Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.32na 1ON23323310421e-145
YEL057Cna 1ON2332338421e-114
Suva_5.11na 1ON2332338311e-113
Smik_5.30na 1ON2342347891e-106
TBLA0H021005.190ON2184113740.62
KNAG0B015103.358ON26083711.0
Ecym_81361.141ON135745711.7
CAGL0J06732g8.834ON98932692.7
TDEL0C027907.418ON278638665.6
KAFR0D037601.110ON130192658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.32
         (233 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.32 Chr5 complement(44026..44727) [702 bp, 233 aa] {ON} YE...   405   e-145
YEL057C Chr5 complement(45020..45721) [702 bp, 233 aa] {ON} Prot...   328   e-114
Suva_5.11 Chr5 complement(21032..21733) [702 bp, 233 aa] {ON} YE...   324   e-113
Smik_5.30 Chr5 complement(47313..48017) [705 bp, 234 aa] {ON} YE...   308   e-106
TBLA0H02100 Chr8 (504541..511095) [6555 bp, 2184 aa] {ON}              33   0.62 
KNAG0B01510 Chr2 (283072..283854) [783 bp, 260 aa] {ON} Anc_3.35...    32   1.0  
Ecym_8136 Chr8 (287415..291488) [4074 bp, 1357 aa] {ON} similar ...    32   1.7  
CAGL0J06732g Chr10 complement(645658..648627) [2970 bp, 989 aa] ...    31   2.7  
TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7....    30   5.6  
KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {...    30   8.4  

>Skud_5.32 Chr5 complement(44026..44727) [702 bp, 233 aa] {ON}
           YEL057C (REAL)
          Length = 233

 Score =  405 bits (1042), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 203/233 (87%), Positives = 203/233 (87%)

Query: 1   MANGGIQKNDNTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSHK 60
           MANGGIQKNDNTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSHK
Sbjct: 1   MANGGIQKNDNTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSHK 60

Query: 61  TCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120
           TCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH
Sbjct: 61  TCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120

Query: 121 LDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRXXXXXX 180
           LDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNR      
Sbjct: 121 LDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRVTFETV 180

Query: 181 XXXXXXXXXXXXXNDFFYEDYLILGCXXXXXXXXXXXILFISNTINFNYQTKV 233
                        NDFFYEDYLILGC           ILFISNTINFNYQTKV
Sbjct: 181 TSSIVIVSSSFIENDFFYEDYLILGCKVRRRKKFKRKILFISNTINFNYQTKV 233

>YEL057C Chr5 complement(45020..45721) [702 bp, 233 aa] {ON} Protein
           of unknown function involved in telomere maintenance;
           target of UME6 regulation
          Length = 233

 Score =  328 bits (842), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 160/233 (68%), Positives = 177/233 (75%)

Query: 1   MANGGIQKNDNTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSHK 60
           MAN GIQ+NDN   FK  QFS YSKEI++IMKKI+FLERNITQQLDTLPHFPKTLPP+HK
Sbjct: 1   MANDGIQRNDNRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNHK 60

Query: 61  TCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120
            C  R  + R  WS+QLKNLLGIYSKEEI TLDNLAATLHDQVLKLQA LFP AILKQVH
Sbjct: 61  DCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQVH 120

Query: 121 LDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRXXXXXX 180
           LDN N+EN++ILKE+TY+YLS ENC+ E KFG FIVKRIFFGDLSLGVS+L+NR      
Sbjct: 121 LDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFESA 180

Query: 181 XXXXXXXXXXXXXNDFFYEDYLILGCXXXXXXXXXXXILFISNTINFNYQTKV 233
                        +DFFYEDYLI  C           ILFIS T+NFNYQTKV
Sbjct: 181 TSSIMVVRSSFIESDFFYEDYLIFDCRAKRRKKLKRKILFISTTMNFNYQTKV 233

>Suva_5.11 Chr5 complement(21032..21733) [702 bp, 233 aa] {ON}
           YEL057C (REAL)
          Length = 233

 Score =  324 bits (831), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 180/233 (77%)

Query: 1   MANGGIQKNDNTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSHK 60
           MANGGIQKND TT  K   F T SKEI+IIMKKI+FLERNIT+QLDTLP FPKTLPP+H+
Sbjct: 1   MANGGIQKNDGTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNHE 60

Query: 61  TCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120
           T   RT + + SW  QLKNLLGIYS++EISTLDNLAATLHDQVLKLQAKLFPIAILKQVH
Sbjct: 61  TRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120

Query: 121 LDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRXXXXXX 180
           L+ +NVEN+KILKE+TYEYLSK+NCQRE KFGAFIV+RIFFGDLSLGVSILVNR      
Sbjct: 121 LNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFETV 180

Query: 181 XXXXXXXXXXXXXNDFFYEDYLILGCXXXXXXXXXXXILFISNTINFNYQTKV 233
                        NDF YEDYLI G            I+FIS TINFNYQTKV
Sbjct: 181 GSSIVVVRSSFIENDFLYEDYLIWGGGMKRRKKFKRKIVFISTTINFNYQTKV 233

