Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.316.11ON55755730050.0
Suva_5.106.11ON55355726330.0
Smik_5.296.11ON55555626290.0
YEL058W (PCM1)6.11ON55755826290.0
TPHA0M002106.11ON54556015880.0
Kpol_1032.26.11ON53955115470.0
NCAS0F002006.11ON54956115310.0
TDEL0G046006.11ON52854615190.0
SAKL0E00902g6.11ON54455915060.0
NDAI0K028906.11ON56157014940.0
KAFR0L003406.11ON54055814890.0
TBLA0G009806.11ON55857314850.0
CAGL0B03597g6.11ON54054714830.0
ZYRO0F00506g6.11ON55056014590.0
Ecym_30146.11ON55154813970.0
Kwal_56.223556.11ON54155313930.0
KLTH0C11506g6.11ON54455313900.0
ACR015W6.11ON55254813630.0
KLLA0D00858g6.11ON54155313460.0
KNAG0E009406.11ON53856013351e-179
Skud_13.4508.840ON62241910.021
TDEL0B005708.840ON63044900.024
KNAG0J002708.840ON62574890.030
Kpol_1068.88.840ON63231890.031
KLLA0D01573g8.840ON60731880.043
NCAS0C004108.840ON625118870.058
CAGL0M02981g8.840ON61728860.069
YMR278W (PGM3)8.840ON62228860.078
Kwal_27.102588.840ON62031860.079
Suva_13.4668.840ON62228860.081
NDAI0K004108.840ON62628850.092
TPHA0I002508.840ON62935850.10
TBLA0B032508.840ON64328850.11
Smik_13.4918.840ON62228850.11
ZYRO0G14190g8.840ON61028840.12
ABL126W8.840ON62452840.14
KLTH0C03872g8.840ON62150830.16
Ecym_46118.840ON63052830.17
KAFR0B039208.840ON62427830.19
SAKL0D01474g8.840ON62427820.26
SAKL0A07612g6.97ON127456810.32
KLLA0C11319g2.212ON923132780.77
ZYRO0G10670g4.129ON127048761.2
TPHA0D045407.339ON84269706.1
CAGL0J10472g5.559ON134585706.6
Skud_15.3556.97ON115066707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.31
         (557 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)  1162   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)  1018   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)  1017   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...  1017   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   616   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   600   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   594   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   589   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   584   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   580   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   578   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   576   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   575   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   566   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   542   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   541   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   540   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   529   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   523   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   518   e-179
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    40   0.021
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    39   0.024
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    39   0.030
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    39   0.031
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    39   0.043
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    38   0.058
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.069
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    38   0.078
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    38   0.079
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    38   0.081
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    37   0.092
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    37   0.10 
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    37   0.11 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    37   0.11 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    37   0.12 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    37   0.14 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    37   0.16 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    37   0.17 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    37   0.19 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    36   0.26 
SAKL0A07612g Chr1 complement(674027..677851) [3825 bp, 1274 aa] ...    36   0.32 
KLLA0C11319g Chr3 complement(971620..974391) [2772 bp, 923 aa] {...    35   0.77 
ZYRO0G10670g Chr7 complement(857355..861167) [3813 bp, 1270 aa] ...    34   1.2  
TPHA0D04540 Chr4 complement(990102..992630) [2529 bp, 842 aa] {O...    32   6.1  
CAGL0J10472g Chr10 (1023529..1027566) [4038 bp, 1345 aa] {ON} hi...    32   6.6  
Skud_15.355 Chr15 (636562..640014) [3453 bp, 1150 aa] {ON} YOR18...    32   7.5  

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/557 (100%), Positives = 557/557 (100%)

Query: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV
Sbjct: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120
           GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120

Query: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180
           EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL
Sbjct: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180

Query: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240
           SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK
Sbjct: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240

Query: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300
           KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD
Sbjct: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300

Query: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360
           GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS
Sbjct: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360

Query: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420
           TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK
Sbjct: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420

Query: 421 PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480
           PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC
Sbjct: 421 PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480

Query: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS 540
           IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS
Sbjct: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS 540

Query: 541 KLDQFCNEIVGYVKASV 557
           KLDQFCNEIVGYVKASV
Sbjct: 541 KLDQFCNEIVGYVKASV 557

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/557 (87%), Positives = 519/557 (93%), Gaps = 4/557 (0%)

Query: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           MKIDY+QLRKLY+ETC TKN+QYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV
Sbjct: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA+WEPYAMQLANAASFA  F+EFYAELVKLIE 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120

Query: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180
           EKIDL A   APH+VVGRDSRESSP+LLRCLTSTMASVFHA V+DLGCVTTPQLHY+T+L
Sbjct: 121 EKIDLDA---APHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNL 177

Query: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240
           SN+R+REG SA   ATEQDYYSFFI AFNELFTT  +EKRLSVPKLF+DTANGIGGPQLK
Sbjct: 178 SNKRQREGGSA-QVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLK 236

Query: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300
           KLLASKDW VPSD+IEI+NDKSDVPKLLN ECGADYVKTNQRLPKGLSPSS +SLYCSFD
Sbjct: 237 KLLASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFD 296

Query: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360
           GDADRVVFYYVD E KFHLLDGDKISTLFAKFLSKQLE+ANL  SLKIGVVQTAYANGSS
Sbjct: 297 GDADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSS 356

Query: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420
           T+YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFS+KFHQTIESELS+
Sbjct: 357 TSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSR 416

Query: 421 PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480
             G  LAL TL CFA LINQTVGDA+SDMLAVLATL+IL MAP +WD+EY DLPNKLVKC
Sbjct: 417 AQGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKC 476

Query: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS 540
           IVPDRSIFQTTDQERKLQNP GLQ+KIDSVI KY MGRSFVRASGTEDAVRVYAECQD +
Sbjct: 477 IVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPT 536

Query: 541 KLDQFCNEIVGYVKASV 557
           KLDQFCNE+V YVK+SV
Sbjct: 537 KLDQFCNEVVEYVKSSV 553

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/556 (87%), Positives = 520/556 (93%), Gaps = 2/556 (0%)

