  +  ++  P
Sbjct: 239 RLWDIRT-KLPVMTMAGHKSPINRVKCLP 266

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 98/239 (41%), Gaps = 41/239 (17%)

Query: 156 LKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSK 215
            + H D   ALSF       L+SGS D  +  WD+  G      ++  D + +   ND+K
Sbjct: 422 FELHSDEITALSFD---SEALISGSKDRKILHWDLVTGK----CVQQLDLIVTPTYNDTK 474

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
                      VS          R+ N +        P       ++S+  LA+   D  
Sbjct: 475 -----------VSA---------RSANNSTSVLGSEAPMIGALQCYNSA--LASGTKDGV 512

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK-----QIGA 330
           V L+DLR + +P+  + GH D +T+L+F              N + +WDL+      + A
Sbjct: 513 VRLWDLR-IGKPVRALEGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSIIDVIA 568

Query: 331 EQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSLPIV 389
              P  + D   +LI V A + + VN F++     W+  + E  N L+  + S  + IV
Sbjct: 569 YDLPITSLDFDDKLITVGA-NETGVNVFNMERDEHWM--TPEPPNSLKGDEASERIAIV 624

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 32/185 (17%)

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWD---------VSGGSDSTTPIRTWDDLHSDIVNDS 214
           + L   PL +  LLS   +  V L D         V  G+ S   +R  D   SD  N S
Sbjct: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD---SDYDNGS 73

Query: 215 KWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTA---KCPQPFNTLAFSHHSSNILAA-- 269
            +         +V+ +  +K+ D+R +  +I      +   PF +L   H    +LA   
Sbjct: 74  VF---------SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGT 121

Query: 270 --AGMDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
             +G+D+ +++YD+RN  +P+  +   H D VT+++F P                ++DL 
Sbjct: 122 ELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLT 181

Query: 327 QIGAE 331
           Q+  E
Sbjct: 182 QVEEE 186

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 68/141 (48%), Gaps = 8/141 (5%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
            ++  P+     ++GS+D ++ +WD++ G   TT        H   V D    + +  LF
Sbjct: 144 CVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAG-----HVMTVRDVAVSDRHPYLF 198

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM 284
            +VSED  +K  D+       D         T++  H + +++A AG DS + L+D+R  
Sbjct: 199 -SVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDMRT- 255

Query: 285 KEPLHHMSGHEDAVTNLEFSP 305
           + P+  + GH+  +  ++ +P
Sbjct: 256 RIPVITLVGHKGPINQVQCTP 276

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 93/215 (43%), Gaps = 35/215 (16%)

Query: 115 YEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNGYALSFSPLIK 173
           Y H + +        D N +AT +G G V  ++ S   +  + K H      L  SP++ 
Sbjct: 64  YGHRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMSSSEELCSFKAHYGIVTGLCVSPVLA 123

Query: 174 G------HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKW--HNF-----N 220
                  ++LS  DD +V LW V   +D    ++   +L++  +  + +  H+F     +
Sbjct: 124 SKNKNLQYMLSCGDDKTVKLWSVD--TDDYADVKDDQNLNTRGLLKTFYGDHSFQGIDHH 181

Query: 221 KDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYD 280
           +     V+  + +++ D     +T + +       ++ F+ + SNILA+ G D+ + LYD
Sbjct: 182 RSNSAFVTGGAQIQLWDTSRSKSTSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYD 241

Query: 281 LR-------------------NMKEPLHHMSGHED 296
           LR                   N  EP + ++G+ED
Sbjct: 242 LRTNSPTQKIVQQMRTNSLCWNPMEPFNFVTGNED 276

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 2/122 (1%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA-ENTTIDTAKCPQPFNTLAFSHHSSN 265
           HS  + D  +   + D+  T S D+ +   D+R+ +     T+        + ++H   N
Sbjct: 113 HSRAITDINFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWNHSDVN 172

Query: 266 ILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           I+A++  D  V+++DLRN   PL  +S HE +V +++F+               +  WD 
Sbjct: 173 IMASSHGDD-VFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDY 231

Query: 326 KQ 327
            +
Sbjct: 232 SR 233

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + FS    +ILA   +D++V+ +D+R+ + P +  S  + +   ++++ H          
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWN-HSDVNIMASSH 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            + + +WDL+            +G   L  + + H S+VN  D N      I S+  +  
Sbjct: 179 GDDVFIWDLR------------NGSTPLFKL-SSHESSVNSIDFNRFRSTEIMSSSNDGT 225

Query: 377 LQVWKCSHSL 386
           ++ W  S ++
Sbjct: 226 VKFWDYSRNV 235

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 9/113 (7%)

Query: 176 LLSGSDDHSVALWDVSGGS-DSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
            ++ SDD+ + +W+ S G  +ST     WD      V    WH     L  + S+D+L+K
Sbjct: 182 FVTCSDDNILKIWNFSNGQQESTLSGHHWD------VRSCDWHP-TMGLIASGSKDNLVK 234

Query: 235 INDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLR-NMKE 286
           + D RA         C     +  F     N+LA    D    ++D+R NMKE
Sbjct: 235 LWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKE 287

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 87/210 (41%), Gaps = 18/210 (8%)

Query: 105 PRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNG 163
           P  N+       H + I    +   D   V T +    + +++ S+G Q STL  H  + 
Sbjct: 154 PNFNMVKVLDEAHTQCIRGISFSGTDSKFV-TCSDDNILKIWNFSNGQQESTLSGHHWDV 212

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDL 223
            +  + P + G + SGS D+ V LWD   G   +T +          +  +K+     ++
Sbjct: 213 RSCDWHPTM-GLIASGSKDNLVKLWDPRAGQCISTILGC-----KHTIISTKFQPTKGNM 266

Query: 224 FGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
              +S+D   +I DIR     +   +    + +L +   + ++      D  +  +DL  
Sbjct: 267 LAVISKDKSCRIFDIRQNMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDL-- 324

Query: 284 MKEPLHHMSG--------HEDAVTNLEFSP 305
           ++EP    SG        H+  +T+L ++P
Sbjct: 325 LQEPQDSSSGCFHNIPYAHDKCITSLAYNP 354

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 65/130 (50%), Gaps = 8/130 (6%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D ++ +WD++ G   TT        H   V D    + +  LF +VSED  +K 
Sbjct: 155 FVTGSNDTTMKVWDLATGKLKTTLAG-----HVMTVRDIAVSDRHPYLF-SVSEDKTVKC 208

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295
            D+   +   D         T++  H + +++A AG DS V L+D+R  + P+  + GH+
Sbjct: 209 WDLEKNHIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIRT-RMPVITLVGHK 266

Query: 296 DAVTNLEFSP 305
             +  ++ +P
Sbjct: 267 GPINQVQCTP 276

>KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly
           similar to uniprot|Q12021 Saccharomyces cerevisiae
           YDR030C RAD28 Protein involved in transcription- coupled
           repair nucleotide excision repair of UV-induced DNA
           lesions homolog of human CSA protein
          Length = 425

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 68/173 (39%), Gaps = 24/173 (13%)

Query: 174 GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           G   +GS+DH V +WD +    +++          DI +     +   DL    SEDS  
Sbjct: 156 GLFFTGSNDHKVKIWDTNTFQVASSI---------DIAHRVAQLDTLGDLLAVASEDSHP 206

Query: 234 KINDIRAENTTID----TAKCPQPFNTLAFSHHSSN----ILAAAGMDSHVYLYDLR--- 282
           ++ D+R+ +  I      +      N   FSH SS     +LA    D +V ++DLR   
Sbjct: 207 RLIDLRSMSAAISLGVKRSDMRHGINAAKFSHTSSGAKPLLLATGDDDGNVRVWDLRMGN 266

Query: 283 ----NMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
               ++ E       H     +L + P             +  MWDL + GA+
Sbjct: 267 RWLCDLTEADTLSKSHARCCNDLCWDPSGSLKLVTTGNDGKCKMWDLHEGGAK 319

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 89/217 (41%), Gaps = 39/217 (17%)

Query: 155 TLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDS 214
           T + H D   ALS  P     L+SGS D ++  WD+  G      ++T D   ++++  +
Sbjct: 495 TFEAHTDEVTALSLDP---SFLVSGSQDRTIRQWDLRSGK----CMQTIDLSFANVLTAA 547

Query: 215 KWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS 274
                N DL    S+ +LL     R+E  +I      Q F+           LA    D 
Sbjct: 548 T----NVDL----SKSTLLTQ---RSERPSIGAL---QSFDA---------ALATGTKDG 584

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK-----QIG 329
            V L+DLR+ K  +  + GH DA+T+L+F                + +WDL+     +  
Sbjct: 585 IVRLWDLRSGK-VIRTLKGHTDAITSLKFGSECLVTGSYDRT---VRVWDLRTGLLSKFH 640

Query: 330 AEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPW 366
           A   P  + D   E   V   + +AV  +D N    W
Sbjct: 641 AYSEPILSLDLCQENAAVIVANETAVQIYDSNKDESW 677

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 55/119 (46%), Gaps = 2/119 (1%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKC-PQPFNTLAFSHHSSN 265
           HS  + D  +H  N ++  T S D+ +   D+R+      +A         + ++  + N
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWNFKNPN 172

Query: 266 ILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           ++A+A  +  ++++DLR    PLH + GH ++V +++FS               +  WD
Sbjct: 173 VMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWD 230

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 122 TRARYMPQDPNMVATINGQGTVFLYSRSDGLQ--STLKFHKDNGYALSFSPLIKGHLLSG 179
            + ++  ++PN++A+ +    +F++    G      LK H ++  ++ FS   +  ++S 
Sbjct: 162 AQVKWNFKNPNVMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSS 220

Query: 180 SDDHSVALWDVSGGSDSTTPIRT 202
           S+D +V  WD S   +   P+RT
Sbjct: 221 SNDGTVKFWDYS--VNDKEPLRT 241

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 68/142 (47%), Gaps = 19/142 (13%)

Query: 220 NKDLFGTVSEDSLLKINDIRAENT--TIDTAKCPQPFNTLAFSHHSSNILAA----AGMD 273
           N DLF + S+DS+ KI D+R  +   T+   K   PF +L   H   ++LA     +G+D
Sbjct: 70  NSDLFASASKDSV-KIFDVRTSSCVATLHNDK-SAPFLSLDSRH---DMLACGTELSGVD 124

Query: 274 SHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQ 332
           + +++YD++ + +PL   +  H D +T+ +F P              + ++DL       
Sbjct: 125 AELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDL------- 177

Query: 333 TPDDAEDGVPELIMVHAGHRSA 354
           T  D ED + ++I   + H   
Sbjct: 178 TNSDEEDALHQVINFASVHSCG 199

>Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {ON}
           YMR146C (REAL)
          Length = 347

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 90/212 (42%), Gaps = 24/212 (11%)

Query: 109 IRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSF 168
           I++T    HE  +T+ ++  +   + +          YS +     TL  H    +++  
Sbjct: 4   IKLTG---HERPLTQVKFNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDV 60

Query: 169 SPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDD-LHSDIVNDSKWHNFNKDLFGTV 227
               K + ++GS D+S+ LWDVS G      I TW   +    V  S   NF   +   V
Sbjct: 61  DRFTK-YCVTGSADYSIKLWDVSSGQ----SIATWKSPVPVKRVEFSPCGNFFLAILDNV 115

Query: 228 SED-SLLKINDIRAENTTIDTAKCP-QPFNTLAFSHHSSNILAAAG------------MD 273
            ++   + I +I  ++TT +  K   +P + +  +H   +    AG             D
Sbjct: 116 MKNPGSINIYEIERDSTTHEMTKVSEEPIHKIT-THEGLDAATVAGWSTEGKYIVAGHKD 174

Query: 274 SHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
             V  YD+ N  E +  +  HE ++++++FSP
Sbjct: 175 GKVSKYDVTNNYEYVDSIDLHEKSISDMQFSP 206

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 68/154 (44%), Gaps = 8/154 (5%)

Query: 152 LQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIV 211
           L   +K H      +   P+      +GS+D ++ +WD++ G    T        H+  V
Sbjct: 103 LMRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLASGKLKITL-----SGHAMTV 157

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAG 271
            D    N +  LF + SED L K  D+       D        +T+   H + +++A AG
Sbjct: 158 RDIAISNRHPYLF-SASEDKLAKCWDLEKNTAIRDYHGHLSGVHTVDI-HPTLDLIATAG 215

Query: 272 MDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            DS V L+D+R+ + P+  + GH+  +  +   P
Sbjct: 216 RDSVVKLWDIRS-RVPVVTLIGHKSPINKVHCLP 248

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 83/212 (39%), Gaps = 40/212 (18%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           ++S S D +  +WD+     S+  ++T    H   V D ++   +  LF +   D  +++
Sbjct: 259 IISSSIDTTCIVWDL----QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 236 NDIRA---------------------ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS 274
            D+R+                       TT  ++        L  S +  N+LA    DS
Sbjct: 315 FDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADS 374

Query: 275 H-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL-------- 325
           + + + D+RN + P+  + GH  +V  +++ P             +++ WDL        
Sbjct: 375 NKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFMEIN 434

Query: 326 ----KQIGAEQTPDDAEDGVPELIMVHAGHRS 353
               K  GA  TP +  DG  + +M   G  S
Sbjct: 435 GGSVKSPGASGTPLEDTDG--DTVMADGGEGS 464

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 102/267 (38%), Gaps = 61/267 (22%)

Query: 19  SNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGEEENYLKFAEI 78
           SN  L +D V E  + +P   +QW P+ +   K       L I  + + EE  + +  +I
Sbjct: 160 SNDLLSWDSVVEADVVYPVSRIQWAPSQLHPRKLATCSDSLRIW-NVNPEERQFQE--QI 216

Query: 79  NLPKEVLNNENPQEQAEMGDE---ASLPPPRS--------NIRITAKYE----------- 116
           NL     N ++P   A   D     + PP  S        N+ I++  +           
Sbjct: 217 NLSLCKYNRQHPTSTATTEDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSS 276

Query: 117 ---------HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFH-------- 159
                    H+ E+   R++ +   + A+  G G+V ++       ST+ +         
Sbjct: 277 HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSS 336

Query: 160 -----------KDNGYA---LSFSPLIKGHLLS-GSDDHSVALWDVSGGSDSTTPIRTWD 204
                       D  YA   L  SP     L +  +D + + + D+    +  +PI T +
Sbjct: 337 SAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADSNKIIILDM---RNPESPILTLE 393

Query: 205 DLHSDIVNDSKWHNFNKDLFGTVSEDS 231
             HS  VN+ KWH   +++  + S+D 
Sbjct: 394 G-HSSSVNEIKWHPTKRNVLLSCSDDC 419

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 73/160 (45%), Gaps = 4/160 (2%)

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           K H +  + +    +W++S    S+  I      H   + D  +H  + +L  T S D+ 
Sbjct: 81  KPHWVVSTSNQKALVWNLS--RTSSNAIEYELHGHFRAITDINFHPSHPELLATCSIDTY 138

Query: 233 LKINDIRA-ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHM 291
           +   D+R+ +     T+      + + ++  ++N+LA++  +S V+++D+R    PL+ +
Sbjct: 139 VHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHANS-VFIWDIRKGCTPLYKL 197

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
           SG+  +V N++F+               +  WD  +   E
Sbjct: 198 SGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKSSTE 237

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 266 ILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           +LA   +D++V+ +D+R+ + P +  S      + ++++             N + +WD+
Sbjct: 129 LLATCSIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHA-NSVFIWDI 187

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHS 385
           ++            G   L  + +G+ S+VN+ D N      I S+  +  ++ W  S S
Sbjct: 188 RK------------GCTPLYKL-SGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKS 234

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 8/130 (6%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D ++ +WD++ G    T        H   V D    + +  LF +VSED  +K 
Sbjct: 155 FVTGSNDTTMKVWDLASGKLKVTLTG-----HVMTVRDIAVSDRHPYLF-SVSEDKTVKC 208

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295
            D+       D         T++  H + +++A AG DS V L+D+R  + P+  + GH+
Sbjct: 209 WDLEKNQIIRDYHGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIRT-RVPVITLVGHK 266

Query: 296 DAVTNLEFSP 305
             +  +E +P
Sbjct: 267 GPINQVECAP 276

>Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [contig
           163] FULL
          Length = 369

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 71/146 (48%), Gaps = 10/146 (6%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H+ +    +F  L     ++GS D  +AL D+  G      +R +   H+ +VN  +   
Sbjct: 117 HRRSAAITTFDTLDDTRAVTGSSDTRLALVDLHTGR----KLRNFAG-HTRVVNQVR--A 169

Query: 219 FNKDLFGTVSEDSLLKINDIRAENTTID-TAKCPQPFNTLAFSHHSSNILAAAGMDSHVY 277
            N D F +VS+D  LKI D   ++     +++ P    T + S    NIL  +G+D  + 
Sbjct: 170 LNTDRFASVSDDGALKIWDAHTKSPVWQISSEFPLFTLTSSSSSSDDNILYTSGLDPVIR 229

Query: 278 LYDLR--NMKEPLHHMSGHEDAVTNL 301
            YDLR  N +E  +  + H D+VT++
Sbjct: 230 AYDLRQNNGQELFNWSTPHTDSVTSI 255

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 86/192 (44%), Gaps = 10/192 (5%)

Query: 117 HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNGYALSFSPLIKGH 175
           H E I    +   D   V T +    + +++ S+G Q   L  H  +  +  + P + G 
Sbjct: 165 HTEGIRDVAFSNNDSKFV-TCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPEL-GL 222

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           ++SGS D+ V LWD   G   +T ++         V  +++     +L   +S+D   ++
Sbjct: 223 IVSGSKDNLVKLWDPRSGQCVSTLLK-----FKHTVLKTRFQPTKGNLLAAISKDKSCRV 277

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDL-RNMKEPLHHMS-G 293
            D+RA    +   +    F  L +S  + ++      D  +  +DL ++ ++P+H +   
Sbjct: 278 FDLRASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFA 337

Query: 294 HEDAVTNLEFSP 305
           HE  ++ + ++P
Sbjct: 338 HEKCISAIAYNP 349

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 69/167 (41%), Gaps = 9/167 (5%)

Query: 117 HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTL-KFHKDNGYALSFSPLIKGH 175
           H+  +T  +Y      M++  +  GT+ ++  +  +   L + H +    ++FS      
Sbjct: 123 HDTSVTTMKYSHAGDWMISG-DADGTIKIWQPNFNMVKELDRIHTEGIRDVAFSNN-DSK 180

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
            ++ SDD+ + +W+ S G       R     H D V    WH     L  + S+D+L+K+
Sbjct: 181 FVTCSDDNILKIWNFSNGQQE----RVLSGHHWD-VRSCDWHP-ELGLIVSGSKDNLVKL 234

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLR 282
            D R+        K         F     N+LAA   D    ++DLR
Sbjct: 235 WDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLR 281

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 72/150 (48%), Gaps = 15/150 (10%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H D+  +L++SP     +++ SDD  + +WDV  G      + T+DD H+  V   ++  
Sbjct: 341 HFDSMNSLTYSP-DGSRVVTSSDDGKIKIWDVVSG----FCLATFDD-HTSSVTAVQFAK 394

Query: 219 FNKDLFGTVSEDSLLKIND-IRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS--- 274
             + LF + S D  +K  D IR  N    TA     FN LA    S  ++ A  +DS   
Sbjct: 395 KGQVLF-SASLDGTVKAWDLIRYRNFRTFTAAERIQFNCLAVD-PSGEVVCAGSVDSFEI 452