>Smik_5.30 Chr5 complement(47313..48017) [705 bp, 234 aa] {ON}
           YEL057C (REAL)
          Length = 234

 Score =  308 bits (789), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 177/234 (75%), Gaps = 1/234 (0%)

Query: 1   MANGGIQKND-NTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSH 59
           M N GIQ+ND N    K  +FS YSKEI++IM+KI+FLE+NITQQL TLPHFPKTLPP+H
Sbjct: 1   MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH 60

Query: 60  KTCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQV 119
           KT   RT++ +E+WSNQL NLLGIYSK+EI TLD+LAATLHDQVL+LQ+ LFPIAIL+QV
Sbjct: 61  KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV 120

Query: 120 HLDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRXXXXX 179
           HL+N+NVEN+K+LKE+TYEYLSKENC    KFG FI+KRIFFGDLSLG+SILVNR     
Sbjct: 121 HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFET 180

Query: 180 XXXXXXXXXXXXXXNDFFYEDYLILGCXXXXXXXXXXXILFISNTINFNYQTKV 233
                         NDF YEDYLI  C           ILFIS TINFNYQTKV
Sbjct: 181 VTSSIIVVRSSFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV 234

>TBLA0H02100 Chr8 (504541..511095) [6555 bp, 2184 aa] {ON} 
          Length = 2184

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 18/113 (15%)

Query: 54  TLPPSHKTCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPI 113
           T+P S   C+ ++S  R   + +LKN +  Y    IST      TL        + LFP 
Sbjct: 16  TIPDSPSLCKAKSSNERAHLNYRLKNSIFYYLYYIISTDGKYLPTLFPDT---DSDLFPK 72

Query: 114 AILKQVHLDNNNVENRKILKEVTYEYLSKE---------NCQRERKFGAFIVK 157
            I+  + LD      +K LK   +++++K+         NC R+ + G  I +
Sbjct: 73  TIIDALPLD------KKPLKRPFFDHINKKNIINHHSGRNCSRKFRIGEPIYR 119

>KNAG0B01510 Chr2 (283072..283854) [783 bp, 260 aa] {ON} Anc_3.358
           YBR107C
          Length = 260

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 55  LPPSHKTCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIA 114
           + P    C       R++W N LKN LGI         D + + L  Q++  + KL+   
Sbjct: 77  MGPVSALCYAEDISLRDTWFNWLKNSLGIIIWPLSFNTDQMFSILDAQIVGNKGKLYDTK 136

Query: 115 ILKQVHLDNNNVENRKILKEVTY 137
           ++ Q    +N +++ +  +E+ Y
Sbjct: 137 LIFQ----DNELDDEETSQELKY 155

>Ecym_8136 Chr8 (287415..291488) [4074 bp, 1357 aa] {ON} similar to
           Ashbya gossypii AFR623W
          Length = 1357

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 14  NFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPS 58
           N +  +F T  +E+   M+K + L  + T  L   PH PK+LP S
Sbjct: 409 NHRSTRFPTTVEELAFEMQKDSMLYSDYTDPLAQRPHVPKSLPES 453

>CAGL0J06732g Chr10 complement(645658..648627) [2970 bp, 989 aa]
           {ON} similar to uniprot|Q03758 Saccharomyces cerevisiae
           YML111w BUL2 or uniprot|P48524 Saccharomyces cerevisiae
           YMR275c BUL1
          Length = 989

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 33  KITFLERNITQQLDTLPHFPKTLPPSHKTCRC 64
           K TF ER++   L   PH  +TLPP+ ++C C
Sbjct: 927 KFTF-ERDVNVHLSLDPHMKETLPPNFESCLC 957

>TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7.418
           YBL088C
          Length = 2786

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 127 ENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDL 164
           E R  + +    Y S + C +  +FG+ IV+RI  GD+
Sbjct: 636 ETRSFILQEEAMYKSIKECSKIERFGSIIVERIVIGDI 673

>KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {ON}
           Anc_1.110 YNL250W
          Length = 1301

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 18  AQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSH--KTCRCRTSKPRESWSN 75
           A+++ Y ++++ I  K+  + R   +   +   F + L  S   KT    TS   E  S+
Sbjct: 231 AKYAEYQEDVKAIEVKLNDITRRSDELFKSNQDFQEVLSKSENLKTLESLTSNEIERLSS 290

Query: 76  QLKNLLGIYSKEEISTLDNLAATLHDQVLKLQ 107
            + N + +   E    LDN + TLH++ L++Q
Sbjct: 291 SI-NAINLGKSELQDLLDNFSNTLHEKELEVQ 321

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,361,713
Number of extensions: 869133
Number of successful extensions: 2919
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2982
Number of HSP's successfully gapped: 34
Length of query: 233
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 127
Effective length of database: 41,326,803
Effective search space: 5248503981
Effective search space used: 5248503981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)