Query: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           MKIDYEQL +LYD+TCRTKNVQYSYGTAGFRTLAK+LDTVMFTTGILA+LRSLKLQGQYV
Sbjct: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA+WEPYAMQLAN ASFA++FEEF AEL +LIE 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120

Query: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180
           EKI L  S + PHIVVGRDSRESSPYLLRCLTSTM SVFHA+VLDLGCVTTPQLHYITDL
Sbjct: 121 EKIGLDTS-IVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDL 179

Query: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240
           SN+REREG SA   ATEQDYYSFFIGAFNELF+TY++EKRLSVP+LFID ANGIGGPQLK
Sbjct: 180 SNKREREGGSA-EVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLK 238

Query: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300
           KLL SKDWVVP DQIE+INDKSDVP+LLN ECGADYVKTNQRLPKGLSPSS +SLYCSFD
Sbjct: 239 KLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFD 298

Query: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360
           GDADRVVFYYVDSE +FHLLDGDKISTLFAKFLSKQLE+A+LE SL+IGVVQTAYANGSS
Sbjct: 299 GDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSS 358

Query: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420
           T YI++TL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQ I+SELS+
Sbjct: 359 TNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR 418

Query: 421 PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480
             G  LALKTL CF+KLINQTVGDA+SDMLAVLATLAI+KMAPM+WD+EY DLPNKLVKC
Sbjct: 419 ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478

Query: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS 540
           IVPDRSIFQT DQERKLQNPVGLQ+KID VIAKYPMGRSFVRASGTEDAVR+YAECQD S
Sbjct: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 538

Query: 541 KLDQFCNEIVGYVKAS 556
           +LDQFCNEIV  VKAS
Sbjct: 539 QLDQFCNEIVELVKAS 554

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/558 (87%), Positives = 526/558 (94%), Gaps = 4/558 (0%)

Query: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           MK+DYEQL KLYD+TCRTKNVQ+SYGTAGFRTLAK+LDTVMF+TGILAVLRSLKLQGQYV
Sbjct: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA+WEPYAMQLANAASFAT+FEEF  EL KLIE 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120

Query: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180
           EKIDL  + V PHIVVGRDSRESSPYLLRCLTS+MASVFHA+VLDLGCVTTPQLHYITDL
Sbjct: 121 EKIDLN-TTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDL 179

Query: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240
           SNRR+ EGD+A   ATEQDYYSFFIGAFNELF TY +EKRLSVPKLFIDTANGIGGPQLK
Sbjct: 180 SNRRKLEGDTA-PVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLK 238

Query: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300
           KLLAS+DW VP++Q+E+IND+SDVP+LLN ECGADYVKTNQRLPKGLSPSSF+SLYCSFD
Sbjct: 239 KLLASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFD 298

Query: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360
           GDADRVVFYYVDS  KFHLLDGDKISTLFAKFLSKQLE+A+LE SLKIGVVQTAYANGSS
Sbjct: 299 GDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSS 358

Query: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420
           TAYIK+TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH+TI+SELSK
Sbjct: 359 TAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSK 418

Query: 421 P--NGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLV 478
              NG TLAL+TL CF++LINQTVGDA+SDMLAVLATLAILKM+PM+WDEEY DLPNKLV
Sbjct: 419 SKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLV 478

Query: 479 KCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQD 538
           KCIVPDRSIFQTTDQERKL NPVGLQ KID V+AKYPMGRSFVRASGTEDAVRVYAEC+D
Sbjct: 479 KCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKD 538

Query: 539 MSKLDQFCNEIVGYVKAS 556
            SKL QFC+E+V +VKAS
Sbjct: 539 SSKLGQFCDEVVEHVKAS 556

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/560 (57%), Positives = 396/560 (70%), Gaps = 24/560 (4%)

Query: 5   YEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMI 64
           +  L  +++  C T+N +Y YGTAGFR  A  LDTVM TTG+LA LRS+ L G+ VGVMI
Sbjct: 3   WNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMI 62

Query: 65  TASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKID 124
           TASHN   DNGVKIVEPDGSML  SWEP+A +LAN ASF    +EF   L +     K+D
Sbjct: 63  TASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVD 122

Query: 125 LGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRR 184
            G   + P +VVGRDSR+S P LL+CL S    +   +++D G +TTPQLH++T+  N  
Sbjct: 123 SG---ITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTT 179

Query: 185 EREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLA 244
           +       A  TE DYYSFF+ A+  +   + + K L  P+L+ID ANGIGGP++ KL  
Sbjct: 180 KSR-----APVTEDDYYSFFMDAWVSITALHGI-KVLQSPRLYIDAANGIGGPKVSKLFE 233

Query: 245 SKDWVVP-SDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSP---SSFESLYCSFD 300
               V P + Q  ++N+    P LLN++CGADYVKTNQRLPK + P   S   +LYCSFD
Sbjct: 234 ----VWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFD 289

Query: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360
           GDADR+VFYY D++  FHLLDGDKISTLFA F+SKQL+ A L   + +GVVQTAYANG+S
Sbjct: 290 GDADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNS 349

Query: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420
           T Y+++ L+ PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF +T ES L K
Sbjct: 350 TNYLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCES-LLK 408

Query: 421 PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480
            N  +L +KTL  FA LINQTVGDA+SDML VLA L+I+K+ P  WD+EY DLPN L K 
Sbjct: 409 ENNESLEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKV 468

Query: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAEC---Q 537
           +VPDRS+F TTDQERKL  P G Q+KID+++AKY  GRSFVRASGTEDAVRVYAE    Q
Sbjct: 469 VVPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQ 528

Query: 538 DMSKLDQFCNEIVGYVKASV 557
           D + L++   E+   V ASV
Sbjct: 529 DAAALNE---EVSKAVLASV 545

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/551 (55%), Positives = 395/551 (71%), Gaps = 18/551 (3%)

Query: 10  KLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHN 69
           KL+++ C TK+ +Y YGTAGFR  A  L+TVMFTTGI+A LRS+ L G+ VGVMITASHN
Sbjct: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63

Query: 70  PYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFAT--HFEEFYAELVKLIELEKIDLGA 127
           P +DNGVKIVEP+G+ML  SWEP A +LAN A+ +T    + +  E VK    E      
Sbjct: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPE----SG 119