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           HV+     N+   L  ++GHE  V+ L FS
Sbjct: 453 HVWSVQTGNL---LDTLAGHEGPVSCLSFS 479

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 71/170 (41%), Gaps = 30/170 (17%)

Query: 134 VATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGG 193
           V   +G+      S+ D    T   H D   ALSFS     +L+SGS D ++  WD++ G
Sbjct: 526 VNLFDGENISMEDSKEDACVYTFDAHVDEITALSFSG---DNLISGSQDRTIRQWDLNSG 582

Query: 194 SDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQP 253
                 ++T D   +  VN S          GT+S  S   +  +  E   I   +C   
Sbjct: 583 K----CVQTIDINFASRVNSSTS--------GTLSSRSSTLL--VPNEQPVIGALQCYDA 628

Query: 254 FNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEF 303
                        LA    D  V L+DLR+  + +  + GH DA+T+L+F
Sbjct: 629 ------------ALATGTKDGLVRLWDLRS-GQVVRTLQGHTDAITSLQF 665

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 134 VATINGQGTVFLYS-RSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSG 192
           +AT    G V L+  RS  +  TL+ H D   +L F  +   +L++GS D S+ +WD+  
Sbjct: 630 LATGTKDGLVRLWDLRSGQVVRTLQGHTDAITSLQFDSI---NLITGSIDRSIRIWDLRT 686

Query: 193 GS 194
           G+
Sbjct: 687 GT 688

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 63/138 (45%), Gaps = 13/138 (9%)

Query: 177 LSGSDDHSVALWDVSGG-------SDSTTPIR--TWDDLHSDIVNDSKWHNFNKDLFGTV 227
           + G D H +    V+GG       S+ + PI   +W    +D V + K++    D+  + 
Sbjct: 175 IQGLDHHRIDPTFVTGGPMIELWDSNRSNPISNLSWG---ADNVTNVKFNQNEHDILAST 231

Query: 228 SEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEP 287
             D+ + + D+R  + T    +  +  N+L ++   +     A  D + Y YD+R M   
Sbjct: 232 GSDNSIVLYDLRTNSPTQKIVQTMRT-NSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRA 290

Query: 288 LHHMSGHEDAVTNLEFSP 305
           L+    H  AV +++FSP
Sbjct: 291 LNVFKDHVSAVMDVDFSP 308

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 69/160 (43%), Gaps = 4/160 (2%)

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           K H +  + +    +W++S    S+  +      H   + D  +H    ++  T S D+ 
Sbjct: 81  KHHWVISTSNQKAIVWNLS--RSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTY 138

Query: 233 LKINDIRA-ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHM 291
               D+R+ +     T+        + ++H +SN+LA +  +  VY++D+R    PL  +
Sbjct: 139 ALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSNI-VYVWDVRKGTSPLSVL 197

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
            GH  +V +++F+P              +  WD  ++  E
Sbjct: 198 EGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 48/115 (41%), Gaps = 14/115 (12%)

Query: 266 ILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           ILA + +D++   +D+R+ K+P    S        ++++ H           N + +WD+
Sbjct: 129 ILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWN-HKNSNVLATSHSNIVYVWDV 187

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVW 380
           ++            G   L ++  GH  +VN  D N      I S+  +  ++ W
Sbjct: 188 RK------------GTSPLSVLE-GHSGSVNSIDFNPFNETEIMSSGNDGTVKFW 229

>TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {ON}
           Anc_4.309 YLR429W
          Length = 642

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 67/171 (39%), Gaps = 16/171 (9%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDL-----------HSDIVNDSKW 216
           F P     + SGSDD  + +WD+  G      I    D+           HS  V    +
Sbjct: 89  FDPFNDHRVASGSDDCKIGIWDIPEGYSFRNHIDENGDVIDIQPTKMLTGHSRKVGHVLF 148

Query: 217 HNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHV 276
           H  ++++  + S D  ++I ++      I T K P    +++FS +  N LA    D  +
Sbjct: 149 HPVSQNVLASSSLDYTVRIWNVETGENLI-TLKHPDMVTSMSFS-YDGNHLATVARDKKL 206

Query: 277 YLYDLRNMK---EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
            ++D+RN K   E L H       V  L  S              ++ +WD
Sbjct: 207 RVWDIRNNKIVSEGLAHAGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWD 257

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 10/123 (8%)

Query: 185 VALWDVSGGSDSTTPIR--TWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN 242
           + LWD    ++ + PI   TW    +D V   K++    D+  +   D+ + + D+R  N
Sbjct: 195 IQLWD----ANRSKPISNLTWG---ADNVTSVKFNQTETDILASTGSDNSIVLYDLRT-N 246

Query: 243 TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
           +     +     N + ++   +     A  D + Y YD+RNM   L+    H  AV +++
Sbjct: 247 SPTQKIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 306

Query: 303 FSP 305
           FSP
Sbjct: 307 FSP 309

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 60/123 (48%), Gaps = 10/123 (8%)

Query: 185 VALWDVSGGSDSTTPIR--TWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN 242
           + LWD+    + + P+   +W    +D +N  K++  + ++ G+   D+ + + D+R  +
Sbjct: 198 INLWDI----NRSKPLSDLSWG---ADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNS 250

Query: 243 TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
            T    +  +  N++ ++   +     A  D + Y YD+RNM   L+    H  AV +++
Sbjct: 251 ATQKIVQTMR-VNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 309

Query: 303 FSP 305
            SP
Sbjct: 310 ISP 312

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 72/169 (42%), Gaps = 16/169 (9%)

Query: 130 DPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNGYALSFSPLI---------KGHLLSG 179
           D N +A+ +G G +  +  S   Q ++ K H      L  +P +         +  +LS 
Sbjct: 79  DLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNIDSASSGNQNFVLSS 138

Query: 180 SDDHSVALWDVS----GGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGT--VSEDSLL 233
           SDD +V LW V+       D+   I T + L      +  +   +     +  V+    +
Sbjct: 139 SDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDHSRMTSNFVTGGPRI 198

Query: 234 KINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLR 282
            + DI       D +      NT+ F+ + +N+L +AG D+ + LYDLR
Sbjct: 199 NLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLR 247

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 76/174 (43%), Gaps = 17/174 (9%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
           +  ++P+    L+S S D +  +WD+    +S+  ++T    H   V D ++   +  LF
Sbjct: 253 SFHWNPIDTNLLISSSIDTTCIIWDL----ESSNYVKTQLIAHDSEVFDVRFLTQSTQLF 308

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFN------------TLAFSHHSSNILAAAGM 272
            +   D  +++ D+R+   +    + P   +             L  S H  NI+A    
Sbjct: 309 ASCGGDGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAA 368

Query: 273 DSH-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           DS+ + + D+RN + P+  + GH  ++  +++ P             +++ WDL
Sbjct: 369 DSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 62/175 (35%), Gaps = 39/175 (22%)

Query: 23  LMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGT-----HTSGEEEN-----Y 72
           L +D ++E  +T+    +QWLP+  +  K     + L I T     +T  E  N     Y
Sbjct: 158 LTWDKITECNVTYSISKMQWLPSHPKPRKLATSSESLRIWTLNDENNTLNETINLSLCKY 217

Query: 73  LKFAEINLPKEVLNNENPQEQAEMGDEASLPPP--------------------------- 105
            K   +N+     N+ NP   A   D     PP                           
Sbjct: 218 KKQHHMNIKAVATNSGNPLSDAVPNDILGEFPPITSFHWNPIDTNLLISSSIDTTCIIWD 277

Query: 106 --RSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKF 158
              SN   T    H+ E+   R++ Q   + A+  G G+V ++       ST+ +
Sbjct: 278 LESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIY 332

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 9/113 (7%)

Query: 176 LLSGSDDHSVALWDVSGGS-DSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
            ++ SDD+ + +W+ S G  +ST     WD      V    WH     L  + S+D+L+K
Sbjct: 182 FVTCSDDNILKIWNFSNGQQESTLTGHHWD------VRSCDWHP-TMGLIASGSKDNLIK 234

Query: 235 INDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLR-NMKE 286
           + D R+         C     +  F     N+LA    D    ++D+R NMKE
Sbjct: 235 LWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFDIRQNMKE 287

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 87/210 (41%), Gaps = 18/210 (8%)

Query: 105 PRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNG 163
           P  N+       H + I    +   D   V T +    + +++ S+G Q STL  H  + 
Sbjct: 154 PNFNMVKVLDEAHTQCIRGISFSGTDSKFV-TCSDDNILKIWNFSNGQQESTLTGHHWDV 212

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDL 223
            +  + P + G + SGS D+ + LWD   G   +T +          +  +K+     ++
Sbjct: 213 RSCDWHPTM-GLIASGSKDNLIKLWDPRSGQCISTILGC-----KHTIISTKFQPTKGNM 266

Query: 224 FGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
              +S+D   ++ DIR     +   +    + +L +   + +I      D  +  +DL  
Sbjct: 267 LAVISKDKSCRVFDIRQNMKELAVYRDESDYMSLTWHPINESIFTVGCYDGSMKHFDL-- 324

Query: 284 MKEPLHHMSG--------HEDAVTNLEFSP 305
           M+EP    SG        H+  +T+L ++P
Sbjct: 325 MQEPQDSSSGCFHNIPYAHDKCITSLAYNP 354

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 88/197 (44%), Gaps = 25/197 (12%)

Query: 146 YSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDD 205
           Y++ D    T+ F  DN + L   PL    LLS   +  V L D     +S T I+    
Sbjct: 3   YTKCD----TISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDW----NSLTSIQDIP- 52

Query: 206 LHSDIVNDSKWHNFNKD---LFGTVSEDSLLKINDIRAENT--TIDTAKCPQPFNTLAFS 260
           +H   ++  K  + + D    F T SEDS+ KI D+R      T+  AK   PF +L   
Sbjct: 53  VHGTSISALKVLDNDVDSGNTFVTASEDSV-KIFDLRLNQCVATVQNAK-NSPFISLDSR 110

Query: 261 HHSSNILAA----AGMDSHVYLYDLRNMKEPLHHMS-GHEDAVTNLEFSPHXXXXXXXXX 315
           H    +LA     +G D+ ++LYDL+ +  P+      H D +T+++F            
Sbjct: 111 H---GMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGS 167

Query: 316 XXNRLIMWDLKQIGAEQ 332
               + ++DLKQ   E+
Sbjct: 168 TDGYVNVYDLKQQEEEE 184

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 24/130 (18%)

Query: 185 VALWDVSGGSDSTTPIR--TWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN 242
           + LWD    S+ +TP+   +W    +D +   K++    D+F +   D+ + + D+R  +
Sbjct: 195 IQLWD----SNRSTPLSNLSWG---ADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNS 247

Query: 243 -------TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295
                  T    A C  P     F             D + Y YD+RNM   ++    H 
Sbjct: 248 PTQKIVQTMRTNAICWNPMEAFNF--------VIGNEDHNAYYYDMRNMSRAINVFKDHV 299

Query: 296 DAVTNLEFSP 305
            AV +++FSP
Sbjct: 300 SAVMDVDFSP 309

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 85/195 (43%), Gaps = 21/195 (10%)

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWHNFNKD 222
           + L   P  K  LL+G  +  + L D + G  S   I+  +   +D+ V DS +   +  
Sbjct: 17  WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQ-SLQKIKASETSINDLKVIDSDFAAGH-- 73

Query: 223 LFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAG-----MDSHVY 277
           L  + S D++ K+ DIR   T    AK     N+   S  S + L A G     +D+ VY
Sbjct: 74  LVSSASIDAV-KVFDIR---TNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVY 129

Query: 278 LYDLRNMKEPLHH-MSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDD 336
           +YD+R    PL   +  H D VT ++F P                ++DLKQ       D+
Sbjct: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DE 182

Query: 337 AEDGVPELIMVHAGH 351
            ED + ++I   + H
Sbjct: 183 EEDALHQVINYASIH 197

>Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {ON}
           YMR146C (REAL)
          Length = 347

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 89/212 (41%), Gaps = 24/212 (11%)

Query: 109 IRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSF 168
           I++T    HE  +T+ +Y  +   + +          YS +     TL  H    +++  
Sbjct: 4   IKLTG---HERPLTQVKYNKEGDLLFSCSKDSSASIWYSLNGERLGTLDGHTGTIWSIDV 60

Query: 169 SPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDD-LHSDIVNDSKWHNFNKDLFGTV 227
               K + ++GS D+S+ LWDVS G      I TW   +    V  S   N+   +   V
Sbjct: 61  DRFTK-YCVTGSADYSIKLWDVSSGQ----CIATWKSPVPVKRVEFSPCGNYFLAILDNV 115

Query: 228 SED-SLLKINDIRAENTTIDTAKCPQ-PFNTLAFSHHSSNILAAAG------------MD 273
            ++   + I  I  ++TT +  K  + P + +  +H   +    AG             D
Sbjct: 116 MKNPGSINIYQIERDSTTHELTKVSEDPIHAI-ITHEGLDAATVAGWSTKGAYIVAGHKD 174

Query: 274 SHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
             +  YD+ N  E +  +  HE ++++++FSP
Sbjct: 175 GKISKYDVNNNYEYVDSIDLHEKSISDMQFSP 206

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 111/303 (36%), Gaps = 80/303 (26%)

Query: 130 DPNMVATINGQGTVFLYSRSDG--LQSTLKFHKDNGYALSFSPL------IKGHLLSGSD 181
           D  ++AT +   T+ L+    G      +K H     +L++ PL       K  L S S 
Sbjct: 197 DGELIATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASK 256

Query: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAE 241
           D ++ +WD S      T + T    H++ V+  KW    + L  T S D  +++ DI+A 
Sbjct: 257 DGTIKIWDAS----RRTCLYTLSG-HTNSVSCVKWGG--QGLLYTGSHDKTIRVWDIKAG 309

Query: 242 NTTIDTAKC------------------------------PQPFNTLAFSHHSS------- 264
              I+  K                               PQ    +A  ++         
Sbjct: 310 GKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEARDIAKKNYEKVVRKSGQ 369

Query: 265 --NILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIM 322
              ++  A  D  ++L++     +PL  M+GH+  V ++ FSP            N + +
Sbjct: 370 VEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSPD-GRYIVSASFDNSIKL 428

Query: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPW-----LIASTEEENIL 377
           W            D  DG  + I    GH ++V       QV W     L+ S  ++  L
Sbjct: 429 W------------DGRDG--KFIATFRGHVASVY------QVAWSSDCRLLVSCSKDTTL 468

Query: 378 QVW 380
           +VW
Sbjct: 469 KVW 471

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 77/172 (44%), Gaps = 20/172 (11%)

Query: 167 SFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGT 226
           +F+P     +++G+ D++  +WD +    + TP+      HS+ V    W + + +L  T
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDCA----TQTPLSVLKG-HSNWVLCVAW-SPDGELIAT 203

Query: 227 VSEDSLLKINDIRAENTTIDTAK---------CPQPFNTLAFSHHSSNILAAAGMDSHVY 277
            S D+ +++ + +A     D  K           +P + +A        LA+A  D  + 
Sbjct: 204 GSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPR--LASASKDGTIK 261

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG 329
           ++D  + +  L+ +SGH ++V+ +++               R+  WD+K  G
Sbjct: 262 IWDA-SRRTCLYTLSGHTNSVSCVKWGGQGLLYTGSHDKTIRV--WDIKAGG 310

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 185 VALWDVSGGSDSTTPIR--TWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN 242
           + LWDV    +   P+   +W     D V+  +++   +D+  +   D+ + + D+R  +
Sbjct: 198 IQLWDV----NRKKPLSNLSWG---VDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNS 250

Query: 243 TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
            T    +  +  N L ++       A A  D + Y YD+RNM   LH    H  AV +++
Sbjct: 251 PTQKVVQRMRT-NALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVD 309

Query: 303 FSP 305
           FSP
Sbjct: 310 FSP 312

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 76/184 (41%), Gaps = 18/184 (9%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H+D  Y L+ +  +   L SGS D  V  W+++   +  +    +  +    V  +    
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSP 125

Query: 219 FNKDLFG-TVSEDSLLKI------------NDIRAENTTIDTAKCPQPFNTLAFS---HH 262
             KD F  +  +D  +K+            +D +  + T D A     +   AF    HH
Sbjct: 126 TKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEHAFQSIDHH 185

Query: 263 SSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIM 322
             N     G  + + L+D+ N K+PL ++S   D V+ + F+ +           N +++
Sbjct: 186 RRNPNFVTG-GAQIQLWDV-NRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVL 243

Query: 323 WDLK 326
           +DL+
Sbjct: 244 YDLR 247

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 87/221 (39%), Gaps = 47/221 (21%)

Query: 156 LKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSK 215
            + H D   ALSF       L+SGS D  +  WD++ G      I+  D + +   NDS+
Sbjct: 439 FEIHDDEITALSFDS---EALISGSKDKKILHWDMATGK----CIQQLDLIFAPTHNDSR 491

Query: 216 WH----NFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAG 271
                 N++  L  T              +   I   +C +            + LA   
Sbjct: 492 ISAPSSNYSTRLLDT--------------DAPMIGALQCYK------------SALATGT 525

Query: 272 MDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK----- 326
            D  V L+DLR + +P+  + GH D +T+L+F              N + +WDL+     
Sbjct: 526 KDGIVRLWDLR-VGKPVRLLRGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSVV 581

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWL 367
            + A   P  + D   +LI V A  R  VN F++     W+
Sbjct: 582 DVIAYDLPVTSLDFDDKLIAVGANER-GVNVFNMELDEHWM 621

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 104/268 (38%), Gaps = 56/268 (20%)

Query: 128 PQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNGYALSFSPLIKGHLLSGSDDHSVA 186
           P D   +A+ +  GT+ ++  +  +   TL  H ++   + +    +G L SGS D ++ 
Sbjct: 244 PGDKPRLASASKDGTIKIWDTARRVCLFTLSGHTNSVSCVKWGG--RGVLYSGSHDKTIR 301

Query: 187 LWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTID 246
            WD++ G      +++    H+  +N             ++S D  L++    A + T  
Sbjct: 302 AWDMNAGGKCINILKS----HAHWINHL-----------SLSTDYALRVG---AFDHTGK 343

Query: 247 TAKCPQPFNTLAFSHHSS---------NILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDA 297
               P+     A  ++            ++  A  D  +YL+D     +P+  M+GH+  
Sbjct: 344 KPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKL 403

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVND 357
           V ++ FSP            N + +W            D  DG    I    GH ++V  
Sbjct: 404 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDGT--FIATFRGHVASV-- 446

Query: 358 FDLNAQVPW-----LIASTEEENILQVW 380
                QV W     L+ S  ++  L+VW
Sbjct: 447 ----YQVAWSSDCRLLVSCSKDTTLKVW 470

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 74/152 (48%), Gaps = 16/152 (10%)

Query: 133 MVATINGQGTVFLYSRSDGLQSTLKFHKDNGYA-----LSFSPLIKGHLLSGSDDHSVAL 187
           ++ T +   T++L+   D ++ST    +  G+      ++FSP  + +++S S D+S+ L
Sbjct: 372 LMVTASDDFTMYLW---DPIKSTKPITRMTGHQKLVNHVAFSPDGR-YIVSASFDNSIKL 427

Query: 188 WDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDT 247
           WD   G D T  I T+   H   V    W + +  L  + S+D+ LK+ D+R +  ++D 
Sbjct: 428 WD---GRDGTF-IATFRG-HVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVRTKKLSVDL 481

Query: 248 AKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
                   T+ +S     +  +AG D  V ++
Sbjct: 482 PGHKDEVYTVDWSVDGKRV-CSAGKDKMVRIW 512

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 85/204 (41%), Gaps = 23/204 (11%)

Query: 155 TLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWD-VSGGSDSTTPIRTWDDLHSDIVND 213
           T  F  DN + L   P    HLL+   +  V   D V+G S     +R  D   +  +N 
Sbjct: 9   TQDFGSDN-WCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKS-----VRV-DQAGNSSINK 61

Query: 214 SKW--HNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQ-PFNTLAFSHHSSNILAA- 269
            K    NFN+     V+ +  + I D+R+ +           PF +L   H    +LA  
Sbjct: 62  LKIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRH---GMLACG 118

Query: 270 ---AGMDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
              +G+D+ +++YD+RN   P+   +  H D VT++ F P                ++DL
Sbjct: 119 TELSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDL 178

Query: 326 KQIGAEQTPDDAEDGVPELIMVHA 349
           KQ    Q  DDA   V     +H+
Sbjct: 179 KQ----QEEDDALHQVINYASIHS 198

>KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa]
           {ON} Anc_4.309 YLR429W
          Length = 634

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 15/127 (11%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDV------------SGGSDSTTPIRTWDDLHSDIVNDSK 215
           F P  +  L SGSDD  + +WD+            +G      P++     HS  V    
Sbjct: 89  FDPFNQRRLASGSDDSKIGIWDIPEDYSFHNYLDSNGDPKDIKPVKMLAG-HSRKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
           +H   +D+  + S D  +KI ++      + T K P    +++FS++ ++ LA    D  
Sbjct: 148 YHPLAQDILASSSLDYTVKIWNVET-GEVLFTLKHPDMVTSMSFSYNGAH-LATVARDKK 205

Query: 276 VYLYDLR 282
           + ++D+R
Sbjct: 206 LRVWDVR 212

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 64/137 (46%), Gaps = 10/137 (7%)

Query: 174 GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           G ++SGS D+ + LWD   G + +T +     L   ++  +K+     +L   VS+D  +
Sbjct: 218 GLIVSGSKDNLIKLWDPRTGRNVSTIL----GLKHTVIK-TKFQPTQGNLLAVVSKDKSI 272

Query: 234 KINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDL----RNMKEPLH 289
           KI D+R     + T +    + +L++   +  I +    +  +  +DL     N     H
Sbjct: 273 KIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACH 332

Query: 290 HMS-GHEDAVTNLEFSP 305
            +   HE +VT+L +SP
Sbjct: 333 TIPYAHEKSVTSLAYSP 349

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 81/181 (44%), Gaps = 18/181 (9%)

Query: 162 NGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKW--HNF 219
           N + L F PL    LL+   +  +++ D       T  I+    +    +ND +   +N+
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWK-----TNQIKDKIKIGETSINDFEIVNNNY 68

Query: 220 NKDLFGTVSEDSLLKINDIRAENT--TIDTAKCPQPFNTLAFSHHSSNILAA----AGMD 273
           N       + +  +KI D+++ +   TI   K   PF +L   H   N++A     +G+D
Sbjct: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEK-NSPFLSLDSLH---NMMACGTELSGVD 124

Query: 274 SHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQ 332
           + +Y+YD+R+   P+   +  H D +T+++F P+               ++DL +   E 
Sbjct: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEED 184

Query: 333 T 333
           +
Sbjct: 185 S 185

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 72/172 (41%), Gaps = 36/172 (20%)

Query: 155 TLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDS 214
           T   H D   ALSF      +L+SGS D ++  WD++ G      ++T D      +N +
Sbjct: 500 TFDSHIDEITALSFEA---NNLVSGSQDRTIRQWDLNNGK----CVQTLD------INFA 546

Query: 215 KWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS 274
              N ++ + G+      L  N+   ++  I   +C                LA    D 
Sbjct: 547 TGGNLSRSMIGS----GFLNTNN---DHPIIGAIQCYDA------------ALATGTKDG 587

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
            V L+DLR+ +  +  + GH DAVT+L+F              N + +WDL+
Sbjct: 588 IVRLWDLRSGR-VVRTLEGHSDAVTSLQFDS---LNLVTGSLDNSIRIWDLR 635

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 134 VATINGQGTVFLYS-RSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSG 192
           +AT    G V L+  RS  +  TL+ H D   +L F  L   +L++GS D+S+ +WD+  
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSL---NLVTGSLDNSIRIWDLRT 636

Query: 193 GS 194
           G+
Sbjct: 637 GT 638

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 72/170 (42%), Gaps = 24/170 (14%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           ++S S D +  +WD+     S+  ++T    H   V D ++   +  LF +   D  +++
Sbjct: 259 IISSSIDTTCIVWDL----QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 236 NDIRA-------------------ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH- 275
            D+R+                    +TT   +K       L  S +  N+LA    +S+ 
Sbjct: 315 FDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNK 374

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           + + D+RN + P+ ++ GH  +V  +++ P             +++ WDL
Sbjct: 375 IIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 66/163 (40%), Gaps = 24/163 (14%)

Query: 150 DGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSD 209
           DGL  T  FH +  +        K   ++G     + LWD +G S   + + +W    +D
Sbjct: 164 DGLLKT--FHGEYAFQSIDHHRTKSTFVTGG--AQIELWD-TGRSKPVSNL-SWG---AD 214

Query: 210 IVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN-------TTIDTAKCPQPFNTLAFSHH 262
            V   K++    D+  +   D+ + + D+R  +       T    A C  P     F   
Sbjct: 215 NVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNF--- 271

Query: 263 SSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
                  A  D + Y YD+RNM   L+    H  AV +++FSP
Sbjct: 272 -----VIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSP 309

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 85/192 (44%), Gaps = 10/192 (5%)

Query: 117 HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNGYALSFSPLIKGH 175
           H E I    +   D   V T +    + +++ S+G Q  TL  H  +  +  + P + G 
Sbjct: 169 HTECIRDIAFSKNDSKFV-TCSDDNILKIWNFSNGKQERTLSGHHWDVKSCDWHPEM-GL 226

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           ++S S D+ + LWD   G   +T +          V  +K+     +L   +S+D   ++
Sbjct: 227 IVSASKDNLIKLWDPRSGQCVSTLLN-----FKHTVLKTKFQPTKGNLLAAISKDKSCRV 281

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYD-LRNMKEPLHHM-SG 293
            DIR     +   +    + TL +   + ++   A  D  +  +D L+N++EP   +   
Sbjct: 282 FDIRYHMKELTVIRDEVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEPQQVIPYA 341

Query: 294 HEDAVTNLEFSP 305
           H+  +T+L ++P
Sbjct: 342 HDKCITSLSYNP 353

>Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {ON}
           YMR146C (REAL)
          Length = 347

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 86/211 (40%), Gaps = 22/211 (10%)

Query: 109 IRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSF 168
           I++T    HE  +T+ +Y  +   + +          YS +     TL  H    +++  
Sbjct: 4   IKLTG---HERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDV 60

Query: 169 SPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDD-LHSDIVNDSKWHNFNKDLFGTV 227
               K + ++GS D+S+ LWDVS G      I TW   +    V  S   N+   +   V
Sbjct: 61  DRFTK-YCVTGSADYSIKLWDVSNGQ----CIATWKSPVPVKRVEFSPCGNYFLAILDNV 115

Query: 228 SED-SLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAG------------MDS 274
            ++   + I +I  ++ T +  K  +       +H   +    AG             D 
Sbjct: 116 MKNPGSINIYEIERDSATHELTKVSEEPIHQIITHEGLDAATVAGWSTEGKYIVAGHKDG 175

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            V  YD+ N  E +  +  HE ++++++FSP
Sbjct: 176 KVSKYDVTNNYEYMDSIDLHEKSISDMQFSP 206

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 81/183 (44%), Gaps = 22/183 (12%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           L+S S D +  +WD+     S+  ++T    H   V D ++   +  LF +   D  +++
Sbjct: 296 LISSSIDTTCIVWDL----QSSNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRV 351

Query: 236 NDIR--AENTTI--------DTAKCPQPFNTLAF---SHHSSNILAAAGMDSH-VYLYDL 281
            D+R  A +T I          A   Q  N L     S   +N++A    +S+ + + D+
Sbjct: 352 FDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDM 411

Query: 282 RNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQT----PDDA 337
           RN + P+  + GH+ A+  +++ P             +++ WDL    +  T     ++A
Sbjct: 412 RNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNSTFSGNTVASPSNNA 471

Query: 338 EDG 340
           E+G
Sbjct: 472 ENG 474

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 71/170 (41%), Gaps = 24/170 (14%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           ++S S D +  +WD+     S+  ++T    H   V D ++   +  LF +   D  +++
Sbjct: 259 IISSSIDTTCIVWDL----QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 236 NDIRA-------------------ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH- 275
            D+R+                     T   ++K       L  S +  N+LA    DS+ 
Sbjct: 315 FDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNK 374

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           + + D+RN + P+ ++ GH  +V  +++ P             +++ WDL
Sbjct: 375 IIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 55/287 (19%), Positives = 108/287 (37%), Gaps = 59/287 (20%)

Query: 19  SNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGEEENYLKFAEI 78
           SN  L ++ V +  + +P   +QW+P+ +   K       L I +  S EE  + +  +I
Sbjct: 160 SNDLLSWESVVDADVVYPVSKIQWVPSQLYPRKLATCSDSLRIWS-VSPEERQFQE--QI 216

Query: 79  NLPKEVLNNENPQEQAEMGDE---ASLPPPRS--------NIRITAKYE----------- 116
           NL     N ++P   A   D     + PP  S        N+ I++  +           
Sbjct: 217 NLSLCKYNRQHPANPAAADDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSS 276

Query: 117 ---------HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHK-----DN 162
                    H+ E+   R++ +   + A+  G G+V ++       ST+ +         
Sbjct: 277 HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSG 336

Query: 163 GYALSFSPLIKG--------------HLLS--GSDDHSVALWDVSGGSDSTTPIRTWDDL 206
             A + +P  KG              ++L+   +D + + + D+    +  +PI      
Sbjct: 337 ATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDM---RNPESPILNLQG- 392

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQP 253
           H   VN  KWH   +++  +  +D  +   D+ +    I+ A    P
Sbjct: 393 HGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSFMEINAAGSKSP 439

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 85/198 (42%), Gaps = 22/198 (11%)

Query: 162 NGYALSFSPLIK--GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWHN 218
           N +   F PL K  G LLS S+   +   D  G   S   IR  +   +D+ + +S +H 
Sbjct: 17  NNWCFKFQPLDKANGLLLSLSNGE-IHCLDF-GTCQSKQSIRVSNLSINDLKILNSDFHC 74

Query: 219 FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQ--PFNTLAFSHHSSNILAAA----GM 272
               LF T + +S+ KI DI + N  I T    +  PF +L   H    +LA      G+
Sbjct: 75  --GSLFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRH---GLLAMGTELQGV 128

Query: 273 DSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
           D+ + +YD+R    PL  +   H D VT L+F P                ++DL Q    
Sbjct: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ---- 184

Query: 332 QTPDDAEDGVPELIMVHA 349
           Q  DDA   V     +H+
Sbjct: 185 QDEDDALHQVMNYASIHS 202

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 98/232 (42%), Gaps = 42/232 (18%)

Query: 155 TLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDS 214
           T + H D   ALS  P     L+SGS D ++  WD+  G      ++T D   ++++  +
Sbjct: 491 TFEAHIDEVTALSLDP---NFLVSGSQDRTIRQWDLCSGK----CMQTIDLSFANVLTTA 543

Query: 215 KWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS 274
                N DL    S+ +LL     R+E  TI      Q F+           LA    D 
Sbjct: 544 T----NVDL----SKSTLLT---QRSERPTIGAL---QSFDA---------ALATGTKDG 580

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLK-----QI 328
            V L+DLR+ K  +  + GH DA+T+L+F              +R + +WDL+     + 
Sbjct: 581 IVRLWDLRSGK-VIRTLEGHTDAITSLKFDS----ACLVTGSYDRTVRVWDLRTGLLSKF 635

Query: 329 GAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPW-LIASTEEENILQV 379
            A   P  + D   +   V   + ++++ +D N    W  +   +E N+  V
Sbjct: 636 HAYNAPVLSLDFFQDNAAVVVSNATSIHIYDSNKDESWPCVEKGDEVNVTAV 687

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 100/243 (41%), Gaps = 30/243 (12%)

Query: 101 SLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLK-FH 159
           +L  P SN      ++H   IT   + PQ P+++AT     ++  Y  +  L+S  + F+
Sbjct: 97  NLAKPSSNAIEHVLHKHFRAITDINFSPQHPDILATC----SIDTYVHAWDLRSPQRPFY 152

Query: 160 KDNGYALSFSPLIK-----GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDS 214
             +G+ LS +  +K      ++L+ +  + V +WD+  GS   TP+      H   VN  
Sbjct: 153 TTSGW-LSGASQVKWSFNDQNVLASAHGNDVCIWDLRKGS---TPLGKLVG-HGSSVNSV 207

Query: 215 KWHNFNKDLFGTVSEDSLLKINDI-RAENTTIDTAKCPQPF---NTLAFSHHSSNILAAA 270
            ++ F +    T S D  +K  D  ++ N  I T +   P      L F      + +  
Sbjct: 208 DFNRFKRTELMTGSNDGSVKFWDYSKSCNEPIKTIRTDFPIWRGRYLPFGEGCCLMPSVG 267

Query: 271 GMDSHVYLYDLRNMK----------EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
           G +S VY+  L              +P++   GH+D VT+  +               +L
Sbjct: 268 GFNS-VYVASLAKRDGVEEVNDSKLQPIYAFKGHDDRVTDFVWRSRSSCGSDGCDREFQL 326

Query: 321 IMW 323
           + W
Sbjct: 327 VTW 329

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + FS    +ILA   +D++V+ +DLR+ + P +  SG     + +++S            
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDLRSPQRPFYTTSGWLSGASQVKWS-FNDQNVLASAH 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            N + +WDL++     TP      + +L+    GH S+VN  D N      + +   +  
Sbjct: 179 GNDVCIWDLRK---GSTP------LGKLV----GHGSSVNSVDFNRFKRTELMTGSNDGS 225

Query: 377 LQVWKCSHSL 386
           ++ W  S S 
Sbjct: 226 VKFWDYSKSC 235

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 106/265 (40%), Gaps = 50/265 (18%)

Query: 128 PQDPNMVATINGQGTVFLYSRSDGLQS-TLKFHKDNGYALSFSPLIKGHLLSGSDDHSVA 186
           P +   +AT +  GT+ ++  +  + + TL  H  +   + +    +  L SGS D +V 
Sbjct: 242 PGERPRLATSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWGG--QNFLYSGSHDKTVR 299

Query: 187 LWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN--DIRAENTT 244
           +WD+         ++          N + W N       ++S D  L++   D   E   
Sbjct: 300 VWDMKNSGRCINILK----------NHAHWVNHL-----SLSTDYALRVGPFDYTGEQPA 344

Query: 245 ---IDTAKCPQPFNTLAFSH-HSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
              I  AK  + +  +A  +   + ++  A  D  ++L+D     +P+  M+GH+  V +
Sbjct: 345 TPEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNH 404

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           + FSP            N + +W            D+ DG  + I    GH ++V     
Sbjct: 405 VAFSP-DGRHIVSASFDNSIKLW------------DSRDG--KFITTFRGHVASV----- 444

Query: 361 NAQVPW-----LIASTEEENILQVW 380
             QV W     L+ S  ++  L+VW
Sbjct: 445 -YQVAWSSDCRLLVSCSKDTTLKVW 468

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 21/140 (15%)

Query: 120 EITRARYMPQDPNMVATINGQGTVFLYSRSDG--------LQSTLKFHKDNGYA-----L 166
           EI +A+ + ++   VA  NG+ T  + + SD         L++T    +  G+      +
Sbjct: 347 EIAKAKAL-KNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHV 405

Query: 167 SFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGT 226
           +FSP  + H++S S D+S+ LWD   G   TT  R     H   V    W + +  L  +
Sbjct: 406 AFSPDGR-HIVSASFDNSIKLWDSRDGKFITT-FRG----HVASVYQVAWSS-DCRLLVS 458

Query: 227 VSEDSLLKINDIRAENTTID 246
            S+D+ LK+ DIR    ++D
Sbjct: 459 CSKDTTLKVWDIRTRKLSVD 478

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 88/192 (45%), Gaps = 10/192 (5%)

Query: 117 HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNGYALSFSPLIKGH 175
           H E I    +   D   V T +    + +++ S+G Q   L  H  +  +  + P + G 
Sbjct: 164 HTECIRDVAFSGNDSKFV-TCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPEM-GL 221

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           + S S D+ V LWD   G   +T ++         V  +++     +L   +S+D   ++
Sbjct: 222 IASASKDNLVKLWDPRVGQCISTILK-----FKHTVLKTRFQPTGGNLLAAISKDKSCRV 276

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYD-LRNMKEPLHHMS-G 293
            DIR     +   +    + TL ++  + ++L  A  D  +  +D ++++K+P+H +   
Sbjct: 277 FDIRHSLKELMVVRDEVDYMTLLWNPINESMLTVACYDGSLKDFDVVQDLKKPVHTIPYA 336

Query: 294 HEDAVTNLEFSP 305
           H+  +T+L ++P
Sbjct: 337 HDKCITSLSYNP 348

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 87/194 (44%), Gaps = 23/194 (11%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
            ++  P+      +GS+D ++ +WD + G    T       +   +V  SK H +   +F
Sbjct: 113 CIAMDPVDNEWFATGSNDSTIKVWDFASGKLKLTLSGHVMGVRDLVV--SKRHPY---MF 167

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM 284
            + SED L+K  D+       D        +T+   H + +++A+AG DS V L+D+R+ 
Sbjct: 168 -SASEDKLVKCWDLEKNAPIRDYFGHLSGVHTVDI-HPTLSLIASAGRDSVVKLWDIRS- 224

Query: 285 KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPEL 344
           K+ +  + GH+  + +++ +P              +I WDL  + A+          P  
Sbjct: 225 KKAVITLVGHKSPINSVKCTP-ADPQIISCSNDTTVITWDL--VAAK----------PMK 271

Query: 345 IMVHAGHRSAVNDF 358
           ++ H  HR AV D 
Sbjct: 272 VITH--HRKAVRDI 283

>KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]
           {ON} similar to uniprot|Q12417 Saccharomyces cerevisiae
           YPL151C PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 434

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 64/141 (45%), Gaps = 8/141 (5%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
            +   P+      +GS+D ++ +WD++ G    T I      H   V D      +  +F
Sbjct: 127 CVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIG-----HVMSVRDIAISKRHPYMF 181

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM 284
            + SED L+K  D+       D        +T+   H S +I+A AG D+ V L+D+R+ 
Sbjct: 182 -SASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDV-HPSLDIIATAGRDAVVRLWDIRSR 239

Query: 285 KEPLHHMSGHEDAVTNLEFSP 305
            E +  + GH+  +  ++  P
Sbjct: 240 SE-IMVLPGHKSPINKVKCLP 259

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 70/159 (44%), Gaps = 17/159 (10%)

Query: 128 PQDPNMVATINGQGTVFLYSRSDG-LQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVA 186
           P D    AT +   T+ ++  + G L+ TL  H  +   ++ S     ++ S S+D  V 
Sbjct: 132 PVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKR-HPYMFSASEDKLVK 190