Query: 128 SNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRRERE 187
           S V P +VVGRDSRES  YLL CL ++  +  +A++++ G +TTPQLH++T+  N ++  
Sbjct: 120 SKVQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKS- 178

Query: 188 GDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLASKD 247
                 A  E  YY++FI ++N++   +++   L    L IDTANGIGGP++++LL  K 
Sbjct: 179 -----YAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELL--KS 230

Query: 248 WVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFES-LYCSFDGDADRV 306
           W   S ++ ++N++ + P LLN  CGAD+VKTNQ+LP G+S +S E+ LYCS+DGDADR+
Sbjct: 231 WPFAS-KVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRI 289

Query: 307 VFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYIKD 366
           VFY+ D + +FHLLDGDKISTLFAK ++K L  ANL   + +GVVQTAYANGSST Y++ 
Sbjct: 290 VFYFQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQG 349

Query: 367 TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPNGHTL 426
           TL+ PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS+ F+Q  E EL K N  ++
Sbjct: 350 TLNVPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL-KANSESI 408

Query: 427 ALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCIVPDRS 486
           A+ TL   + LINQTVGDA+SDML VL+ L+I+K++   WD EY DLPN L K IVPDRS
Sbjct: 409 AVNTLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRS 468

Query: 487 IFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSKLDQFC 546
           +F TTDQERKL +P GLQSKID  I+++  GRSFVRASGTEDAVRVYAE     +  +  
Sbjct: 469 VFITTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELN 528

Query: 547 NEIVGYVKASV 557
             +   VK SV
Sbjct: 529 ALVTKLVKESV 539

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/561 (52%), Positives = 396/561 (70%), Gaps = 18/561 (3%)

Query: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           M ID   L+++Y+ TC T++ +Y+YGTAGFR  A  LDTVMF TGI+A  RS+ L G  V
Sbjct: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120
           GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+  + FE+ Y  ++++ + 
Sbjct: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANES-FEKVYDFILEVSKD 119

Query: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180
            K     +   P +++G DSRESSP L + L +T   +++A + + G VTTPQLH+IT L
Sbjct: 120 PKFPFQEN--KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSL 177

Query: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240
            N +  +  + + +    +YY++F  ++++    YD     S   L ID+ANGIGGP++ 
Sbjct: 178 WNAKYNKNTNDVISV--DNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVT 235

Query: 241 KLLASKDWVVPS---DQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYC 297
            L+++  W  PS     + IIN+  + P LLN++CGADYVKTNQ+LPKG+   S  +L+C
Sbjct: 236 DLIST--W--PSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHC 291

Query: 298 SFDGDADRVVFYYV-DSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYA 356
           SFDGDADR+VFYY+ + + KFHLLDGDKI+TLFAKFLS  L+  NL   LK+GVVQTAYA
Sbjct: 292 SFDGDADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYA 351

Query: 357 NGSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIES 416
           NGSST Y+ + L  PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FSE+F Q +++
Sbjct: 352 NGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQN 411

Query: 417 ELSKPNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNK 476
           E       T A +TL  F K+INQTVGDAM+DML V+  L++ K+ P  WD+ YKDLPNK
Sbjct: 412 E-----PKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNK 466

Query: 477 LVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAEC 536
           L K IVPDRS+F TT+QER+L +PVGLQ KID  ++K   GRSFVRASGTEDAVRVYAE 
Sbjct: 467 LAKVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEA 526

Query: 537 QDMSKLDQFCNEIVGYVKASV 557
               + ++   E+  +V +SV
Sbjct: 527 ATQEETEKLSQEVCKFVLSSV 547

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/546 (55%), Positives = 381/546 (69%), Gaps = 27/546 (4%)

Query: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65
           E L  L ++ C T+  +Y YGTAGFR  ++ LDTVMF TGI+A LRS  L G+ VGVMIT
Sbjct: 3   EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62

Query: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDL 125
           ASHNP  DNGVK+VEPDGSML+ SWE  A +LAN  +     E+  A++ +L        
Sbjct: 63  ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIKAKVGQLTS------ 115

Query: 126 GASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRRE 185
           G S+V P ++VGRDSR S P+LL CL ++  S+F A++ D G +TTPQLH++T+      
Sbjct: 116 GESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTN------ 169

Query: 186 REGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLAS 245
            E     A   EQ Y++ F+GA++++       + + +P + +D ANGIGGP++  LL  
Sbjct: 170 -ETMITGAHVDEQAYFAHFLGAWDQIAAL----QPVKLPNVVVDCANGIGGPKMSALLTQ 224

Query: 246 KDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFDGDADR 305
             +   + Q  +INDK D P+LLN  CGAD+VKT+QRLP G+ P++   LYCSFDGDADR
Sbjct: 225 WGF---AKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNA-NDLYCSFDGDADR 280

Query: 306 VVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYIK 365
           VVFYY+D  L FHLLDGDKISTLFA F++K L+   L+  L +GVVQTAYANGSST Y++
Sbjct: 281 VVFYYLDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQ 340

Query: 366 DTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPNGHT 425
           D L  PVSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH+T+ +   +    T
Sbjct: 341 DNLQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQ----T 396

Query: 426 LALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCIVPDR 485
             LK L   AKLINQTVGDA+SDM+AVLA L+IL+ +P  WD E+ DLPNKL K +V DR
Sbjct: 397 PELKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDR 456

Query: 486 SIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSKLDQF 545
           S F TTDQER+L +P GLQ KID  +A+   GRSFVRASGTEDAVRVYAE    S+ DQ 
Sbjct: 457 SAFTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQL 516

Query: 546 CNEIVG 551
            + IVG
Sbjct: 517 -SSIVG 521

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/559 (55%), Positives = 385/559 (68%), Gaps = 21/559 (3%)

Query: 3   IDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62
           ++ + L +LYD+ C+T    Y+YGTAGFR  A  LDTVMFTTGILA +RS+ L+GQYVGV
Sbjct: 2   VNIQLLEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEK 122
           MITASHNP QDNGVKIV+P G ML  +WEP+A +LAN+AS     +E    L KLI    
Sbjct: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLITKLG 118