Query: 187 LWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNK----DLFGTVSEDSLLKINDIRAEN 242
            WD+    +  T IR   D H  +   S  H  +     D+  T   D+++++ DIR+ +
Sbjct: 191 CWDL----ERNTAIR---DFHGHL---SGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRS 240

Query: 243 TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDL 281
             +       P N +        I++ +G D+ V L+D+
Sbjct: 241 EIMVLPGHKSPINKVKCLPVDPQIISCSG-DATVRLWDI 278

>TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON}
           Anc_4.309 YLR429W
          Length = 595

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 43/82 (52%), Gaps = 8/82 (9%)

Query: 160 KDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF 219
           K  G+ L + PL K  L S S D+S+ +W V  G D  T       LH D+V  S   +F
Sbjct: 145 KRVGHVL-YHPLAKDVLASSSFDNSIKIWRVDTGEDLITL------LHPDLVT-SMCFSF 196

Query: 220 NKDLFGTVSEDSLLKINDIRAE 241
           +     TV+ D +++I DIRA+
Sbjct: 197 DGSYLVTVARDRMIRIWDIRAQ 218

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 61/144 (42%), Gaps = 20/144 (13%)

Query: 168 FSPLIKGHLLSGSDDHSVALWD------------VSGG----SDSTTPIRTWDDLHSDIV 211
           F P     + S SDD  V +W+            +SGG    S + TP++     HS  V
Sbjct: 89  FDPFNDHRIASASDDGKVGIWEIPKRYSFGRYRSISGGGFKLSKNITPLKMLVG-HSKRV 147

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAG 271
               +H   KD+  + S D+ +KI  +      I T   P    ++ FS   S ++  A 
Sbjct: 148 GHVLYHPLAKDVLASSSFDNSIKIWRVDTGEDLI-TLLHPDLVTSMCFSFDGSYLVTVA- 205

Query: 272 MDSHVYLYDLRNMKEPLHHMSGHE 295
            D  + ++D+R  K  + H  GHE
Sbjct: 206 RDRMIRIWDIRAQK-IISHSLGHE 228

>AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR429W
           (CRN1); 1-intron
          Length = 633

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 12/128 (9%)

Query: 163 GYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKD 222
           G+ L + P  +G L S S DH+V LW+V  G   T PI      H D+V  S   ++   
Sbjct: 144 GHVL-YHPTAQGVLASSSLDHTVRLWNVEQG---TNPIVL---THPDMVT-SMSFSYGGT 195

Query: 223 LFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGM----DSHVYL 278
              TV  D +L++ DIR      +      P N       +S+ LA  G     D  + +
Sbjct: 196 YLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKNQRVVWLGNSDRLATTGFSKLSDRQIAV 255

Query: 279 YDLRNMKE 286
           +D  N+++
Sbjct: 256 WDAFNLEK 263

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 92/203 (45%), Gaps = 12/203 (5%)

Query: 108 NIRITAKYE--HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDG-LQSTLKFHKDNGY 164
           N  +  ++E  H E I    +   D   V T +    + +++ S+G ++ TL  H  +  
Sbjct: 162 NFNMVKEFENAHTECIRDISFSNNDSKFV-TCSDDNVLKIWNFSNGQVERTLSGHHWDIK 220

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
           +  + P + G ++S S D+ V LWD   G   +T I+         V  +++     +L 
Sbjct: 221 SCDWHPEM-GLIVSASKDNLVKLWDPRSGQCISTIIK-----FKHTVLKTRFQPTRGNLL 274

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYD-LRN 283
             +S+D   ++ DIR     +   +    + TL ++  + ++      D  +  +D L++
Sbjct: 275 AAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQD 334

Query: 284 MKEPLHHMS-GHEDAVTNLEFSP 305
           ++ P H +   H+  VT++ ++P
Sbjct: 335 LEGPSHVIPYAHDKCVTSMAYNP 357

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 88/205 (42%), Gaps = 23/205 (11%)

Query: 158 FHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKW 216
           F     + L   P  K  LL+G  +  + L D +    S   I+  +   +D+ V DS +
Sbjct: 11  FFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWAT-CKSLQNIKASETAINDLKVIDSDF 69

Query: 217 HNFNKDLFGTVSEDSLLKINDIRAENTTIDTAK--CPQPFNTLAFSHHSSNILAAA---- 270
              +  L  + S D++ K+ DIR  N+ I T +     PF +L   H    +LA      
Sbjct: 70  SAGH--LVSSASIDAV-KVFDIRT-NSCIATIQNESNSPFLSLDSRH---GLLACGTELQ 122

Query: 271 GMDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG 329
           G+D+ V++YD+R    PL  +   H D VT ++F P                ++DLKQ  
Sbjct: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-- 180

Query: 330 AEQTPDDAEDGVPELIMVHAGHRSA 354
                D+ ED + ++I   + H   
Sbjct: 181 -----DEEEDALHQVINYASIHSCG 200

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 89/219 (40%), Gaps = 45/219 (20%)

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           +G L SGS D +V +WD++          T     S + N + W N       ++S D  
Sbjct: 291 EGLLYSGSHDKTVRVWDMNSA--------TVGKCISILKNHAHWVNHL-----SLSTDYA 337

Query: 233 LKIN-----DIRAENTTIDTAKCPQPFNTLAFSHHSSN-ILAAAGMDSHVYLYDLRNMKE 286
           L+I       ++         +    ++ +A  + S+  ++  A  D  ++L++ + + +
Sbjct: 338 LRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTK 397

Query: 287 PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIM 346
           PL  M+GH+  V ++ FSP            N + +W            D  DG  + + 
Sbjct: 398 PLARMTGHQKLVNHVAFSPD-GRYIVSASFDNSIKLW------------DGRDG--KFLS 442

Query: 347 VHAGHRSAVNDFDLNAQVPW-----LIASTEEENILQVW 380
              GH ++V       QV W     L+ S  ++  L+VW
Sbjct: 443 TFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 475

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 64/143 (44%), Gaps = 27/143 (18%)

Query: 248 AKCPQPFNTLAFSHHS-SNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
           AK  +P  T    HH  +N+LA    D  V ++DL + K  L +++GH  A+T L+F   
Sbjct: 101 AKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYS-KTVLCNLNGHSSAITALKFDTS 159

Query: 307 XXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNA---- 362
                      N +I+WDL           +E G+ +L      H+ A+     N     
Sbjct: 160 GTRLISGSRDSN-IIVWDLV----------SEVGLYKL----RSHKDAITGIWCNEVTNN 204

Query: 363 -----QVPWLIASTEEENILQVW 380
                ++ WLI ST ++ ++++W
Sbjct: 205 NQEENELDWLI-STSKDGLIKIW 226

>KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {ON}
           Anc_8.631 YOR212W
          Length = 423

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 68/153 (44%), Gaps = 9/153 (5%)

Query: 135 ATINGQGTVFLYSRSDGLQSTLK--FHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSG 192
           A ++   TV+  S+ + +Q  +   F    GY  S   L +  +LS S D + ALWD+  
Sbjct: 153 AGLDNNCTVYKISKENRIQQNVITIFKGHTGYISSIDFLDERQILSASGDMTCALWDIPK 212

Query: 193 GSDSTTPIRTWDDLHSDIVNDSKWHNFNKD--LFGTVSEDSLLKINDIRAENTTIDTAKC 250
                  IR + D   D++  +  HN N +  +F +   D  L I D R+          
Sbjct: 213 AK----RIREYTDHLGDVLALALPHNDNANGKIFASCGSDGYLYIWDTRSPANAQSFFIS 268

Query: 251 PQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
               ++L F    ++I+A +  +  + ++DLR+
Sbjct: 269 SSDASSLQFFRDDNSIIAGSE-NGTISMFDLRS 300

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 107/265 (40%), Gaps = 50/265 (18%)

Query: 128 PQDPNMVATINGQGTVFLYSRSDGLQ-STLKFHKDNGYALSFSPLIKGHLLSGSDDHSVA 186
           P D   +A+ +  GT+ ++  S  +   TL  H ++   + +    +G L SGS D +V 
Sbjct: 245 PGDKPRLASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWGG--QGLLYSGSHDKTVR 302

Query: 187 LWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTID 246
           +WD++ G      +++    H+  VN             ++S +  L++       T   
Sbjct: 303 VWDMNVGGKCINILKS----HAHWVNHL-----------SLSTEYALRVGPFDHTATKFT 347

Query: 247 TA-----KCPQPFNTLAFSH-HSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           +A     K  + +  +A  +  +  ++  A  D  ++L+D     +PL  ++GH+  V +
Sbjct: 348 SAEEARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNH 407

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           + FSP            N + +W            D  +G    I    GH ++V     
Sbjct: 408 VAFSP-DGRFIVSASFDNSIKLW------------DGRNGT--FISTFRGHVASV----- 447

Query: 361 NAQVPW-----LIASTEEENILQVW 380
             QV W     L+ S  ++  L+VW
Sbjct: 448 -YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 77/166 (46%), Gaps = 12/166 (7%)

Query: 116 EHEEEITRARYMPQDPNMVATINGQGTVFLY--SRSDGLQSTLKFHKDNGYALSFSPLIK 173
           E+ E+I  A+   +   ++ T +   T+FL+  ++S    + L  H+     ++FSP  +
Sbjct: 358 ENYEKI--AKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGR 415

Query: 174 GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
             ++S S D+S+ LWD   G    T I T+   H   V    W + +  L  + S+D+ L
Sbjct: 416 -FIVSASFDNSIKLWDGRNG----TFISTFRG-HVASVYQVAWSS-DCRLLVSCSKDTTL 468

Query: 234 KINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
           K+ D+R    ++D         T+ +S     +  + G D  V L+
Sbjct: 469 KVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRV-CSGGKDKMVRLW 513

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 74/184 (40%), Gaps = 50/184 (27%)

Query: 132 NMVATINGQGTVFLYSRSDGLQS------------TLKFHKDNGYALSFSPLIKGHLLSG 179
           NMV +     TV L++   G++S            T   H D   A+S       +L+SG
Sbjct: 421 NMVISAGKDATVKLWNVDLGIESFNTERYFNPCIYTFDSHTDEITAIS---SYHENLVSG 477

Query: 180 SDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239
           S D ++  WD+  G                I+N   + N  K+L GTV            
Sbjct: 478 SRDKTIRQWDLKTGK------------CIQILNIG-FLNSQKELLGTV------------ 512

Query: 240 AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVT 299
                 D  + P P   L     +   LA  G D  V L+DLR + + +  +SGHE+A+T
Sbjct: 513 ------DPIRSPPPIGALQCRDAA---LATGGQDGIVRLWDLR-IGKVVRSLSGHENAIT 562

Query: 300 NLEF 303
            L+F
Sbjct: 563 ALKF 566

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 62/134 (46%), Gaps = 7/134 (5%)

Query: 174 GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           G ++SGS D+ V  WD   G   +T +          V  +++     +    +S+D   
Sbjct: 222 GLIVSGSKDNLVKFWDPRSGQCVSTILN-----FKHTVLRTRFQPTRGNYLLGISKDKSC 276

Query: 234 KINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYD-LRNMKEPLHHMS 292
           ++ DIR     + T +    F TL++   + ++   A  D  +  +D L ++++P+H + 
Sbjct: 277 RVFDIRNHTKELLTVRDEVDFMTLSWHPINESVFTLANYDGSIKHFDILEDLEKPIHTIP 336

Query: 293 -GHEDAVTNLEFSP 305
             HE  +T + ++P
Sbjct: 337 FAHEKCITAMSYNP 350

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 49/248 (19%), Positives = 85/248 (34%), Gaps = 31/248 (12%)

Query: 117 HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHL 176
           H  ++    + P+   +V+        F   RS    ST+   K       F P    +L
Sbjct: 208 HHWDVKSCDWHPEMGLIVSGSKDNLVKFWDPRSGQCVSTILNFKHTVLRTRFQPTRGNYL 267

Query: 177 LSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236
           L  S D S  ++D+   +     +R   D  +       WH  N+ +F   + D  +K  
Sbjct: 268 LGISKDKSCRVFDIRNHTKELLTVRDEVDFMT-----LSWHPINESVFTLANYDGSIKHF 322

Query: 237 DIRAENTTIDTAKCPQPFNTLAFSHHSS----------NILAAAGMDSHVYLYDLRNMKE 286
           DI  +          +P +T+ F+H             +ILA+A  D  +  +      +
Sbjct: 323 DILED--------LEKPIHTIPFAHEKCITAMSYNPIGHILASASKDRTIRFWTRSKPID 374

Query: 287 PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIM 346
           P    +G +D   N     H           N   + +  + GA   P +  D +P    
Sbjct: 375 P----NGFDDPTYN----NHKINGWFYGINNNINAVREKTEFGAAPPPAEGADAIPSTST 426

Query: 347 VHAGHRSA 354
            +A   S 
Sbjct: 427 ANAASGST 434

>YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON}
           TIF34eIF3i subunit of the core complex of translation
           initiation factor 3 (eIF3), which is essential for
           translation; stimulates rate of ribosomal scanning
           during translation reinitiation
          Length = 347

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 86/211 (40%), Gaps = 22/211 (10%)

Query: 109 IRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSF 168
           I++T    HE  +T+ +Y  +   + +          YS +     TL  H    +++  
Sbjct: 4   IKLTG---HERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDV 60

Query: 169 SPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDD-LHSDIVNDSKWHNFNKDLFGTV 227
               K + ++GS D+S+ LWDVS G      + TW   +    V  S   N+   +   V
Sbjct: 61  DCFTK-YCVTGSADYSIKLWDVSNGQ----CVATWKSPVPVKRVEFSPCGNYFLAILDNV 115

Query: 228 SED-SLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAG------------MDS 274
            ++   + I +I  ++ T +  K  +       +H   +    AG             D 
Sbjct: 116 MKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDG 175

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            +  YD+ N  E +  +  HE ++++++FSP
Sbjct: 176 KISKYDVSNNYEYVDSIDLHEKSISDMQFSP 206

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
            ++  P+     ++GS+D ++ +WD++ G    T        H+  V D      +  +F
Sbjct: 91  CVAVEPVDNEWFVTGSNDTTLKVWDLASGKLKLTL-----SGHTMGVRDVAVSERHPYMF 145

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM 284
            + SED L+K  D+       D        +T+   H + +++A  G D+ V L+D+R  
Sbjct: 146 -SASEDKLVKCWDLEKNTAIRDYYGHLSGVHTVDI-HPTLDLIATGGRDAVVKLWDIRTR 203

Query: 285 KEPLHHMSGHEDAVTNLEFSP 305
           K  +  + GH+  +T ++ +P
Sbjct: 204 K-AVKTLVGHKAPITKVKCTP 223

>Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {ON}
           complement(63130..64962) [1833 nt, 611 aa]
          Length = 610

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 11/135 (8%)

Query: 156 LKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSK 215
           L  HK     + +SP+ +  L S S D++V +W+V  G D  T        H D+V  S 
Sbjct: 136 LTGHKKKVGHVLYSPVAQNILASSSLDYTVKIWNVETGKDEITL------KHPDMVT-SM 188

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGM--- 272
             +++ +   TVS D  L++ D+R      + A      N       + N LA  G    
Sbjct: 189 SFSYDGNHLATVSRDKKLRVWDVRKGTVVSEGAAHTGAKNQRVVWLGNCNRLATTGFSRL 248

Query: 273 -DSHVYLYDLRNMKE 286
            D  + ++D  N+++
Sbjct: 249 SDRQIGIWDAFNLEK 263

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query: 98  DEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLK 157
           DE + P   S ++I     H++++    Y P   N++A+ +   TV +++   G      
Sbjct: 122 DEDNQPKDISPVKILTG--HKKKVGHVLYSPVAQNILASSSLDYTVKIWNVETGKDEITL 179

Query: 158 FHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGS 194
            H D   ++SFS     HL + S D  + +WDV  G+
Sbjct: 180 KHPDMVTSMSFS-YDGNHLATVSRDKKLRVWDVRKGT 215

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDV------------SGGSDSTTPIRTWDDLHSDIVNDSK 215
           F P  +  ++S +DD  +A+WD+                   +P++     H   V    
Sbjct: 89  FDPFNERRIVSCADDSKIAVWDIPENYSFHHYLDEDNQPKDISPVKILTG-HKKKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
           +    +++  + S D  +KI ++      I T K P    +++FS +  N LA    D  
Sbjct: 148 YSPVAQNILASSSLDYTVKIWNVETGKDEI-TLKHPDMVTSMSFS-YDGNHLATVSRDKK 205

Query: 276 VYLYDLR 282
           + ++D+R
Sbjct: 206 LRVWDVR 212

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 10/146 (6%)

Query: 162 NGYALSFSP--LIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF 219
           NG+     P  +      +GS+D ++ +WD++ G    T       + S  V+       
Sbjct: 121 NGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQ------ 174

Query: 220 NKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
              L  + SED ++K  D+       D        NT+   H + +++A+AG D+ V L+
Sbjct: 175 RHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDV-HPTLDLIASAGRDAVVRLW 233

Query: 280 DLRNMKEPLHHMSGHEDAVTNLEFSP 305
           D+R  + P+  ++GH+  +  ++  P
Sbjct: 234 DIRT-RLPVMTLAGHKSPINQVKCFP 258

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 72/334 (21%), Positives = 130/334 (38%), Gaps = 62/334 (18%)

Query: 19  SNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHTSGEEENYLKFAEI 78
           SN  L ++ V+E  +T+P   +QWLP+     K     + L I +      +N       
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPSVPNPRKLATSSECLRIWSLDDNSMDN------- 242

Query: 79  NLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATIN 138
                V NN           + SL   + N+ +  KY  + +I          N   +++
Sbjct: 243 ---SSVFNNNISNNSRHNTYKKSL-TEQVNLSL-CKYNEQHQIIN--------NSTNSVS 289

Query: 139 GQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTT 198
            +    L  +   L     FH        ++ +    L+S S D +  +WD+     S+ 
Sbjct: 290 NKSNARLLGQ---LPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDL----QSSN 334

Query: 199 PIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA-ENTTI--DTAKCPQPFN 255
            ++T    H   V D K+   +  LF +   D  +++ D+RA +++TI  +TA   Q  N
Sbjct: 335 YVKTQLIAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNN 394

Query: 256 TL--------------AFSHH---------SSNILAAAGMDSH-VYLYDLRNMKEPLHHM 291
           T               + SH            N++A  G+D   + + D+RN   P+  +
Sbjct: 395 TFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLVL 454

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           SGH  +V  +++ P             +++ WDL
Sbjct: 455 SGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 57/148 (38%), Gaps = 29/148 (19%)

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH-------NFNK---DLF 224
           H   G D H      V+GG+     I  WD      +++  W         FN+   DL 
Sbjct: 176 HAFQGIDHHKENTSFVTGGAQ----IELWDINRRKPLSNLSWGIDNITAVKFNQNEADLL 231

Query: 225 GTVSEDSLLKINDIRAENTT---IDTAK----CPQPFNTLAFSHHSSNILAAAGMDSHVY 277
            +   D+ + + D+R  + T   + T K    C  P     F          A  D + Y
Sbjct: 232 LSSGSDNSVVLYDLRTNSPTQKIVQTMKTNSMCWNPMEPFNF--------VTANEDQNAY 283

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            YD+RNM   LH    H  A+ +++ SP
Sbjct: 284 YYDMRNMSRALHVFKDHVSAIMDVDISP 311

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 75/183 (40%), Gaps = 17/183 (9%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H+D  Y ++ +  +   L S S D  V  W++S   +  +    +  +    V+     N
Sbjct: 66  HRDGCYVIAKNYNVLNRLASASADGVVKYWNISTREELCSFKAHYGLVTGLCVSPQHIGN 125

Query: 219 FNKDLFGTVSEDSLLKINDIRAE--NTTIDTAKCPQP----------FNTLAFS---HHS 263
            +     +  +D ++K+  + +   N   D  K   P          +   AF    HH 
Sbjct: 126 QSDSYMLSCGDDKMVKMWSVDSGDFNNVKDDTKVLHPSDGNGLIKTFYGEHAFQGIDHHK 185

Query: 264 SNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMW 323
            N     G  + + L+D+ N ++PL ++S   D +T ++F+ +           N ++++
Sbjct: 186 ENTSFVTG-GAQIELWDI-NRRKPLSNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLY 243

Query: 324 DLK 326
           DL+
Sbjct: 244 DLR 246

>ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some
           similarities with uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 684

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 11/117 (9%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTV 227
           F+P++K  L S S D ++ +W++  G D  T        H ++V  S   +++ +   TV
Sbjct: 149 FNPVVKDVLASSSLDRTIKIWNIETGKDEITLT------HPEMVT-SMSFSYDGNYLATV 201

Query: 228 SEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGM----DSHVYLYD 280
           + D  L++ DIRA+    +        +       +SN LA +G     +  V L+D
Sbjct: 202 ARDRKLRVWDIRAQKIVSECKAHEGAKSQRVVWLGNSNRLATSGFSRLSERQVALWD 258

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 106/268 (39%), Gaps = 56/268 (20%)

Query: 128 PQDPNMVATINGQGTVFLY-SRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVA 186
           P     +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D +V 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVR 302

Query: 187 LWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTID 246
           +WD++        +++    H+  VN             ++S D  L+I    A + T  
Sbjct: 303 VWDINSQGRCINILKS----HAHWVNHL-----------SLSTDYALRIG---AFDHTGK 344

Query: 247 TAKCPQPFNTLAFSHH---------SSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDA 297
               P+     A  ++         S  ++  A  D  ++L++     +P+  M+GH+  
Sbjct: 345 KPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKL 404

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVND 357
           V ++ FSP            N + +W            D  DG  + I    GH ++V  
Sbjct: 405 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV-- 447

Query: 358 FDLNAQVPW-----LIASTEEENILQVW 380
                QV W     L+ S  ++  L+VW
Sbjct: 448 ----YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 70/152 (46%), Gaps = 16/152 (10%)

Query: 133 MVATINGQGTVFLYSRSDGLQSTLKFHKDNGYA-----LSFSPLIKGHLLSGSDDHSVAL 187
           M+ T +   T+FL+   + L+ST    +  G+      ++FSP  + +++S S D+S+ L
Sbjct: 373 MMVTASDDYTMFLW---NPLKSTKPIARMTGHQKLVNHVAFSPDGR-YIVSASFDNSIKL 428

Query: 188 WDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDT 247
           WD   G   +T  R     H   V    W +  + L  + S+D+ LK+ D+R    ++D 
Sbjct: 429 WDGRDGKFIST-FRG----HVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDL 482

Query: 248 AKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
                   T+ +S     +  + G D  V L+
Sbjct: 483 PGHKDEVYTVDWSVDGKRV-CSGGKDKMVRLW 513

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 69/147 (46%), Gaps = 9/147 (6%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H D+  +L++SP     +++ +DD  + +WDV  G    T        H+  V   ++  
Sbjct: 340 HFDSTNSLTYSP-DGSRVVTAADDGKIKVWDVVSGFCLATFTE-----HTSSVTQVQFAK 393

Query: 219 FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH-VY 277
             + LF +  + ++   + IR  N    TA     FN LA    S  ++ A  +DS  ++
Sbjct: 394 KGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVD-PSGEVVCAGSIDSFDIH 452

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           ++ ++   + L  +SGHE  V+ L FS
Sbjct: 453 VWSVQT-GQLLDTLSGHEGPVSCLSFS 478

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 96/221 (43%), Gaps = 30/221 (13%)

Query: 160 KDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF 219
           +D  + ++++ L +  +L    D S+ L+D      +  PI  + + H   V    W+  
Sbjct: 60  QDCLFDVAWNELHENQVLVAQGDGSLRLFDTK---LAQYPIAIFKE-HQKEVFSCNWNLL 115

Query: 220 NKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
           NK+ F + S D  +KI     +++ +     PQP  T+    HS NI  +          
Sbjct: 116 NKNTFVSSSWDGTVKIWSPTRKDSLLTLT--PQPLKTVNRVDHSMNIPMS---------- 163

Query: 280 DLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAED 339
           + RN  +    ++ +++ +   +FSPH           + + ++DL+Q     +P +  +
Sbjct: 164 NQRNHAD----ITRNKNCIYQAQFSPHDPNLVMCCSGNSYITIFDLRQ---PPSPTNQRN 216

Query: 340 GVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVW 380
                 + H+G  +   DF  N   P  IA+   +N++++W
Sbjct: 217 -----FLGHSGLEALTCDF--NKYRPHTIATGGVDNVIRIW 250

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 56/146 (38%), Gaps = 29/146 (19%)

Query: 177 LSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH-------NFNK---DLFGT 226
             G D H V     +GG+     I+ WD      V++  W         FN+   D+  +
Sbjct: 182 FQGIDSHRVNSTFATGGA----KIQLWDVNRVKPVSNLSWGADNITSVKFNQNETDILAS 237

Query: 227 VSEDSLLKINDIRAEN-------TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
              D+ + + D+R  +       T    A C  P     F          A  D + Y Y
Sbjct: 238 TGSDNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNF--------VIANEDHNAYYY 289

Query: 280 DLRNMKEPLHHMSGHEDAVTNLEFSP 305
           D+RN+   L+    H  AV +++FSP
Sbjct: 290 DMRNLSRSLNVFKDHVSAVMDVDFSP 315

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 63/160 (39%), Gaps = 26/160 (16%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTI-DTAKCPQPFNTLAFSHHSSN 265
           H+  + D  +H  + +L  T S D+ +   D+R        T+      + + ++   +N
Sbjct: 113 HTRAITDINFHPIHPELLATCSIDTYVHAWDMRCSQRPFYGTSDWSSGASQVKWNFKDAN 172

Query: 266 ILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           I+A++   S V+++D+R    PL+ ++G   +V N++F+ +             +  WD 
Sbjct: 173 IIASSHA-STVFIWDIRKGSVPLYRLNGSGSSVNNIDFNRNNECEIMSSYNDGTIKFWDY 231

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVP 365
                                   GH  A   F +NA  P
Sbjct: 232 ------------------------GHEPASAQFTINADFP 247

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+    ++LA   +D++V+ +D+R+   P +  S    A + ++++ +          
Sbjct: 119 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 177

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            N + +WDL++     TP          +    GH S+VN  D N      I S+  +  
Sbjct: 178 GNDIFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGT 224

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 225 VKFWDYSKS 233

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 58/131 (44%), Gaps = 19/131 (14%)

Query: 254 FNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEP---LHHMSGHEDAVTNLEFSPHXXXX 310
           FN ++ +    +++ A+     +Y+ DL +   P   LHH++  +  V ++++SPH    
Sbjct: 26  FNAVSINPSGRDVVLASRQG--LYIIDLDDPFTPPRWLHHITPWQ--VADVQWSPHPAKP 81

Query: 311 XXXXXXXN-RLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIA 369
                  N + I+W+L           A+     +  V  GH  A+ D + N Q P ++A
Sbjct: 82  YWIVSTSNQKAIIWNL-----------AKHSSNAIEFVLHGHSRAITDINFNPQHPDVLA 130

Query: 370 STEEENILQVW 380
           +   +  +  W
Sbjct: 131 TCSVDTYVHAW 141

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 122 TRARYMPQDPNMVATINGQGTVFLYSRSDGLQ--STLKFHKDNGYALSFSPLIKGHLLSG 179
           ++ ++  +DPN++A+ +G   +F++    G     +LK H  +  ++ F+      ++S 
Sbjct: 161 SQVKWNYKDPNVLASSHGND-IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSS 219

Query: 180 SDDHSVALWDVSGGS 194
           S+D +V  WD S  +
Sbjct: 220 SNDGTVKFWDYSKST 234

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 62/303 (20%), Positives = 113/303 (37%), Gaps = 80/303 (26%)

Query: 130 DPNMVATINGQGTVFLYSRSDG--LQSTLKFHKDNGYALSFSPL------IKGHLLSGSD 181
           D  ++AT +   T+ L++  +G  +  +L+ H     +L++ PL       K  L S S 
Sbjct: 196 DAEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASASK 255

Query: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAE 241
           D ++ +WD +G     T        H+  V+  +W   N  +  T S D  +++ D+ + 
Sbjct: 256 DGTIKVWDTTGRVCLYTL-----SGHTSSVSCVRWGGQN--MLYTGSHDKTIRVWDMNSN 308

Query: 242 NTTIDTAKCPQ-----------------PFN----------------------TLAFSHH 262
              I+  K                    PF+                       +  + H
Sbjct: 309 GRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKIVKKNGH 368

Query: 263 SSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIM 322
           +  ++  A  D  ++L++     +PL  M+GH+  V ++ FSP            N + +
Sbjct: 369 TEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSP-DGRHIVSASFDNSIKL 427

Query: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPW-----LIASTEEENIL 377
           W            D  DG  + I    GH ++V       QV W     L+ S  ++  L
Sbjct: 428 W------------DGRDG--KFISTFRGHVASV------YQVAWSSDCRLLVSCSKDTTL 467

Query: 378 QVW 380
           +VW
Sbjct: 468 KVW 470

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 28/175 (16%)

Query: 110 RITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYA---- 165
           +I  K  H EE            ++ T +   T+FL+   + L+ST    +  G+     
Sbjct: 361 KIVKKNGHTEE------------LMVTASDDFTMFLW---NPLKSTKPLARMTGHQKLVN 405

Query: 166 -LSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
            ++FSP  + H++S S D+S+ LWD   G   +T  R     H   V    W + +  L 
Sbjct: 406 HVAFSPDGR-HIVSASFDNSIKLWDGRDGKFIST-FRG----HVASVYQVAWSS-DCRLL 458

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
            + S+D+ LK+ D+R +  ++D         T+ +S     +  + G D  V L+
Sbjct: 459 VSCSKDTTLKVWDVRTKKLSVDLPGHQDEVFTVDWSVDGKRV-CSGGKDKMVRLW 512

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 32/199 (16%)

Query: 115 YEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKG 174
           Y   E+I    Y P+             VF         S +  H       +F+P    
Sbjct: 109 YNTTEDIITLIYTPR------------AVFKVKPVTRSSSAIAGHGSTILCSAFAPNSSS 156

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
            +++G+ D++  LWD     D+ TP+ T    HS+ V    W + + ++  T S D+ ++
Sbjct: 157 RMVTGAGDNTARLWDC----DTQTPMATLSG-HSNWVLCVAW-SPDAEVIATGSMDNTIR 210

Query: 235 I----------NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM 284
           +          + +R  +  I T+   +P + +         LA+A  D  + ++D    
Sbjct: 211 LWNGINGKPIGDSLRGHSKWI-TSLAWEPLHLVKVGQKPR--LASASKDGTIKVWDTTG- 266

Query: 285 KEPLHHMSGHEDAVTNLEF 303
           +  L+ +SGH  +V+ + +
Sbjct: 267 RVCLYTLSGHTSSVSCVRW 285

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 10/146 (6%)

Query: 162 NGY--ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF 219
           NG+   +   P+      +GS+D ++ +WD++ G    T       + S  ++       
Sbjct: 125 NGWVRCVCVDPVDNEWFATGSNDTTIKVWDLASGKLKLTLAGHVMTVRSIAISQ------ 178

Query: 220 NKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
              L  + SED L+K  D+       D        +T+   H + +++A+AG D+ V L+
Sbjct: 179 RHPLMFSASEDKLVKCWDLEKNTVVRDYHGHFSGVHTVDV-HPTLDLIASAGRDAVVRLW 237

Query: 280 DLRNMKEPLHHMSGHEDAVTNLEFSP 305
           D+R  + P+  ++GH+  +  ++  P
Sbjct: 238 DIRT-RVPVMTLAGHKGPINQVKCFP 262

>TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6.135
           YGL116W
          Length = 689

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 63/134 (47%), Gaps = 12/134 (8%)

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           HL  G DD +  +WD    ++++T +RT        +    W N    L  T S    ++
Sbjct: 346 HLSIGKDDGNTEIWD----TETSTLVRTMRSNLGVRIGSQSWLN---TLLATGSRSGEIQ 398

Query: 235 INDIRAENTTIDTAKCPQPFNTLAFSHHSSNI-LAAAGMDSHVYLYDLR-NMKEPLHHMS 292
           IND+R +N  + T +           + S  + LA+ G D+ V ++D R +M + + H  
Sbjct: 399 INDVRIKNHVVSTWE-EHSGEVCGLEYKSDGLQLASGGNDNAVIIWDTRTSMPQFIKH-- 455

Query: 293 GHEDAVTNLEFSPH 306
            H  AV  +++SP+
Sbjct: 456 NHNAAVKAIKWSPN 469

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 107/268 (39%), Gaps = 56/268 (20%)

Query: 128 PQDPNMVATINGQGTVFLY-SRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVA 186
           P     +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D +V 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVR 302

Query: 187 LWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTID 246
           +WD++        +++    H+  VN             ++S D  L++    A + T  
Sbjct: 303 VWDMNSQGRCINILKS----HAHWVNHL-----------SLSTDYALRVG---AFDHTGQ 344

Query: 247 TAKCPQPFNTLAFSHH---------SSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDA 297
               P+     A +++         S  ++  A  D  ++L++     +P+  M+GH+  
Sbjct: 345 KPTSPEDAQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKL 404

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVND 357
           V ++ FSP            N + +W            D  DG  + I    GH ++V  
Sbjct: 405 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV-- 447

Query: 358 FDLNAQVPW-----LIASTEEENILQVW 380
                QV W     L+ S  ++  L+VW
Sbjct: 448 ----YQVAWSSDCRLLVSCSKDTTLKVW 471

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 87/200 (43%), Gaps = 26/200 (13%)

Query: 117 HEEEITRARYMPQDPNMVATINGQGTV--FLYSRSDG---LQSTLKFHKDNGYALSFSPL 171
           H+ +I   ++ P+  N + +    G +  F YS+ +G   L   L  H+     + + P 
Sbjct: 217 HKGKIGAVQWHPESNNQIISCAEDGHIKNFQYSKEEGEIKLLGDLVGHERRVSDVKYHP- 275

Query: 172 IKGHLL-SGSDDHSVALWDVSGGSDSTTPIRTWDDL-----HSDIVNDSKWHNFNKDLFG 225
             G L+ S S D +  LWD S          T+ +L     H++ V    +   +  L  
Sbjct: 276 -SGKLIGSASHDMTWRLWDAS----------TYQELLLQEGHTEGVFSLSFQ-CDGSLVC 323

Query: 226 TVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMK 285
           +   D+L  I DIR+ N  +      +P  T+A+S +   + A  G D  + ++D+R   
Sbjct: 324 SGGMDTLSMIWDIRSGNKVMTLTGHSKPVYTVAWSTNGYQV-ATGGGDGLINVWDIRQRD 382

Query: 286 -EPLHHMSGHEDAVTNLEFS 304
              +  +  H + VT ++FS
Sbjct: 383 GGQVSQILAHRNIVTQVQFS 402

>Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429W
           (REAL)
          Length = 652

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 12/128 (9%)

Query: 163 GYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKD 222
           G+ L + P+ K  L S S D++V LWDV  G D  T        H D+V  S   +++ +
Sbjct: 144 GHVL-YHPVAKNVLASSSGDYTVKLWDVETGKDMITL------KHPDMVT-SMSFSYDGN 195

Query: 223 LFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGM----DSHVYL 278
              TV+ D  L++ +IR E    +        N       +S+ LA  G     D  + +
Sbjct: 196 YLATVARDKKLRVWNIRDEKIVSEGFAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGI 255

Query: 279 YDLRNMKE 286
           +D  N+++
Sbjct: 256 WDAFNLEK 263

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 65/172 (37%), Gaps = 18/172 (10%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDV------------SGGSDSTTPIRTWDDLHSDIVNDSK 215
           F P     + SGSDD  + +W++             G      P++     H+  V    
Sbjct: 89  FDPFNDHRIASGSDDSKIGIWNIPESYKFHDHVNEDGEPIDIEPVKFLTG-HARKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
           +H   K++  + S D  +K+ D+      I T K P    +++FS +  N LA    D  
Sbjct: 148 YHPVAKNVLASSSGDYTVKLWDVETGKDMI-TLKHPDMVTSMSFS-YDGNYLATVARDKK 205

Query: 276 VYLYDLRNMK---EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           + ++++R+ K   E   H       V  L  S              ++ +WD
Sbjct: 206 LRVWNIRDEKIVSEGFAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWD 257

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 88/219 (40%), Gaps = 47/219 (21%)

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           K  L SGS D +V +WD++ G      +++    H+  VN             ++S D  
Sbjct: 289 KNLLYSGSHDKTVRVWDMNLGGKCINILKS----HAHWVNHL-----------SLSTDYA 333

Query: 233 LKINDIRAENTTIDT-----AKCPQPFNTLAFSHHS-SNILAAAGMDSHVYLYDLRNMKE 286
           L++           T     AK  + +  +A  + S   ++  A  D  ++L++     +
Sbjct: 334 LRVGPFDHTGIMPATPEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTK 393

Query: 287 PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIM 346
           P+  M+GH+  V ++ FSP            N + +W            D+ DG  + I 
Sbjct: 394 PISRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DSRDG--KFIT 438

Query: 347 VHAGHRSAVNDFDLNAQVPW-----LIASTEEENILQVW 380
              GH ++V       QV W     L+AS  ++  L+VW
Sbjct: 439 TFRGHVASV------YQVAWSSDCRLLASCSKDTSLKVW 471

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 73/158 (46%), Gaps = 10/158 (6%)

Query: 124 ARYMPQDPNMVATINGQGTVFLY--SRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSD 181
           A+    D  ++ T +   T+FL+  S+S    S +  H+     ++FSP  + +++S S 
Sbjct: 364 AKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSPDGR-YIVSASF 422

Query: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAE 241
           D+S+ LWD   G   TT  R     H   V    W + +  L  + S+D+ LK+ DIR +
Sbjct: 423 DNSIKLWDSRDGKFITT-FRG----HVASVYQVAWSS-DCRLLASCSKDTSLKVWDIRTK 476

Query: 242 NTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
             ++D         T+ +S     +  + G D  V L+
Sbjct: 477 KLSVDLPGHLDEVYTVDWSVDGKRV-CSGGKDKMVRLW 513

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 2/110 (1%)

Query: 225 GTVSEDSLLKIND-IRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
           GT  E SLLKI D  ++    I +   P    T     H +++ +    D+ +  YD R 
Sbjct: 137 GTGEEHSLLKIVDNSQSPGRLIRSICIPGTTVTHTIKFHDNHMFSTCSDDNKIRFYDTRG 196

Query: 284 MKEPLHHMSG-HEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQ 332
             +PL  +   H+  +T  + SP              L +WDL+ + A Q
Sbjct: 197 DGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDLRSVIAAQ 246

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 56/123 (45%), Gaps = 10/123 (8%)

Query: 185 VALWDVSGGSDSTTPIR--TWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN 242
           + LWDV    +   P+   +W    +D +   K++    D+  +   D+ + + D+R  +
Sbjct: 201 IHLWDV----NRLKPVSNLSWG---ADNITSVKFNQSETDILASTGSDNSIVLYDLRTNS 253