Query: 123 IDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSN 182
           ID      +  I + RDSRES P LL+ +      + + +V+D   +TTPQLH++T   N
Sbjct: 119 ID---DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYN 175

Query: 183 RREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVP-KLFIDTANGIGGPQLKK 241
               +G S+     E  YYS F  A+ ++   +D+    S+P ++ ID ANGIGGP++ +
Sbjct: 176 ----QGSSS--KVEESTYYSAFSSAWTKICGLHDIN---SLPYRVIIDAANGIGGPKVSE 226

Query: 242 LLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSS-FESLYCSFD 300
           +L    +   S  + +IN++   P+LLN  CGADYVKTNQ  PKG+S +S  E +YCSFD
Sbjct: 227 MLLKNKFF--SSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFD 284

Query: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360
           GDADR+VFYY D + KF+LLDGDKISTLFAKF  + L  A  E  LK+GVVQTAYANGSS
Sbjct: 285 GDADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSS 344

Query: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420
           T Y+   L  PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS++FH+TI+ +L +
Sbjct: 345 TEYLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKE 404

Query: 421 PNGHTL--ALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLV 478
           P       ALKTL  F  LINQTVGDA+SDMLAVLA L ILK +P  WD+EY DLPNKLV
Sbjct: 405 PQDEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLV 464

Query: 479 KCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQD 538
           K IVPDRS+F+T++ ER+L +P GLQ KIDS + ++  GRSFVRASGTEDAVRVYAE   
Sbjct: 465 KVIVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAAT 524

Query: 539 MSKLDQFCNEIVGYVKASV 557
             K D+    +   V  SV
Sbjct: 525 KEKADRLAASVSDLVSRSV 543

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/570 (54%), Positives = 395/570 (69%), Gaps = 29/570 (5%)

Query: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQY- 59
           M  + +QL+  ++E C+TKN  Y+YGTAGFR  AK LDTVMFTTGI+A LRSL LQ    
Sbjct: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64

Query: 60  ---VGVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVK 116
              +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+  + F+EFY  L+ 
Sbjct: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANES-FDEFYQLLID 123

Query: 117 LIELEKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHY 176
            I   + DL      P +++G DSR+SSP L+  +  +   +F+A++++   VTTPQLH+
Sbjct: 124 SIVTLENDLNIKQ-PPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHF 182

Query: 177 ITDLSNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGG 236
           +T+L+        +    A E +YY  F    ++L + Y     L    L ID ANGIG 
Sbjct: 183 LTNLT--------NTTGTAEEINYYDHFNKYLSQLQSLYP-PFNLPFDNLIIDAANGIGA 233

Query: 237 PQLKKLLASKDWVVP---SDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFE 293
           PQ++KLL +K+   P    + I+IIN+ S  P LLN  CGADYVKTNQ+LP+G+ P   +
Sbjct: 234 PQVEKLLFTKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGI-PKDID 292

Query: 294 ---SLYCSFDGDADRVVFYYVDSELK-FHLLDGDKISTLFAKFLSKQLEMANLERSLKIG 349
              +L+CS+DGDADR+VFYY+D     F+LLDGDKI+TLFAKF S  L +A L   LK+G
Sbjct: 293 ANSTLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLG 352

Query: 350 VVQTAYANGSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEK 409
           VVQTAYANGSST YI   L  PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS+K
Sbjct: 353 VVQTAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDK 412

Query: 410 FHQTIESELSK--PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWD 467
           FH    SEL+K   +G +  +KTL  F++LINQTVGDAMSDMLAV+A L+IL+++P +WD
Sbjct: 413 FH----SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWD 468

Query: 468 EEYKDLPNKLVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTE 527
           +EYKDLPNKL K IVPDRS F TTDQERKL  P GLQ  ++  +A   +GRSFVRASGTE
Sbjct: 469 KEYKDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTE 528

Query: 528 DAVRVYAECQDMSKLDQFCNEIVGYVKASV 557
           DAVRVYAE +   + +    ++   V  SV
Sbjct: 529 DAVRVYAEAKTQEETEWLSKKVCQLVIESV 558

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/558 (53%), Positives = 380/558 (68%), Gaps = 25/558 (4%)

Query: 4   DYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVM 63
           D  QL   + + C T+N  Y+YGTAGFR  A  LDTVMFTTGI+A+LRSL LQG+Y+GVM
Sbjct: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62

Query: 64  ITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKI 123
           ITASHNP QDNGVKIVEP G+ML+ SWE  A  LAN AS   +F  F   L ++I    I
Sbjct: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIAKLNI 121

Query: 124 DLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNR 183
           D       P ++VG DSRESSPYL+ CL +  A VF   V++   +TTPQLHY+T L N 
Sbjct: 122 D---ETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQND 177

Query: 184 REREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLL 243
                       TE DYY FF  ++N LF+ Y  +  L+   L +D ANG+G  Q  K L
Sbjct: 178 ----------VVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFL 226

Query: 244 ASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFDGDA 303
                +  +    IINDK +VP++LN +CGAD+VKTNQ+LP G+   +   LY SFDGDA
Sbjct: 227 PYLPQL--ATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDA 284

Query: 304 DRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAY 363
           DR+VFYYVD+  KFHLLDGDKIST+  K L   L  + L   + +GVVQTAYANGSST Y
Sbjct: 285 DRIVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKY 344

Query: 364 IKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPNG 423
           I  +L  PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF++ ++  +   NG
Sbjct: 345 ITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAID--NG 402

Query: 424 HT-----LALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLV 478
            +      A  +L  F+KLINQTVGD+M+D+LAV+ATL+IL+++P +WD EY+DLPN L 
Sbjct: 403 SSSEKIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLT 462

Query: 479 KCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQD 538
           KC V +R +F+TTD ERKL +P GLQ KID+ ++KY  GRSFVRASGTEDAVR+YAE + 
Sbjct: 463 KCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKT 522

Query: 539 MSKLDQFCNEIVGYVKAS 556
            ++++    E+   V+ S
Sbjct: 523 KAEVEALSKEVTQLVENS 540

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/573 (53%), Positives = 389/573 (67%), Gaps = 34/573 (5%)