Query: 243 TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
            T    +  +  N + ++   +     A  D + Y YD+RN+   L+    H  AV +++
Sbjct: 254 PTQKIVQTMRT-NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 303 FSP 305
           FSP
Sbjct: 313 FSP 315

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 35/189 (18%), Positives = 79/189 (41%), Gaps = 25/189 (13%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H+D  YA++ +      L +GS D  +  W++S   +  +    +  +    V   ++H+
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPRFHD 125

Query: 219 -----FNKDLFGTVSEDSLLKINDIRA----------------ENTTIDTAKCPQPFNTL 257
                 N++   + S+D  +K+  I                  E   + T      F  +
Sbjct: 126 KKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAFQGI 185

Query: 258 AFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXX 317
             SH  ++  A  G  + ++L+D+  +K P+ ++S   D +T+++F+             
Sbjct: 186 D-SHRENSTFATGG--AKIHLWDVNRLK-PVSNLSWGADNITSVKFNQSETDILASTGSD 241

Query: 318 NRLIMWDLK 326
           N ++++DL+
Sbjct: 242 NSIVLYDLR 250

>TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON} 
          Length = 384

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 49/124 (39%), Gaps = 3/124 (2%)

Query: 204 DDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHH- 262
           + +H   +    W N +   F +  ED ++K+     E      +         A  +H 
Sbjct: 137 NSIHRGKITGLDW-NVDGKSFASGGEDGIVKLFSFENEKIQESNSIEAHEARITAVKYHG 195

Query: 263 SSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIM 322
            +++LA +  DS   L+DL  M E      GH   + NL+F P            N  ++
Sbjct: 196 CASLLATSSFDSTWKLWDLAKMTELYLQEGGHSTEIFNLDFHPDGSLLSSVGGDGN-CVL 254

Query: 323 WDLK 326
           WDL+
Sbjct: 255 WDLR 258

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 65/164 (39%), Gaps = 18/164 (10%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           L+S S D +  +WD+     S   ++T    H   V D ++ + +  LF +   D  +++
Sbjct: 262 LVSSSIDTTCIVWDL----QSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVRV 317

Query: 236 NDIRA-------------ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH-VYLYDL 281
            D+R+             E T  D          L  S    NI+A    DS  + + D+
Sbjct: 318 FDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILDM 377

Query: 282 RNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           RN + P   + GH   V  +++ P             +++ WDL
Sbjct: 378 RNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

>TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {ON}
           Anc_5.139 YGR200C
          Length = 785

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 78/190 (41%), Gaps = 32/190 (16%)

Query: 134 VATINGQGTVFLYSRSD----GLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWD 189
           V       T+ L+  +D    G+  TLK H      + F P    +++S S+DH V +WD
Sbjct: 28  VVAFGAGKTIALWKPTDDFAQGVCRTLKGHAAEVTCVKFMPGTN-YMVSASEDHHVKIWD 86

Query: 190 VSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK--INDIR------AE 241
            S    +   ++T +     IV  +     NK+L    S D L+   I D +       +
Sbjct: 87  FS----TLECVQTIEHFKHTIVTLA----VNKNLIAIGSADGLVSIWIKDSQEHRFGLGQ 138

Query: 242 NTTIDTAKCPQPFNTLAFSH--HSSNILAAAGMDSHVYLYDLRNMKEPLH------HMSG 293
             +I     P    TL+ SH  +   +LA  G   +V++Y     +  +        + G
Sbjct: 139 EFSIRKGILPL---TLSISHVINDKFLLAVGGTSMNVFIYSFVLSESEIQDCQMAAELDG 195

Query: 294 HEDAVTNLEF 303
           HED V +L F
Sbjct: 196 HEDWVKSLAF 205

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 9/95 (9%)

Query: 99  EASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ--STL 156
           +A+ P P +  R  AKY     ITR   +  D   +AT +   T  ++S  D  Q  +TL
Sbjct: 193 DAANPKPVTKFRSHAKY-----ITRV-LLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246

Query: 157 KFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVS 191
             H+   +  +FS     +L++   DH V LWD+S
Sbjct: 247 DNHQRWVWDCAFSA-DSAYLVTACSDHYVRLWDLS 280

>KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {ON}
           Anc_8.631 YOR212W
          Length = 425

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 70/161 (43%), Gaps = 5/161 (3%)

Query: 127 MPQDPNMVAT--INGQGTVFLYSRSDGLQSTLK--FHKDNGYALSFSPLIKGHLLSGSDD 182
           M  + N+VA+  +N   TV+  S+ + +Q  +   F     Y      L    +L+ S D
Sbjct: 142 MSPNGNLVASAGLNNNCTVYKVSKENRVQQNITSIFKGHTCYISDIDFLDNTQVLTASGD 201

Query: 183 HSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN 242
            + ALWD+      T       D+ +  +  +K +N ++++F +   D    I DIR   
Sbjct: 202 MTCALWDIPKAKRVTEYTDHLGDVLALALPTNKNNNNDENIFASCGSDGYTYIWDIRTPG 261

Query: 243 TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
           +  +     +  NTL F     N +A    D  V LYDLR+
Sbjct: 262 SVQNFFVSNRDVNTLQFFKD-GNSIATGSDDGMVNLYDLRS 301

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 15/130 (11%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDV------------SGGSDSTTPIRTWDDLHSDIVNDSK 215
           FSP     + SGSDD  + +W++             G      P+R     HS  V    
Sbjct: 101 FSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSG-HSRKVGHLL 159

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
           +H   +++  + S D  +KI DI  E     T K P    +++FS+   +++  +  D  
Sbjct: 160 FHPLAENILASSSLDYTVKIWDISQEEVKF-TLKHPDMVTSMSFSYDGKHLVTVS-RDKK 217

Query: 276 VYLYDLRNMK 285
           + ++D+R  K
Sbjct: 218 LRVWDVRAEK 227

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 166 LSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFG 225
           L F PL +  L S S D++V +WD+S      T        H D+V    +    K L  
Sbjct: 158 LLFHPLAENILASSSLDYTVKIWDISQEEVKFTL------KHPDMVTSMSFSYDGKHLV- 210

Query: 226 TVSEDSLLKINDIRAE 241
           TVS D  L++ D+RAE
Sbjct: 211 TVSRDKKLRVWDVRAE 226

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 64/136 (47%), Gaps = 15/136 (11%)

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPI------RTWDDLHSDI--VNDSKWHNFNKDLF 224
           K   L+G+++ +V+LW++   + ST+ I      RT    HS +  +ND KW++ +  +F
Sbjct: 61  KTSFLAGNNNGTVSLWNLDN-TLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMF 119

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHV-YLYDLRN 283
            T   D  +K+ D    N  I+       FN+  F   ++N      +D +   L DLRN
Sbjct: 120 FTCGNDKFVKLWD---TNKFINVQDL--EFNSNLFQMDTANQFILVTLDDYYPRLIDLRN 174

Query: 284 MKEPLHHMSGHEDAVT 299
           M   +     H ++ T
Sbjct: 175 MNLGITIFGKHLNSKT 190

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 73/147 (49%), Gaps = 9/147 (6%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H D+  +L++SP     +++ SDD  + +WDV+ G      + T+++ H+  V   ++  
Sbjct: 344 HFDSTNSLAYSP-DGSRVVTASDDGKIKVWDVTSG----FCLATFEE-HTSSVTAVQFAK 397

Query: 219 FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH-VY 277
             + +F +  + ++   + IR  N    T      FN LA    S  ++ A  +D+  ++
Sbjct: 398 RGQVMFSSSMDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD-PSGEVVCAGSLDNFDIH 456

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           ++ ++   + L  +SGHE  V+ L FS
Sbjct: 457 VWSVQT-GQLLDALSGHEGPVSCLSFS 482

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 73/176 (41%), Gaps = 24/176 (13%)

Query: 170 PLIKGHLLSG------SDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWHNFNKD 222
           PL+    +SG      S D S+ LW +   +DS  P+ +   L  D   ND  W + NK 
Sbjct: 21  PLLVSGTVSGTVDANFSTDSSLELWSLLT-TDSEKPMAS---LQVDSKFNDLDWSHNNKT 76

Query: 223 LFGTVSEDSLLKINDIRAENTTIDTAKC---PQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
           + G +   +L   +   A +T + TAK         T+ F+    N+LA+ G +  ++++
Sbjct: 77  IAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIW 136

Query: 280 DLRNMKE---------PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
           D+    E         P   MS   D V +L ++             N   +WDLK
Sbjct: 137 DMNKCTESPSSYTPLTPGQSMSS-VDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 49/249 (19%), Positives = 95/249 (38%), Gaps = 42/249 (16%)

Query: 109 IRITAKYE-HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALS 167
           I  TAK+  H   +   ++  +  N++A+    G +F++  +   +S            S
Sbjct: 98  IVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTES----------PSS 147

Query: 168 FSPLIKGHLLSGSDDHSVALWD-------VSGGSDSTTPIRTWD-DLHSDIVNDS----- 214
           ++PL  G  +S  D+ +   W+        S GS +   I  WD     ++++ S     
Sbjct: 148 YTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASI--WDLKAKKEVIHLSYTSPN 205

Query: 215 ----------KWHNFNKDLFGTVS---EDSLLKINDIRAENTTIDTAKCPQPFNTLAF-- 259
                     +WH  N     T +    D  + + D+R  NT + T         L+   
Sbjct: 206 SGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQGHQKGILSLDW 265

Query: 260 SHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNR 319
            H   N+L ++G D+ V L++  + +E L       +     +F+P            NR
Sbjct: 266 CHQDENLLLSSGRDNTVLLWNPESAEE-LSQFPSRGNWCFKTKFAPEAPDLFACASFDNR 324

Query: 320 LIMWDLKQI 328
           + +  L+ +
Sbjct: 325 IEVQTLQNL 333

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 59/134 (44%), Gaps = 20/134 (14%)

Query: 255 NTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHM-----SGHEDAVTNLEFSPHXXX 309
           N+LA++   +++ A+AG  +   ++DL+  KE +H       SG +  ++ +E+ P    
Sbjct: 164 NSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNST 223

Query: 310 XXXXXXXXNR---LIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPW 366
                   +    +++WDL+      TP         L  +  GH+  +   D   Q   
Sbjct: 224 RVATATGSDNDPSILVWDLRNAN---TP---------LQTLSQGHQKGILSLDWCHQDEN 271

Query: 367 LIASTEEENILQVW 380
           L+ S+  +N + +W
Sbjct: 272 LLLSSGRDNTVLLW 285

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 43/217 (19%), Positives = 84/217 (38%), Gaps = 34/217 (15%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           ++S S D +  +WD+     S+  ++T    H   V D ++   +  LF +   D  +++
Sbjct: 259 IISSSIDTTCIVWDL----QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 236 NDIRA-------------------ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH- 275
            D+R+                      T  + K       L  S +  N+LA    DS+ 
Sbjct: 315 FDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNK 374

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPD 335
           + + D+RN + P+ ++ GH  +V  +++ P             + + WDL     E    
Sbjct: 375 IIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSFMEINGS 434

Query: 336 DA----------EDGVPELIMVHAGHRSAVNDFDLNA 362
           D+          ED   + +M   G ++   +  LN+
Sbjct: 435 DSKSPTASGASLEDSDGDTVMADGGAKANQQEDPLNS 471

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 75/162 (46%), Gaps = 10/162 (6%)

Query: 149 SDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHS 208
           S  L + + F  DN + L   PL    LL  S + SV L D     +S + I+ ++   +
Sbjct: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDW----NSPSIIKKFEVGET 56

Query: 209 DIVNDSKWHN-FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNIL 267
           +I +    +N F        +  + +KI D+R  ++ + T K  +    L+       ++
Sbjct: 57  NINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLV 116

Query: 268 AAA---GMDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSP 305
                 G+D+ +++YD+R   +P+   +  H D +T+++F P
Sbjct: 117 CGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHP 158

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 85/222 (38%), Gaps = 53/222 (23%)

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           +G L SGS D ++  WD++ G      +++    H+  +N             +++ D  
Sbjct: 288 RGILYSGSHDKTIRAWDMAAGGKCINILKS----HAHWINHL-----------SLNTDYA 332

Query: 233 LKINDIRAENTTIDTAKCPQPFNTLAFSHHSS---------NILAAAGMDSHVYLYDLRN 283
           L++    A + T +    P+     A  ++            ++  A  D  +YL+D   
Sbjct: 333 LRVG---AFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLK 389

Query: 284 MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPE 343
             +P+  M+GH+  V ++ FSP            N + +W            D  +G   
Sbjct: 390 ASKPITRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DGRNGT-- 434

Query: 344 LIMVHAGHRSAVNDFDLNAQVPW-----LIASTEEENILQVW 380
            I    GH ++V       QV W     L+ S  ++  L+VW
Sbjct: 435 FIATFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 470

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 166 LSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFG 225
           ++FSP  + +++S S D+S+ LWD   G    T I T+   H   V    W + +  L  
Sbjct: 407 VAFSPDGR-YIVSASFDNSIKLWDGRNG----TFIATFRG-HVASVYQVAWSS-DCRLLV 459

Query: 226 TVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
           + S+D+ LK+ D+R +  ++D         T+ +S     +  +AG D  V ++
Sbjct: 460 SCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRV-CSAGKDKMVRIW 512

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 54/130 (41%), Gaps = 7/130 (5%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
            ++ SDD+ + +W+ S G       R     H D V    WH     L  + S+D+L+K+
Sbjct: 192 FVTCSDDNILKIWNFSNGKQE----RVLSGHHWD-VKSCDWHP-EMGLIASASKDNLVKL 245

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295
            D R+ N      K         F     N+L A   D    ++D+R   + L  +    
Sbjct: 246 WDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDET 305

Query: 296 DAVTNLEFSP 305
           D +T LE+ P
Sbjct: 306 DYMT-LEWHP 314

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 9/95 (9%)

Query: 99  EASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQ--STL 156
           +A+ P P +  R  AKY     ITR   +  D   +AT +   T  ++S  D  Q  +TL
Sbjct: 193 DAANPRPVTKFRSHAKY-----ITRV-LLSSDVKHLATCSADHTARVWSIDDNFQLETTL 246

Query: 157 KFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVS 191
             H+   +  +FS     +L++   DH V LWD+S
Sbjct: 247 DGHQRWVWDCAFSA-DSAYLVTACSDHYVRLWDLS 280

>KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {ON}
           conserved hypothetical protein
          Length = 309

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 64/151 (42%), Gaps = 13/151 (8%)

Query: 158 FHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH 217
           +H  N    +   L     ++GS D  +AL D+  G      +R     H  +VN  +  
Sbjct: 55  YHHGNAAITALDALGDRCAVTGSSDTRLALCDLETGQ----LLRGLAG-HRRVVNQVR-- 107

Query: 218 NFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVY 277
              +  F +V +D  LK+ D       +  A    P   +A    + +++ A+G++  + 
Sbjct: 108 ALGESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLEPVIR 167

Query: 278 LYDLRNMKEPLHHMS----GHEDAVTNLEFS 304
            YDLR   +  H  S     H DAVT+L+ S
Sbjct: 168 AYDLRRSAD--HAFSSWPAAHSDAVTSLDVS 196

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+    ++LA   +D++V+ +D+R+   P +  S    A + ++++ +          
Sbjct: 120 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            N + +WDL++     TP          +    GH S+VN  D N      I S+  +  
Sbjct: 179 GNDIFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSTS 234

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 58/131 (44%), Gaps = 19/131 (14%)

Query: 254 FNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEP---LHHMSGHEDAVTNLEFSPHXXXX 310
           FN ++ +    +++ A+     +Y+ DL +   P   LHH++  +  V ++++SPH    
Sbjct: 27  FNAVSINPSGRDVVLASRQG--LYIIDLDDPFTPPRWLHHITPWQ--VADVQWSPHPAKP 82

Query: 311 XXXXXXXN-RLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIA 369
                  N + I+W+L           A+     +  V  GH  A+ D + N Q P ++A
Sbjct: 83  YWIVSTSNQKAIIWNL-----------AKSSANAIEFVLHGHSRAITDINFNPQHPDVLA 131

Query: 370 STEEENILQVW 380
           +   +  +  W
Sbjct: 132 TCSVDTYVHAW 142

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 122 TRARYMPQDPNMVATINGQGTVFLYSRSDGLQ--STLKFHKDNGYALSFSPLIKGHLLSG 179
           ++ ++  +DPN++A+ +G   +F++    G     +LK H  +  ++ F+      ++S 
Sbjct: 162 SQVKWNYKDPNVLASSHGND-IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSS 220

Query: 180 SDDHSVALWDVS 191
           S+D +V  WD S
Sbjct: 221 SNDGTVKFWDYS 232

>KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.247
           YKR036C
          Length = 674

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 100/266 (37%), Gaps = 64/266 (24%)

Query: 127 MPQDPNMVATINGQGTVFLYSRSDGLQS--------------TLKFHKDNGYALSFSPLI 172
           M  + NM+AT +   T+ +++ S  +QS              + + H D   ALS +   
Sbjct: 425 MDNNYNMLATGSRDATLKIWNVSQAVQSYGIDPDTVADSCIFSFQEHSDEVTALSINF-- 482

Query: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
             HLLSGS D +V  WD++ G      ++T D    + ++ S     +  + G       
Sbjct: 483 -NHLLSGSQDRTVRQWDMNTGK----CVQTLDVSFVNALSHSLVTTLDPPVVGA------ 531

Query: 233 LKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMS 292
           LK  D+                            LA    D  V L+DLR   E +  + 
Sbjct: 532 LKSYDV---------------------------ALATGTKDGMVRLWDLRT-GEIVRTLK 563

Query: 293 GHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGA-----EQTPDDAEDGVPELIMV 347
           GH  A++ L+F  H           N + +WDL+          Q+P  + D   E + +
Sbjct: 564 GHTGAISCLKFDLH---NLITGSLDNSVRVWDLRSGSTLDAFRYQSPVTSLDFDDEKVAI 620

Query: 348 HAGHRSAVNDFDLNAQVPWLIASTEE 373
             G  S +  ++   Q  W+    EE
Sbjct: 621 ANGSNS-IQVYNRKEQRHWVCGQNEE 645

>Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C
           (ASC1) - G-beta like protein [contig 54] FULL
          Length = 218

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 73/166 (43%), Gaps = 26/166 (15%)

Query: 152 LQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDS-TTPIRTWDDLHSDI 210
           L+ TL+ H     +L+ SP     LLSGS D S+  W ++G       P+R++   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRG-HSHI 67

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKIN---DIRAENTTIDTAKCPQPFN-------TLAFS 260
           V D            TV+ D    ++   D       + T KC Q F        ++   
Sbjct: 68  VQDC-----------TVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTID 116

Query: 261 HHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
             +S I++A+  D  V +++   + E +  + GH D V+ +  +P+
Sbjct: 117 RRASQIVSAS-RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPN 159

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 61/137 (44%), Gaps = 10/137 (7%)

Query: 174 GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           G ++SGS D+ +  WD   G + +T +     L   I+  +K+     +L   V++D   
Sbjct: 218 GLIVSGSKDNLIKFWDPRTGRNVSTIL----GLKHTIIK-TKFQPTQGNLLAVVAKDKST 272

Query: 234 KINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDL---RNMKEPLHH 290
           KI DIR     + T +    + +L +   +  + +    +  +  +DL    N   P  H
Sbjct: 273 KIYDIRQNMRELQTIRDDVDYMSLVWHPINETMFSVGCYNGAIKHFDLLHDNNSPVPSSH 332

Query: 291 --MSGHEDAVTNLEFSP 305
                HE +VT+L +SP
Sbjct: 333 TITYAHEKSVTSLAYSP 349

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 8/128 (6%)

Query: 178 SGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D ++ +W+++ G    T        H   V D    N +  +F +VSED  +K  D
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTL-----KAHDMTVRDLAISNRHPYMF-SVSEDKTVKCWD 186

Query: 238 IRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDA 297
           +  +NT I               H + +++  AG DS V ++D+R  + P+  + GH+  
Sbjct: 187 LE-KNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRT-RLPVMTLPGHKGP 244

Query: 298 VTNLEFSP 305
           +T +   P
Sbjct: 245 ITKVRCLP 252

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 54/130 (41%), Gaps = 7/130 (5%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
            ++ SDD+ + +W+ S G       R     H D V    WH     L  + S+D+L+K+
Sbjct: 194 FVTCSDDNILKIWNFSNGKQE----RVLSGHHWD-VKSCDWHP-EMGLIASASKDNLVKL 247

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295
            D R+ N      K         F     N+L A   D    ++D+R   + L  +    
Sbjct: 248 WDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDET 307

Query: 296 DAVTNLEFSP 305
           D +T LE+ P
Sbjct: 308 DYMT-LEWHP 316

>KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {ON}
           similar to uniprot|P26309 Saccharomyces cerevisiae
           YGL116W CDC20 Cell-cycle regulated activator of
           anaphase- promoting complex/cyclosome (APC/C) which is
           required for metaphase/anaphase transition directs
           ubiquitination of mitotic cyclins Pds1p and other
           anaphase inhibitors potential Cdc28p substrate
          Length = 545

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 9/132 (6%)

Query: 175 HLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           H+  G +D +V +WD    +++ T +RT        +    W +    L  T S+   ++
Sbjct: 263 HISIGKNDGNVEIWD----AETMTHVRTMRSGLGVRIGSQSWLD---TLCVTGSKSGEIQ 315

Query: 235 INDIRAENTTIDTAKCPQPFNTLAFSHHSSNI-LAAAGMDSHVYLYDLRNMKEPLHHMSG 293
           IND+R +N  + T +  Q       S     I LA+   D+ V ++D R   +P+     
Sbjct: 316 INDVRIKNHVVQTWERHQG-EVCGLSFREDGIQLASGANDNTVMIWDTRQNNDPIWTKRN 374

Query: 294 HEDAVTNLEFSP 305
           H+ AV  + + P
Sbjct: 375 HKAAVKAISWHP 386

>SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]
           {ON} similar to uniprot|P42935 Saccharomyces cerevisiae
           YGR200C ELP2 Elongator protein part of the six-subunit
           RNA polymerase II Elongator histone acetyltransferase
           complex target of Kluyveromyces lactis zymocin
          Length = 789

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 84/201 (41%), Gaps = 23/201 (11%)

Query: 115 YEHEEEITRARYMPQDPNMVATI----NGQGTVF-LYSRSDGLQS--TLKFHKDNGYALS 167
           Y H  EI+     P D  +VA+     N Q  V  ++     LQ    L FH      L 
Sbjct: 554 YGHGYEISCLDVSP-DKKLVASACRSNNAQHAVIRIFDTKSWLQQKPNLAFHNLTITRLK 612

Query: 168 FSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFN-KDLFGT 226
           FS   K HLLS S D   A+W+ +  SD+       D  H+ I+ D +W      D F T
Sbjct: 613 FSKDNK-HLLSVSRDRQWAVWERNMESDTFELKYKNDKPHTRIIWDCEWTPLEFGDAFVT 671

Query: 227 VSEDSLLKINDIRAENTTI---DTAKCPQPFNTLAF--SHHSSNILAAAGMDS---HVYL 278
            S D  +KI     +  T    ++ +  +P   ++   S  + ++  A G +S   H+Y 
Sbjct: 672 ASRDKTIKIWKFSEDQKTYSLENSLRFKEPITAISVHDSLFNGHLAIALGFESGAIHIYA 731

Query: 279 YDLRNMKEPLHHMSGHEDAVT 299
           Y+     E  H +   + A+T
Sbjct: 732 YN-----EVFHRILELDAAIT 747

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 107 SNIRITAKYE-HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDG--LQSTLKFHKDNG 163
           SN++   K++ H   ITR   +  D   +AT +   T  ++S  D   L+STL  H+   
Sbjct: 195 SNLKPATKFKAHPSYITRV-LLSSDVKHMATCSADHTARIWSVEDNFNLESTLDGHQRWV 253

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWDVS 191
           +  +FS     +L++ S DH V LWD+S
Sbjct: 254 WDCAFSA-DSAYLVTASSDHYVRLWDLS 280

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 8/141 (5%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
            L   P+      +GS+D +V +WD++ G    T        H   V D      +  LF
Sbjct: 120 CLKVDPVDNEWFATGSNDTTVKIWDLASGKLKLTLAG-----HVMTVRDVAISQRHPYLF 174

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM 284
            + SED ++K  D+       D        +T+   H + +++A+AG D  V L+D+R+ 
Sbjct: 175 -SASEDKMVKCWDLEKNQIIRDYHGHLSGVHTVDI-HPTLDLIASAGRDGVVKLWDIRS- 231

Query: 285 KEPLHHMSGHEDAVTNLEFSP 305
           +  +  + GH+  +T +   P
Sbjct: 232 RTAVMTLIGHKSPITKVHCLP 252

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 106/268 (39%), Gaps = 56/268 (20%)

Query: 128 PQDPNMVATINGQGTVFLY-SRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVA 186
           P     +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D +V 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVR 302

Query: 187 LWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTID 246
           +WD++        +++    H+  VN             ++S D  L++    A + T  
Sbjct: 303 VWDINSQGRCINILKS----HAHWVNHL-----------SLSTDYALRVG---AFDHTGK 344

Query: 247 TAKCPQPFNTLAFSHH---------SSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDA 297
               P+     A  ++         S  ++  A  D  ++L++     +P+  M+GH+  
Sbjct: 345 RPSTPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKL 404

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVND 357
           V ++ FSP            N + +W            D  DG  + I    GH ++V  
Sbjct: 405 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV-- 447

Query: 358 FDLNAQVPW-----LIASTEEENILQVW 380
                QV W     L+ S  ++  L+VW
Sbjct: 448 ----YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 70/152 (46%), Gaps = 16/152 (10%)

Query: 133 MVATINGQGTVFLYSRSDGLQSTLKFHKDNGYA-----LSFSPLIKGHLLSGSDDHSVAL 187
           M+ T +   T+FL+   + L+ST    +  G+      ++FSP  + +++S S D+S+ L
Sbjct: 373 MMVTASDDFTMFLW---NPLKSTKPVARMTGHQKLVNHVAFSPDGR-YIVSASFDNSIKL 428

Query: 188 WDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDT 247
           WD   G   +T  R     H   V    W +  + L  + S+D+ LK+ D+R    ++D 
Sbjct: 429 WDGRDGKFIST-FRG----HVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDL 482

Query: 248 AKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
                   T+ +S     +  + G D  V L+
Sbjct: 483 PGHKDEVYTVDWSVDGKRV-CSGGKDKMVRLW 513

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+    ++LA   +D++V+ +D+R+   P +  S    A + ++++ +          
Sbjct: 120 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENI 376
            N + +WDL++     TP          +    GH S+VN  D N      I S+  +  
Sbjct: 179 GNDIFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKYSEIMSSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSKS 234

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 58/131 (44%), Gaps = 19/131 (14%)

Query: 254 FNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEP---LHHMSGHEDAVTNLEFSPHXXXX 310
           FN ++ +    +I+ A+     +Y+ DL +   P   LHH++  +  V ++++SPH    
Sbjct: 27  FNAVSINPSGRDIVLASRQG--LYIIDLDDPFTPPRWLHHITPWQ--VADVQWSPHPAKP 82

Query: 311 XXXXXXXN-RLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIA 369
                  N + I+W+L           A+     +  V  GH  A+ D + N Q P ++A
Sbjct: 83  YWIVSTSNQKAIIWNL-----------AKSSSNAIEFVLHGHSRAITDINFNPQHPDVLA 131

Query: 370 STEEENILQVW 380
           +   +  +  W
Sbjct: 132 TCSVDTYVHAW 142

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 122 TRARYMPQDPNMVATINGQGTVFLYSRSDGLQ--STLKFHKDNGYALSFSPLIKGHLLSG 179
           ++ ++  +DPN++A+ +G   +F++    G     +LK H  +  ++ F+      ++S 
Sbjct: 162 SQVKWNYKDPNVLASSHGND-IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSS 220

Query: 180 SDDHSVALWDVSGGS 194
           S+D +V  WD S  +
Sbjct: 221 SNDGTVKFWDYSKST 235

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 107 SNIRITAKYE-HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDG--LQSTLKFHKDNG 163
           SN++   K+  H+  ITR   +  D   +AT +   T  ++S  D   L +TL  H+   
Sbjct: 195 SNLKPVTKFRAHDAYITRI-LLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWV 253

Query: 164 YALSFSPLIKGHLLSGSDDHSVALWDVS 191
           +  +FS     +L++ S DH V LWD+S
Sbjct: 254 WDCAFSA-DSAYLITASSDHYVRLWDLS 280

>Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429W
           (REAL)
          Length = 642

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 12/128 (9%)

Query: 163 GYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKD 222
           G+ L + P+ K  L S S D++V LWDV  G D  T        H D+V  S   +++ +
Sbjct: 144 GHVL-YHPVAKNVLASSSGDYTVKLWDVETGKDVITL------KHPDMVT-SMSFSYDGN 195

Query: 223 LFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGM----DSHVYL 278
              TV+ D  L++ +IR E    +        N       +S+ LA  G     D  + +
Sbjct: 196 HLATVARDKKLRVWNIRDEKIVSEGPAHSGAKNQRVVWLGNSDRLATTGFSKLSDRQIGI 255

Query: 279 YDLRNMKE 286
           +D  N+++
Sbjct: 256 WDAFNLEK 263

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 15/130 (11%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDV------------SGGSDSTTPIRTWDDLHSDIVNDSK 215
           F P     + S SDD  + +WDV            +G      P++     H+  V    
Sbjct: 89  FDPFNDRRIASSSDDSKIGIWDVPENYKFHDHVDENGDPIDIKPVKFLTG-HARKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
           +H   K++  + S D  +K+ D+      I T K P    +++FS +  N LA    D  
Sbjct: 148 YHPVAKNVLASSSGDYTVKLWDVETGKDVI-TLKHPDMVTSMSFS-YDGNHLATVARDKK 205

Query: 276 VYLYDLRNMK 285
           + ++++R+ K
Sbjct: 206 LRVWNIRDEK 215

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 53/130 (40%), Gaps = 24/130 (18%)

Query: 185 VALWDVSGGSDSTTPIR--TWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN 242
           + LWDV    +   P+   +W    +D +   K++    D+  +   D+ + + D+R  +
Sbjct: 201 IHLWDV----NRLKPVSDLSWG---ADNITSLKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 243 -------TTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295
                  T    A C  P     F          A  D + Y YD+RN+   L+    H 
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNF--------VTANEDHNAYYYDMRNLSRSLNVFKDHV 305

Query: 296 DAVTNLEFSP 305
            AV +++FSP
Sbjct: 306 SAVMDVDFSP 315

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H+D  YA++ +      L +GS D  +  W++S   +  +    +  +    V   ++H+
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHD 125

Query: 219 FNKDLFG-----TVSEDSLLK-----INDIRAENTT-----------IDTAKCPQPFNTL 257
              DL       + S+D  +K     ++D   +N++           I T      F  +
Sbjct: 126 KKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGI 185

Query: 258 AFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXX 317
             SH  ++  A  G  + ++L+D+  +K P+  +S   D +T+L+F+ +           
Sbjct: 186 D-SHRENSTFATGG--AKIHLWDVNRLK-PVSDLSWGADNITSLKFNQNETDILASTGSD 241

Query: 318 NRLIMWDLK 326
           N ++++DL+
Sbjct: 242 NSIVLYDLR 250

>KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 83/197 (42%), Gaps = 34/197 (17%)

Query: 219 FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAF-SHHSSNILAAAGMDSHVY 277
           F+   FG+ S+D+ ++  DIR  +  I +   P+     AF +   +N L   G  + V 
Sbjct: 241 FDNYTFGSCSDDNTIRFWDIRTADKPIFSLSEPKNGKLTAFDASQITNELFVTGTSTGVI 300

Query: 278 -LYDLRNMK----EPLHHMSGHE--------------DAVTNLEFSPHXXXXXXXXXXXN 318
            L+D+R+++    +  H  +GH+              D+V +++FSP             
Sbjct: 301 KLWDIRSVEFATTDLTHRQNGHDPIQTELVNLYHSGGDSVADVQFSPTSSSEFATVGGSG 360

Query: 319 RLIMWDLKQIGAEQTPDDAEDG----VPE------LIMVHAGH----RSAVNDFDLNAQV 364
            +  WD++   ++   DDA        PE      L   H G+    R+  N    +  +
Sbjct: 361 NVYHWDMEFFFSQNDDDDAGATAKLPAPEELQGQCLKFFHIGNNQQKRNVKNSVAWHPTI 420

Query: 365 PWLIASTEEENILQVWK 381
             L+ + ++ +++ V+K
Sbjct: 421 DDLVCTVDDTSLISVYK 437

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 7/130 (5%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
            ++ SDD+ + +W+ S G +     R     H D V    WH     L  + S+D+L+K+
Sbjct: 192 FVTCSDDNILKIWNFSNGKEE----RVLSGHHWD-VKSCDWHP-EMGLIASASKDNLVKL 245

Query: 236 NDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHE 295
            D R+ N      K         F     N+L A   D    ++D+R   + L  +    
Sbjct: 246 WDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRVFDIRYSMKELMCVRDET 305

Query: 296 DAVTNLEFSP 305
           D +T LE+ P
Sbjct: 306 DYMT-LEWHP 314

>TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.309
           YLR429W
          Length = 640

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 12/126 (9%)

Query: 163 GYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKD 222
           G+ L F PL +  L S S D++V +WDV  G    T        H D+V  S   +++  
Sbjct: 149 GHVL-FHPLAQNVLASSSLDYTVKIWDVESGEAKITL------KHPDMVT-SMSFSYDGQ 200

Query: 223 LFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGM----DSHVYL 278
              TV+ D  L++ DIR E    +        N       +S+ LA  G     D  + +
Sbjct: 201 YLATVARDKKLRVWDIREEKIVSEGVAHSGAKNQRVVWLGNSDRLATTGFSRLSDRQIGI 260

Query: 279 YDLRNM 284
           +D  N+
Sbjct: 261 WDAFNL 266

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 54/135 (40%), Gaps = 20/135 (14%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDV-----------------SGGSDSTTPIRTWDDLHSDI 210
           F P     ++S SDD  + +W++                        +P++     H+  
Sbjct: 89  FDPFNDHRIVSASDDSKIGVWEIPQDYSFRDYNEETMEDDDPKPKDISPLKFLSG-HTRK 147

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAA 270
           V    +H   +++  + S D  +KI D+ +    I T K P    +++FS +    LA  
Sbjct: 148 VGHVLFHPLAQNVLASSSLDYTVKIWDVESGEAKI-TLKHPDMVTSMSFS-YDGQYLATV 205

Query: 271 GMDSHVYLYDLRNMK 285
             D  + ++D+R  K
Sbjct: 206 ARDKKLRVWDIREEK 220

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 98/231 (42%), Gaps = 23/231 (9%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
           ++ FSP  K +L +G++D  + +WD+S    S   + T      DI +   +   +K + 
Sbjct: 374 SVCFSPDGK-YLATGAEDKLIRIWDLS----SKKILMTLQGHEQDIYSLDYFPAGDKLVS 428

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYD---- 280
           G  S D  ++I D+R    ++ T        T+A S      +AA  +D  V ++D    
Sbjct: 429 G--SGDRTVRIWDLRTGQCSL-TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 281 --LRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAE 338
             +  +       +GH+D+V ++ F+               + +WDL+ +  +++    E
Sbjct: 486 FLVERLDSENELSTGHKDSVYSVVFT-RDGRSVVSGSLDRSVKLWDLRGLNGQKSHATCE 544

Query: 339 DGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSLPIV 389
                  + + GH+  V          ++++ +++  +L  W  +   P++
Sbjct: 545 -------VTYTGHKDFVLSVATTQDDEYILSGSKDRGVL-FWDTASGNPLL 587

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 87/202 (43%), Gaps = 29/202 (14%)

Query: 117 HEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYA-LSFSPLIKGH 175
           HE++I    Y P    +V+  +G  TV ++    G Q +L    ++G   ++ SP    +
Sbjct: 410 HEQDIYSLDYFPAGDKLVSG-SGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKY 467

Query: 176 LLSGSDDHSVALWDVSGGS-----DSTTPIRTW--DDLHSDIVNDSKWHNFNKDLFGTVS 228
           + +GS D +V +WD   G      DS   + T   D ++S +        F +D    VS
Sbjct: 468 IAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVV--------FTRDGRSVVS 519

Query: 229 E--DSLLKINDIRAENTTIDTAKCPQPFN-------TLAFSHHSSNILAAAGMDSHVYLY 279
              D  +K+ D+R  N     A C   +        ++A +     IL+ +  D  V  +
Sbjct: 520 GSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGS-KDRGVLFW 578

Query: 280 DLRNMKEPLHHMSGHEDAVTNL 301
           D  +   PL  + GH ++V ++
Sbjct: 579 DTAS-GNPLLMLQGHRNSVISV 599

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 75/158 (47%), Gaps = 17/158 (10%)

Query: 155 TLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVN-- 212
           TL+ H+ + Y+L + P     L+SGS D +V +WD+  G  S T +   D + +  V+  
Sbjct: 406 TLQGHEQDIYSLDYFP-AGDKLVSGSGDRTVRIWDLRTGQCSLT-LSIEDGVTTVAVSPG 463

Query: 213 DSKW---HNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAA 269
           D K+    + ++ +    SE   L +  + +EN      K      ++ F+    ++++ 
Sbjct: 464 DGKYIAAGSLDRTVRVWDSETGFL-VERLDSENELSTGHK--DSVYSVVFTRDGRSVVSG 520

Query: 270 AGMDSHVYLYDLRNMKEPLHHM------SGHEDAVTNL 301
           + +D  V L+DLR +     H       +GH+D V ++
Sbjct: 521 S-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSV 557

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 68/325 (20%), Positives = 119/325 (36%), Gaps = 79/325 (24%)

Query: 107 SNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDG--LQSTLKFHKDNGY 164
           +  R+     H   +    + P D  ++AT +   T+ L+  S G      L+ H     
Sbjct: 175 TQTRMCTLQGHHNWVLCCSWSP-DGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWIT 233

Query: 165 ALSFSPL------IKGHLLSGSDDHSVALWDV---------------------------- 190
           +LS+ P+       K  L + S D ++ +WD                             
Sbjct: 234 SLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVLY 293

Query: 191 SGGSDSTTPIRTWD-DLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAK 249
           SG  D T  IR WD +L+   +N  K H    +   ++S D  L++    A +   +T  
Sbjct: 294 SGSHDKT--IRCWDMNLNGKCINILKSHAHWVNHL-SLSTDYALRLG---AFDHKGETPA 347

Query: 250 CPQPFNTLAFSHHSS---------NILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
            P+     A  ++            ++  A  D  +YL++     +P+  M+GH+  V +
Sbjct: 348 SPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNH 407