Query: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
            ++D  +   L+ + C+TKN  Y+YGTAGFR  A  LDTVMFTTG +A LRSL   G+ V
Sbjct: 3   FQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAV 62

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120
           GVM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS     +    ELV+ +  
Sbjct: 63  GVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLAS-----QGKIDELVQFVNA 117

Query: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180
           + I+L  SN  P ++VGRDSRESS  LL CL      +F A+++D   +TTPQLH++T+ 
Sbjct: 118 KLIELN-SNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNA 176

Query: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFT-TYDMEKRLS--VPKLFIDTANGIGGP 237
            N  +           E DYY  F  A+++L +   D     S  +  L ID+ANGIGGP
Sbjct: 177 YNLEKD-------LPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGP 229

Query: 238 QLKKLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSP-----SSF 292
           +++ LL  K W   + ++ +IN+    P+ LN+ CGADYVKTNQ+LP G++      SS 
Sbjct: 230 KMENLL--KYWKT-NYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSK 286

Query: 293 ESLYCSFDGDADRVVFYYVDSELK-FHLLDGDKISTLFAKFLSKQLEMANL--ERSLKIG 349
             ++CSFDGDADRVVFYY D +   F+LLDGDKISTLFA F+S QL++A +  E  +K+G
Sbjct: 287 NVIHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLG 346

Query: 350 VVQTAYANGSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEK 409
           VVQTAYANGSST Y++  L  PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFSE 
Sbjct: 347 VVQTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSEN 406

Query: 410 FH----QTIESELSKPNGHTL-ALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPM 464
           F+    Q I +E    N   L ALKTL   + LINQTVGDA+SDM+ V+A LAIL   P 
Sbjct: 407 FYKIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQ 466

Query: 465 NWDEEYKDLPNKLVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRAS 524
            W++EY DLPNKL K +VPDRS+F+TTDQERKL +P GLQSKI+ ++AKY  GRSFVRAS
Sbjct: 467 IWNKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRAS 526

Query: 525 GTEDAVRVYAECQDMSKLDQFCNEIVGYVKASV 557
           GTEDAVRVYAE  D   +++ C E++     SV
Sbjct: 527 GTEDAVRVYAEASD--DVNKLCQEVLDATAESV 557

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/547 (55%), Positives = 375/547 (68%), Gaps = 27/547 (4%)

Query: 10  KLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHN 69
           +LY++ C T++  Y+YGTAGFR  A+ LD+VMFTTG++A LRS+  Q   VGVMITASHN
Sbjct: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 70  PYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDLGASN 129
           P +DNGVKIVE DGSMLL  WEP A +LAN+ +    +  F + L  +++   I  G   
Sbjct: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA---DYHTFESTLNAIMQELNISPGH-- 118

Query: 130 VAPHIVVGRDSRESSPYLLRCLTSTMASVF-HARVLDLGCVTTPQLHYITDLSNRREREG 188
            AP IVVG DSRESSP LL  L   + +V   AR+ + G +TTPQLH++T          
Sbjct: 119 -APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT---------- 167

Query: 189 DSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLASKDW 248
             A  A  E  YY +F+ A+N+LF  Y +E   S  KL IDTANGIGGPQ  K+L+    
Sbjct: 168 --ANPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQT 225

Query: 249 VVPS------DQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFDGD 302
            +P        QI+I N+    P +LNS CGAD+VKTNQRLP+G++     +LYCSFDGD
Sbjct: 226 DLPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADP-RNLYCSFDGD 284

Query: 303 ADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTA 362
           ADRVVFYYVD  L FHLLDGDKISTL A F++  L+ A L   LK+GVVQTAYANGSST 
Sbjct: 285 ADRVVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTT 344

Query: 363 YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPN 422
           Y+   L  PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F++ IE  L+K N
Sbjct: 345 YVTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAK-N 403

Query: 423 GHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCIV 482
            H  +  TL   ++LINQT+GDA+SDMLA++  L IL  +P  WD EY DLPNKL K +V
Sbjct: 404 AHDKSTLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVV 463

Query: 483 PDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSKL 542
           PDRSIF TTDQER+L +P GLQ KID ++A  P GRSF+RASGTEDAVRVYAE Q +   
Sbjct: 464 PDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEAT 523

Query: 543 DQFCNEI 549
           ++   E+
Sbjct: 524 EKLSTEV 530

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/560 (51%), Positives = 377/560 (67%), Gaps = 24/560 (4%)

Query: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65
           + L KL D+ C   +  Y YGTAGFR  A  LDTV+F TGILA LRSL L+G  +GVM+T
Sbjct: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64

Query: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELE-KID 124
           ASHNP  DNGVK+VEPDGSM+  SWEP A +LAN  +      E        ++ E K  
Sbjct: 65  ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124

Query: 125 LGASN------VAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYIT 178
           L ++N      + P +VVGRDSRES P LL CL ++   +FHA++ D G +TTPQLH++T
Sbjct: 125 LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184

Query: 179 DLSNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRL-SVPKLFIDTANGIGGP 237
                   E    +A  TE  YY  F+ A++ +   + + + L ++  L ID ANGIG P
Sbjct: 185 S-------ETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAP 237

Query: 238 QLKKLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYC 297
           ++++LL+   W     Q+  INDK   P+LLN ECGAD+VK+NQR P G + S+   L C
Sbjct: 238 KVQELLS--QWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGC 292

Query: 298 SFDGDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYAN 357
           S+DGDADRVVFYY++   +F LLDGD+IS LFA F +  L+ A L+  L +GVVQTAYAN
Sbjct: 293 SYDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYAN 352

Query: 358 GSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESE 417
           G+ST Y++ TL  PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++ I+ +
Sbjct: 353 GNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQ 412

Query: 418 LSKPNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKL 477
             +    ++A++TL  F++LINQTVGDA+SDML VLA L+I K  P +W +E+ DLPN+L
Sbjct: 413 KER----SVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRL 468

Query: 478 VKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQ 537
            K +VPDRS+F TTDQER+L  P GLQ KID  +  +  GRSFVRASGTEDAVRVYAE  
Sbjct: 469 AKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAA 528

Query: 538 DMSKLDQFCNEIVGYVKASV 557
            +  +++  N +   V  SV
Sbjct: 529 SLEDVEKLSNTVKELVVKSV 548

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/548 (53%), Positives = 370/548 (67%), Gaps = 16/548 (2%)

Query: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65
           E++ KLYD+ C ++  +Y YGTAGFR  A+ LDTV+FTTG+LA LRS+ L+GQYVG MIT
Sbjct: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDL 125
           ASHNP QDNGVK+V+P G ML   WE YA +LAN AS   H  +F   L +L  + +  +
Sbjct: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKH--QFLHRLQEL--MNQFGI 119

Query: 126 GASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRRE 185
            A + A  IVV RDSRES   LL+ L    +   +  ++D   +TTPQLH++T   NR +
Sbjct: 120 KADSEA-RIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNR-Q 177

Query: 186 REGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLAS 245
            E +  +    E  YYS F+ A  EL   +++   L  P L ID ANG+GG + ++L   
Sbjct: 178 MESERVIEV-NEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMK 234

Query: 246 KDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSS-FESLYCSFDGDAD 304
             +    D   IIN       LLNS CGADYVKTNQ LP+G+S ++   SL+CSFDGDAD
Sbjct: 235 NTFF--KDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDAD 292

Query: 305 RVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYI 364
           RV+FYY D +  FHLLDGDKISTLFAKF    L +A ++ ++K+GVVQTAYANGSST Y+
Sbjct: 293 RVIFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYL 352

Query: 365 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPN-- 422
            + L  PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFSE F+ T+   L + +  
Sbjct: 353 SEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLS 412

Query: 423 -GHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCI 481
               +ALKTL  F+KLINQTVGDAMSDM+AVLA L ILK  P  WD EY DLPN L+K +
Sbjct: 413 AESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVV 472

Query: 482 VPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSK 541
           VPDRS+F+TT+ ER+L +P GLQ++ID VI  Y   RSFVRASGTEDAVR+YAE     +
Sbjct: 473 VPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQ 532

Query: 542 LDQFCNEI 549
            D    +I
Sbjct: 533 ADDLSIKI 540

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/553 (53%), Positives = 377/553 (68%), Gaps = 31/553 (5%)

Query: 3   IDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62
           +D + L+ LY+  C T    Y+YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ VGV
Sbjct: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEK 122
           MITASHNP +DNGVKIV+P G ML  SWE YA  LAN+AS    F EF A + +L  + K
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERL--MTK 116

Query: 123 IDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSN 182
           +++G SN    IVV RDSRES P LL    S +  + + +V D G +TTPQLH++T  SN
Sbjct: 117 LEVG-SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSN 175

Query: 183 RREREGDSALAAATEQD---YYSFFIGAFNELFTTYDMEKRLSVP-KLFIDTANGIGGPQ 238
                    L   TE     YY  F+ A+ E+    ++ K  S+P KL ID ANGIG P 
Sbjct: 176 E--------LPKGTEIGKSLYYDNFLSAWVEI---AELCKIDSLPYKLEIDAANGIGAPV 224

Query: 239 LKKLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFES-LYC 297
           + ++L+   +        ++ND+ + P  LN  CGAD+VKTNQ+LP G++P    + + C
Sbjct: 225 VTEMLSQHKFF--KGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICC 282

Query: 298 SFDGDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYAN 357
           SFDGDADR+VFYY      FHLLDGDK++TLFAKF  + L  A L+  L++GVVQTAYAN
Sbjct: 283 SFDGDADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYAN 342

Query: 358 GSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESE 417
           GSSTAYI+  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF   I+ +
Sbjct: 343 GSSTAYIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRK 401

Query: 418 LSK---PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLP 474
           LS+    +    +LK L  FAKLINQTVGDA+SDMLAVLA L+ILK +P  WDEEY DLP
Sbjct: 402 LSEKLESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLP 461

Query: 475 NKLVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYA 534
           NKL+K +VPDR++F+T + ER+L +P G+Q KID+++A +  GRSFVRASGTEDAVRVYA
Sbjct: 462 NKLIKVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYA 521

Query: 535 EC---QDMSKLDQ 544
           E    Q+   L Q
Sbjct: 522 EAATPQETEALSQ 534

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/553 (51%), Positives = 379/553 (68%), Gaps = 24/553 (4%)

Query: 3   IDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62
           +D + L  LY+  C++    Y+YGTAGFR  A  LDTVMFTTG+LA LRS+ L+G+ VGV
Sbjct: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFA-THFEEFYAELVKLIELE 121
           MITASHNP +DNGVKIV+P G ML  SWE YA  LAN+A+ + T F  +   LV  + L+
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120

Query: 122 KIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLS 181
              LG+      + V RDSRES P LL  L +    + + R+ D G +TTPQLH++T  S
Sbjct: 121 TDALGS------LAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLT--S 172

Query: 182 NRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVP-KLFIDTANGIGGPQLK 240
            R E   D+A+       YY  F+ A++++     ++   S+P KL ID ANGIG P++K
Sbjct: 173 KRNELPNDTAIDRFF---YYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVK 226

Query: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSS-FESLYCSF 299
           ++L++  +        ++ND  + P  LN  CGADYVKTNQRLP G+  ++  + + CSF
Sbjct: 227 EMLSTHKFF--DGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSF 284

Query: 300 DGDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGS 359
           DGDADR+VFY+ DSE +F LLDGDK++TLFAKF    L  ANL+  L +GVVQTAYANGS
Sbjct: 285 DGDADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGS 344

Query: 360 STAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELS 419
           ST YI+  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FS+KF + + S LS
Sbjct: 345 STHYIERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLS 403

Query: 420 ---KPNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNK 476
              + +    +L+ LS FA LINQTVGDA+SDM+ VLA L+ILK  P  W++EY DLPNK
Sbjct: 404 NKHQSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNK 463

Query: 477 LVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAEC 536
           LVK +VPDR++F+TT+ ER+L +P+GLQ KI++++A+Y   RSFVRASGTEDAVRVYAE 
Sbjct: 464 LVKVLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEA 523