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           + FSP            N + +W            D  DG  + +    GH ++V     
Sbjct: 408 VAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASV----- 447

Query: 361 NAQVPW-----LIASTEEENILQVW 380
             QV W     L+ S  ++  L+VW
Sbjct: 448 -YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 79/210 (37%), Gaps = 19/210 (9%)

Query: 103 PPPRSNIRITAKYEHEEEITRARYMPQDPNMVATINGQGTVFLY-SRSDGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T  G  T  ++   +     TL+ H +
Sbjct: 131 PVTRSSSAIAG---HGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHN 187

Query: 162 NGYALSFSPLIKGHLL-SGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF- 219
                S+SP   G L+ +GS D+++ LW+ S G      +R     HS  +    W    
Sbjct: 188 WVLCCSWSP--DGELIATGSMDNTIRLWESSKGKPYGDALRG----HSKWITSLSWEPIH 241

Query: 220 -----NKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS 274
                +K    T S+D  +KI D       +    C    +         N+L +   D 
Sbjct: 242 LVKPGDKPRLATASKDGTIKIWDTTRRVCLLTL--CGHTSSVSCVKWGGKNVLYSGSHDK 299

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
            +  +D+    + ++ +  H   V +L  S
Sbjct: 300 TIRCWDMNLNGKCINILKSHAHWVNHLSLS 329

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 72/147 (48%), Gaps = 9/147 (6%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H D+   L++SP     +++ SDD  + +WD++ G      + T+++ H+  V   ++  
Sbjct: 339 HFDSTNCLAYSP-DGSRVVTASDDGKIKVWDITSG----FCLATFEE-HTSSVTAVQFAK 392

Query: 219 FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH-VY 277
             + +F +  + ++   + IR  N    T      FN LA    S  ++ A  +D+  ++
Sbjct: 393 RGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD-PSGEVVCAGSLDNFDIH 451

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           ++ ++   + L  +SGHE  V+ L FS
Sbjct: 452 VWSVQT-GQLLDALSGHEGPVSCLSFS 477

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 73/147 (49%), Gaps = 9/147 (6%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHN 218
           H D+  +L++SP     +++ SDD  + +WD++ G      + T+++ H+  V   ++  
Sbjct: 342 HFDSTNSLAYSP-DGSRVVTASDDGKIKVWDITSG----FCLATFEE-HTSSVTAVQFAK 395

Query: 219 FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH-VY 277
             + +F +  + ++   + IR  N    T      FN LA    S  ++ A  +D+  ++
Sbjct: 396 RGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD-PSGEVVCAGSLDNFDIH 454

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           ++ ++   + L  +SGHE  V+ L FS
Sbjct: 455 VWSVQT-GQLLDALSGHEGPVSCLSFS 480

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 58/120 (48%), Gaps = 18/120 (15%)

Query: 261 HHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
           H  +N+LAA  MD  + ++DL + K  L   +GH+ A+T ++F              N +
Sbjct: 86  HDETNLLAAGYMDGTIKVWDLLS-KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSN-I 143

Query: 321 IMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVW 380
           I+WDL           +E G+ +L      H+ A++      +  WL+ ST ++ ++++W
Sbjct: 144 IVWDLV----------SEVGLYKL----RSHKDAISGIWCEGE-DWLV-STSKDGLIKIW 187

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 106/265 (40%), Gaps = 50/265 (18%)

Query: 128 PQDPNMVATINGQGTVFLY-SRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVA 186
           P     +A+ +  GT+ ++ S +   Q TL  H ++   + +    +G L SGS D +V 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDSVNRVCQYTLSGHTNSVSCVKWGG--QGLLYSGSHDRTVR 302

Query: 187 LWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTID 246
           +WD++        +++    H+  VN             ++S D  L++           
Sbjct: 303 VWDMNSQGRCINILKS----HAHWVNHL-----------SLSTDYALRVGAFDHTGKKPA 347

Query: 247 TA-----KCPQPFNTLAFSHHSS-NILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           T+     K  + +  +   + SS  ++  A  D  ++L++     +P+  M+GH+  V +
Sbjct: 348 TSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNH 407

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360
           + FSP            N + +W            D  DG  + I    GH ++V     
Sbjct: 408 VAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV----- 447

Query: 361 NAQVPW-----LIASTEEENILQVW 380
             QV W     L+ S  ++  L+VW
Sbjct: 448 -YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 78/169 (46%), Gaps = 18/169 (10%)

Query: 116 EHEEEITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYA-----LSFSP 170
           E+ E+I +     ++  M+ T +   T+FL+   + L+ST    +  G+      ++FSP
Sbjct: 358 ENYEKICKKNGSSEE--MMVTASDDFTMFLW---NPLKSTKPIARMTGHQKLVNHVAFSP 412

Query: 171 LIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSED 230
             + +++S S D+S+ LWD   G   +T  R     H   V    W + +  L  + S+D
Sbjct: 413 DGR-YIVSASFDNSIKLWDGRDGKFIST-FRG----HVASVYQVAWSS-DCRLLVSCSKD 465

Query: 231 SLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLY 279
           + LK+ D+R    ++D         T+ +S     +  + G D  V L+
Sbjct: 466 TTLKVWDVRTRKLSVDLPGHQDEVYTVDWSVDGKRV-CSGGKDKMVRLW 513

>KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, 697
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 697

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 24/142 (16%)

Query: 117 HEEEITRARYMPQDPNMVATINGQGTVFL-----------YSRSDGLQSTL---KFHKDN 162
           H   +    + P + N++A+ +  G + +           Y+ S+G    L   KF   +
Sbjct: 80  HTAHVLDTDFDPFNDNIIASGSDDGKIGIWEIPEDYSFHHYTNSEGEPKDLQPKKFLTGH 139

Query: 163 GYALS---FSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF 219
           G  +    F P  +  L S S DH+V +WDV  G +  T        H D+V  S   ++
Sbjct: 140 GRKVGHVLFHPTARNVLASSSLDHTVRIWDVESGKELFTL------KHPDMVT-SMSFSY 192

Query: 220 NKDLFGTVSEDSLLKINDIRAE 241
           + +   TVS D  L++ DIR E
Sbjct: 193 DGNHLATVSRDKKLRVWDIREE 214

>TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {ON}
           Anc_2.469 YMR093W
          Length = 509

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 86/208 (41%), Gaps = 13/208 (6%)

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           +T   + PQ  +  A  +        SR+  +  T    KD  Y+ SF     G LL   
Sbjct: 42  VTHIAFNPQHTHDFAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRN--DGKLLVAG 99

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR- 239
           D  +  L  V    +  T + + + + +  V+ +K+H+ +     T S+D + ++ DI  
Sbjct: 100 D--ATGLVSVFDSYNPRTLLLSIN-VSTHPVHVTKFHSQDSKTLVTASDDRVTRLWDISY 156

Query: 240 AENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM-KEPLHHMSGHEDAV 298
           A   +++         TL F   + +++A    D  V LYD RN   EP+  ++ HE  +
Sbjct: 157 AYEPSLELTGASDYVRTLTFIPSAPHLVATGSYDGIVRLYDTRNSGSEPVFSLN-HEQPL 215

Query: 299 TN-LEFSPHXXXXXXXXXXXNRLIMWDL 325
            N L  SP            N   +WDL
Sbjct: 216 ENILAISP----TQLISAGGNNFKVWDL 239

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 74/184 (40%), Gaps = 10/184 (5%)

Query: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180
           +T   + PQ P+  A  +        SR+  +  T    KD  Y+ SF     G LL   
Sbjct: 42  VTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRS--DGKLLCAG 99

Query: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDI--VNDSKWHNFNKDLFGTVSEDSLLKINDI 238
           D  +  L  V    DS  P      +++     + +K+H  +  +  T S+D + ++ DI
Sbjct: 100 D--ATGLVSVY---DSYNPRTILLSMNASTHPTHVTKFHTQDSKILATASDDRVTRLWDI 154

Query: 239 -RAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDA 297
             A    ++         TL+F   + +++A    D  V LYD R+      +   H+  
Sbjct: 155 SNAYEPQLELTGATDYVRTLSFIPAAPHLIATGSYDGLVRLYDTRSSGSTPIYSLNHDQP 214

Query: 298 VTNL 301
           + N+
Sbjct: 215 IENV 218

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%)

Query: 253 PFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
           P +   F    S ILA A  D    L+D+ N  EP   ++G  D V  L F P
Sbjct: 126 PTHVTKFHTQDSKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIP 178

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 77/162 (47%), Gaps = 20/162 (12%)

Query: 152 LQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSG-GSDSTTPIRTWDDLHSDI 210
           L+ TL+ H     +LS SP     LLSGS D ++  W ++G       P+R++   HS I
Sbjct: 25  LRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKG-HSHI 83

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPF-------NTLAFSHHS 263
           V D    +  K    + S D  L++ D+++        KC + F        +++    +
Sbjct: 84  VQDCTVTHDGKYAL-SASWDKTLRLWDLQS-------GKCIKRFVGHKSDVMSVSIDPRA 135

Query: 264 SNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
           + I++A+  D  V +++   + + +  + GH D V+N+  +P
Sbjct: 136 TQIVSAS-RDKTVKVWN--TVGDCVVTLLGHNDWVSNVRIAP 174

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 233 LKINDIRAENT--TIDTAKCPQPFNTLAFSHHSSNILAA----AGMDSHVYLYDLRNMKE 286
           +KI DIR+ N   TI   K   PF +L   H   N+LA     +G D+ +++YD+R    
Sbjct: 82  VKIWDIRSNNCLATISNDK-NAPFLSLDSRH---NMLACGTELSGSDAELHIYDVRKWDS 137

Query: 287 PLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
           PL  +   H D +T++ F P                ++DL+Q   E
Sbjct: 138 PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183

>KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {ON}
           Anc_4.309 YLR429W
          Length = 527

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 151 GLQSTLKF---HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLH 207
           G+Q T +     K  G+ L ++P+I+  L S S D +V +WD+S G        T   L 
Sbjct: 124 GIQPTARLTGHEKKVGHVL-YNPVIQDLLASSSFDQTVKIWDISTG-------ETLHTLQ 175

Query: 208 SDIVNDSKWHNFNKDLFGTVSEDSLLKINDIR 239
            D V  S   +++ +   T+S + +L++ DIR
Sbjct: 176 HDEVVLSLSFSYDGNYLATLSRNRILRVWDIR 207

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 10/133 (7%)

Query: 159 HKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDL--------HSDI 210
           HK N   + F P     + S S+D S+A+W +       +    +  +        H   
Sbjct: 78  HKGNVLDIDFDPFDDYKISSCSEDKSIAIWQIPKDYSIRSKRFKFKGIQPTARLTGHEKK 137

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAA 270
           V    ++   +DL  + S D  +KI DI +   T+ T +  +   +L+FS +  N LA  
Sbjct: 138 VGHVLYNPVIQDLLASSSFDQTVKIWDI-STGETLHTLQHDEVVLSLSFS-YDGNYLATL 195

Query: 271 GMDSHVYLYDLRN 283
             +  + ++D+RN
Sbjct: 196 SRNRILRVWDIRN 208

>Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON}
           (27192..29201) [2010 nt, 670 aa]
          Length = 669

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 67/169 (39%), Gaps = 52/169 (30%)

Query: 176 LLSGSDDHSVALWDVSGGSDSTTPIRTWD------------DLHSDIVNDSKWHNFNKDL 223
           ++SG  D  V LWD+    D +T     +            D HSD ++   + NFN   
Sbjct: 411 IISGGRDSLVRLWDIKKFQDYSTNYNDIENYYEETNCIFECDSHSDEISSISYDNFN--- 467

Query: 224 FGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHS-------------------- 263
             T S+D  +K  D+        T KC Q F+   + ++S                    
Sbjct: 468 LLTGSQDKTIKHWDLI-------TGKCVQTFDVSFYLNNSPPFENKFSPTKKNYFAHSEA 520

Query: 264 ---------SNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEF 303
                     + LA+   D  + L+DLR+ K  +  + GH DA+T+L+F
Sbjct: 521 PTIGSLQCFESALASGTKDGLIRLWDLRSGK-VIRILEGHTDAITSLKF 568

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 59/149 (39%), Gaps = 33/149 (22%)

Query: 155 TLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDS 214
           T   H D   ALSF     GHL+SGS D +V  WD++ G      ++T D          
Sbjct: 493 TFDSHVDEITALSFDS---GHLVSGSQDRTVRQWDLTSGK----CLQTID---------- 535

Query: 215 KWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDS 274
                     G +S+ S    + +     T       Q F+           LA    D 
Sbjct: 536 ------LSFAGRLSQTSSNSGSGLLTSTDTSPIIGALQCFDA---------ALATGTRDG 580

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEF 303
            V L+DLR+ K  +  + GH  AVT+L+F
Sbjct: 581 AVRLWDLRSGK-IIRTLEGHTGAVTSLKF 608

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 102/241 (42%), Gaps = 29/241 (12%)

Query: 77  EINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVAT 136
            I L KE+ NN N +         ++   + N++   K     E+T ++ + + P  V  
Sbjct: 148 RIKLEKELANNFNWK---------NVLASKRNLKTGLK---RYELTGSQVIAERPVSVVK 195

Query: 137 INGQGTVFLYSRSDGLQS---TLKFHKDNGYALSFSPLIKG--------HLLSGSDDHSV 185
           +  Q  +      DG  S    +   +   +  +    I G        +L +G +D  V
Sbjct: 196 LAPQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDCLV 255

Query: 186 ALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENTTI 245
            ++      +  T I T    H   V+D K H   K L G+ S D+  ++ DI  +   +
Sbjct: 256 KVFGYE--KNDLTSIDTLKG-HQGRVSDVKLHPLGKYL-GSSSFDNTWRLWDIEKKKEIL 311

Query: 246 DTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
                 +   +LAF H   ++ A AG DS   ++DLR+ K  + ++ GH   + +L+++P
Sbjct: 312 LQEGHSKEIFSLAF-HTDGSLTATAGFDSIGMIWDLRSGKNIM-NLIGHAKPIYSLDWAP 369

Query: 306 H 306
           +
Sbjct: 370 N 370

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 77/157 (49%), Gaps = 22/157 (14%)

Query: 162 NGYALSFSPLIKGH--LLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNF 219
           N +AL   PL  G+  LL+   +  V   D S    + T I+ ++ +    +ND +  N 
Sbjct: 16  NNWALKLQPLQHGNNGLLTSLSNGEVHYLDPS----TLTTIQKYN-ISETSINDLQLINH 70

Query: 220 N---KDLFGTVSEDSLLKINDIRA--ENTTIDTAKCPQPFNTLAFSHHSSNILAAA---- 270
           N     LF T + +S+ KI DI +  E  TI  ++   PF +L   H    +LA      
Sbjct: 71  NPTSSPLFTTATSNSV-KIFDIHSTKEVATIH-SQGNVPFPSLDSRH---GLLACGTELK 125

Query: 271 GMDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPH 306
           G+D+ +Y+YD+R   +P+  +   H D VT L++ P+
Sbjct: 126 GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPN 162

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 54/130 (41%), Gaps = 15/130 (11%)

Query: 168 FSPLIKGHLLSGSDDHSVALWDV------------SGGSDSTTPIRTWDDLHSDIVNDSK 215
           F P     L S +DD  +A+W++             G      P++     H   V    
Sbjct: 89  FDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPVKILSG-HKRKVGHIL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSH 275
           +H   +++  + S D  +KI DI  E   + T   P    +++FS++  N LA    D  
Sbjct: 148 YHPVAQNVLASSSLDYTVKIWDIENEKDML-TLTHPDMVTSMSFSYN-GNFLATVARDKK 205

Query: 276 VYLYDLRNMK 285
           + ++D+R  K
Sbjct: 206 LRVWDVREGK 215

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 7/84 (8%)

Query: 156 LKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSK 215
           L  HK     + + P+ +  L S S D++V +WD+    D  T        H D+V  S 
Sbjct: 136 LSGHKRKVGHILYHPVAQNVLASSSLDYTVKIWDIENEKDMLTLT------HPDMVT-SM 188

Query: 216 WHNFNKDLFGTVSEDSLLKINDIR 239
             ++N +   TV+ D  L++ D+R
Sbjct: 189 SFSYNGNFLATVARDKKLRVWDVR 212

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 23/197 (11%)

Query: 165 ALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLF 224
            +   P+      +GS+D S+ +WD++ G    T        H   V D      +  +F
Sbjct: 127 CVEVDPVDNAWYATGSNDTSIKVWDLASGKLKLTL-----SGHIMTVRDLAISERHPYMF 181

Query: 225 GTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNM 284
            + SED  +K  D+       +        +T++  H + +++ +AG DS V L+D+R  
Sbjct: 182 -SASEDKTIKCWDLEKNMVIRNYHGHLSGVHTVSL-HPTLDLVVSAGRDSVVKLWDMRT- 238

Query: 285 KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPEL 344
           + P+ ++ GH+  +  +   P            N + +WD+              G    
Sbjct: 239 RVPVMNLIGHKSPINKVRCLPVDPQIISCSTDAN-IRLWDITA------------GKSAK 285

Query: 345 IMVHAGHRSAVNDFDLN 361
           I+ H  H+ +V DF L+
Sbjct: 286 ILTH--HKRSVRDFALH 300

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 78/212 (36%), Gaps = 39/212 (18%)

Query: 209 DIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAEN-----TTIDTAKCPQPFNTLAFSHHS 263
           D V  +K+   +  L    S DS + + D+RA       T    A       ++ F+ + 
Sbjct: 167 DCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNKYR 226

Query: 264 SNILAAAGMDSHVYLYDLRNMKE-PL--------------------HHMSGHEDAVTNLE 302
           +N++A  G+D+ + ++DLR ++  PL                      + GHE AV  + 
Sbjct: 227 TNVIATGGVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVN 286

Query: 303 FSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPD------------DAEDGVPELIMVHAG 350
           +SPH               +W       ++T              +A D    L+     
Sbjct: 287 WSPHSSNYLLSTSYDMTCCIWQDMGYATDRTRGNNSGYGVTTGRTNASDLRNGLVSRFTA 346

Query: 351 HRSAVNDFDLNA-QVPWLIASTEEENILQVWK 381
           H   V D D +    P  +A+T  +  + VWK
Sbjct: 347 HTEFVFDGDWSLWGAPGFVATTGWDGNVFVWK 378

>KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 aa]
           {ON} weakly similar to uniprot|Q12206 YOR229W
           Saccharomyces cerevisiae WTM2 WD repeat containing
           transcriptional modulator 2
          Length = 449

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 2/108 (1%)

Query: 225 GTVSEDSLLKIND-IRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRN 283
           G   E SLLKI D  ++    I T   P    T +   H +N+ +    D+ +  YD+R 
Sbjct: 205 GPGEEHSLLKIVDNSQSPGNLIRTISIPGVSVTQSIKFHDNNMFSTCSDDNGIRFYDIRG 264

Query: 284 MKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGA 330
             +PL  +   H+  +T  + SP              L +WDL+ + A
Sbjct: 265 DGKPLWTVFEPHDGKLTCYDVSPTLETLFITGSDTGVLKLWDLRSVIA 312

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,825,757
Number of extensions: 2153407
Number of successful extensions: 7865
Number of sequences better than 10.0: 651
Number of HSP's gapped: 7375
Number of HSP's successfully gapped: 912
Length of query: 401
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 289
Effective length of database: 40,638,807
Effective search space: 11744615223
Effective search space used: 11744615223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)