Query: 537 QDMSKLDQFCNEI 549
               + D   + +
Sbjct: 524 STREEADSLASRV 536

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/548 (51%), Positives = 360/548 (65%), Gaps = 19/548 (3%)

Query: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65
           +++ KLYD   R     Y+YGTAGFR+ A+ L  V+F TG+LA LRSL L G YVGVM+T
Sbjct: 5   QEMVKLYDRH-RGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDL 125
           ASHNP +DNGVK+V+P G ML A WE +A  LAN AS     +E    L  L++   +DL
Sbjct: 64  ASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQ--QELLDALHMLVDRLGLDL 121

Query: 126 GASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRRE 185
               +   +VV RDSR S P LL  L      +    V+D G +TTPQLH++T   N R 
Sbjct: 122 A---LRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER- 177

Query: 186 REGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLAS 245
                + A   E  YY+ F+ A  EL   + +E  L  P L +DTANG+G  + ++L   
Sbjct: 178 ----GSAAGVREDLYYAHFVAALEELAALHGLET-LPFP-LVVDTANGVGALKARELFRR 231

Query: 246 KDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSF-ESLYCSFDGDAD 304
                  +++ IIND     +LLNS CGADYVKT Q LP+G+S     ESL+CS+DGDAD
Sbjct: 232 SPLF--KNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDAD 289

Query: 305 RVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYI 364
           RV+FYY+D + +FHLLDGDKISTL AKFL   L  A +   + +GVVQTAYANGSST Y+
Sbjct: 290 RVIFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYL 349

Query: 365 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKP--- 421
            + L  PVSCT TGVKHLH EA  +YD+GIYFEANGHGT+IFSE F  T+E  L  P   
Sbjct: 350 SEVLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALS 409

Query: 422 NGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCI 481
               L+L+TL  FA LINQT+GDA++DMLAV+A L+IL  +P +WD++Y DLPN LVK +
Sbjct: 410 AKARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVV 469

Query: 482 VPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSK 541
           VPDRS+F+TT+ E++L +P GLQ  ID ++  Y  GRSFVRASGTEDAVR+YAE     +
Sbjct: 470 VPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQ 529

Query: 542 LDQFCNEI 549
            D+   ++
Sbjct: 530 ADELATKV 537

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/553 (51%), Positives = 378/553 (68%), Gaps = 23/553 (4%)

Query: 8   LRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITAS 67
            R LY++ C+  +  Y+YGTAGFR     LDTVMFTTGI+AVLRS+ L+ ++VGVMITAS
Sbjct: 3   FRDLYEQYCKQGHA-YTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61

Query: 68  HNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDLGA 127
           HNP +DNGVK+VEP G ML+ +WEP A +LANAAS  + F +  + L  +I    ID   
Sbjct: 62  HNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIAELNID--- 116

Query: 128 SNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHA-RVLDLGCVTTPQLHYITDLSNRRER 186
           +    +I V RDSRES P LL  L + + SVF A +++D   +TTPQLH++    N    
Sbjct: 117 TTQLANITVARDSRESGPRLLAALKAGI-SVFPAVKIIDFELLTTPQLHFLVYSLNT--- 172

Query: 187 EGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVP-KLFIDTANGIGGPQLKKLLAS 245
              S  +   +  YY  F+  +N+L   Y++ +   +P  L ID ANGIG  ++K+L++ 
Sbjct: 173 --SSQPSQVRDSTYYDHFVSIWNQLTQLYEVTE---LPFHLTIDCANGIGADKVKQLISQ 227

Query: 246 KDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFDGDADR 305
              ++  + +  +N ++   +LLN  CGAD+VKTNQ  P   +P   + LYCSFDGDADR
Sbjct: 228 AGHML-ENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKPSQ-LYCSFDGDADR 285

Query: 306 VVFYYVDS-ELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYI 364
           VVFYYVD  E KFHLLDGDKI+TL AK ++  L    L  +LK+GVVQTAYANGSST YI
Sbjct: 286 VVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYI 345

Query: 365 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPNGH 424
            D L  PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS +F +T++S L + +G+
Sbjct: 346 TDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGN 405

Query: 425 T---LALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCI 481
                +L +L   ++LINQTVGDA+SDMLAV+ATL+I  + P +WD  Y+DLPN+L K I
Sbjct: 406 EQQYKSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVI 465

Query: 482 VPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSK 541
           VPDRS+F +T+ ER+L +P GLQ+KID ++ ++P  RSFVRASGTEDAVRVYAE +    
Sbjct: 466 VPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTES 525

Query: 542 LDQFCNEIVGYVK 554
             +   ++   VK
Sbjct: 526 AIELATKVGELVK 538

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  518 bits (1335), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 279/560 (49%), Positives = 361/560 (64%), Gaps = 33/560 (5%)

Query: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65
           E +R ++D  C TK   Y+YGTAGFR  A  LDTVMF TG +AVLRS +L G  VGVM+T
Sbjct: 4   EAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDL 125
           ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+  T F++++     L+E      
Sbjct: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGT-FDQWWEYWTSLVEEGNYTG 122

Query: 126 GASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARV-LDLGCVTT-PQLHYITDLSNR 183
           GA      + VG D+RESSP LL+ L     +V    + +    +T  PQLHY+T L   
Sbjct: 123 GA-----RLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL--- 174

Query: 184 REREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLL 243
            +R+G +  AA     Y   F G + +LF   D        +LFIDTANG+G  QL++  
Sbjct: 175 -QRDGVTDAAA-----YNDHFQGCWQKLFP--DGVVAWPFDRLFIDTANGVGAVQLQQFF 226

Query: 244 ASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLP------KGLSPSSFESLYC 297
             K W V  ++  ++N     P+ LN +CGAD+VKTN RLP      +G S  +   LYC
Sbjct: 227 --KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTS-GALPDLYC 283

Query: 298 SFDGDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYAN 357
           SFDGDADR+VFY+V ++ +FHLLDGDKISTLFAKF+ +    A  +  L +GVVQTAYAN
Sbjct: 284 SFDGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYAN 342

Query: 358 GSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESE 417
           G+ST YI   L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS+KF++ +   
Sbjct: 343 GNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGV 402

Query: 418 LSKPNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKL 477
            S  +    A  TL  F+KLINQTVGDA++DML VLA L  L+  P  W  EY DLPN L
Sbjct: 403 ASTND----AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLL 458

Query: 478 VKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQ 537
            K +VPDRSIF+TTDQER+L +P GLQ KID+ + ++   RSFVRASGTE+AVR+Y E +
Sbjct: 459 TKVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAE 518

Query: 538 DMSKLDQFCNEIVGYVKASV 557
           D  ++ +   ++   V  SV
Sbjct: 519 DPQEVQELSKQVTEAVLNSV 538

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANA 100
           VGVMITASHNP  DNG K+   +G  ++    P+   ++NA
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDQAISNA 188

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANA 100
           G  VGVMITASHNP  DNG K+   +G  ++    P+  ++A +
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDSEIAQS 196

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 28  AGFRTLAKDL-DTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86
           AGF+ L  +  DT++ T  +   +  L      VGVMITASHNP  DNG K+   +G  +
Sbjct: 124 AGFKVLYLNPGDTLVHTPLVPFTVDHLNAS---VGVMITASHNPKMDNGYKVYFANGCQI 180

Query: 87  LASWEPYAMQLANA 100
           +    P+ + +A +
Sbjct: 181 IP---PHDLNIARS 191

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G  VG+MITASHNP  DNG K+   +G  ++
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 47/118 (39%), Gaps = 14/118 (11%)

Query: 28  AGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVK--------IV 79
           AGF+      D   F    L     L L+   VGVMITASHNP  DNG K        I+
Sbjct: 123 AGFKVFYLTPDD-QFVHTPLVPFSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQII 180

Query: 80  EPD----GSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDLGASNVAPH 133
            P       M+  + EP++      A+F    E      +K +  EK  +    V  H
Sbjct: 181 PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIH 238

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           +GVMITASHNP  DNG K+   +G  ++
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 53  LKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           + L    +GVMITASHNP  DNG K+   +G  ++
Sbjct: 150 INLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 36  DLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           D D  + T  +   + +++      GVMITASHNP  DNG K+   +G  ++
Sbjct: 135 DEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQII 186

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 38  DTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           D V+ T  +   +  L+  G   G+MITASHNP  DNG K+   +G  ++
Sbjct: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQII 183

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 35  KDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86
           KD+++ + T  +   + +++  G   G+MITASHNP  DNG K+   +G  +
Sbjct: 139 KDVESYVHTPMVPFTVSNIE-GGASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182

>SAKL0A07612g Chr1 complement(674027..677851) [3825 bp, 1274 aa]
           {ON} similar to uniprot|P21339 Saccharomyces cerevisiae
           YOR188W MSB1 Protein involved in positive regulation of
           both 1 3-beta-glucan synthesis and the Pkc1p-MAPK
           pathway potential Cdc28p substrate multicopy suppressor
           of temperature-sensitive mutations in CDC24 and CDC42
           and of mutations in BEM4
          Length = 1274

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 313 SELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYIKDTL 368
           S+  FHLL      +    F+S+ LE ANL R+LK  +  + Y    STAY  +T+
Sbjct: 264 SDAMFHLL-----LSFIRSFVSQDLESANLPRALKSVLFNSEYPPSGSTAYSSETI 314

>KLLA0C11319g Chr3 complement(971620..974391) [2772 bp, 923 aa] {ON}
           similar to uniprot|P14242 Saccharomyces cerevisiae,
           YNL082W
          Length = 923

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 57/132 (43%), Gaps = 16/132 (12%)

Query: 3   IDYEQLRKLYDETCRT-KNVQYSYGTAGFRTLAKDLD----------TVMFTTGILAVLR 51
           +DY ++ K  +ET ++  NVQY      FR   K LD          ++ +   +L  LR
Sbjct: 287 VDYPKVAKTINETYQSFNNVQYPSFVLDFRVGTKFLDLNVTPDKRTVSLHYEEYVLDALR 346

Query: 52  -SLKLQGQYVGVMI----TASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATH 106
            SL+L  Q  G ++    T S NP+    +K+   D S L  S     +   N     T 
Sbjct: 347 ESLQLFFQKQGFVVPKSETTSDNPFGPKRIKVEPLDASTLHNSENSKIISNGNHLRHPTI 406

Query: 107 FEEFYAELVKLI 118
            ++   EL +LI
Sbjct: 407 IKDEVHELPRLI 418

>ZYRO0G10670g Chr7 complement(857355..861167) [3813 bp, 1270 aa] {ON}
            similar to uniprot|P39702 Saccharomyces cerevisiae
            YAL002W VPS8 involved in vacuolar protein sorting
            required for localization and trafficking of the CPY
            sorting receptor Vps8p is a membrane-associated
            hydrophilic protein which contains a C-terminal
            cysteine-rich region that conforms to the H2 variant of
            the RING finger Zn2 binding motif.
          Length = 1270

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 210  ELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLASKDWVVPSDQIEI 257
            ++FTTYD+E+ +S   L I   + +G  QL +   +K W + +D+ EI
Sbjct: 1152 DVFTTYDIERHISRLILEIVQESSVGVGQLYESTLTKGWPIENDECEI 1199

>TPHA0D04540 Chr4 complement(990102..992630) [2529 bp, 842 aa] {ON}
           Anc_7.339 YLR207W
          Length = 842

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 11/69 (15%)

Query: 397 EANGHGTIIFSEKFHQT----------IESELSKPNGHTLALKTLSCFAKLINQTVGDAM 446
           EA G+ TI  S+KF+ T          +  E   PN  TLA   L+ + ++I  T G+A+
Sbjct: 96  EAIGYLTIS-SDKFNNTAATLLLAQIHLWGEYGYPNNKTLAYSYLNKYNEMIGFTDGEAL 154

Query: 447 SDMLAVLAT 455
            D+  +L+T
Sbjct: 155 FDLAVMLST 163

>CAGL0J10472g Chr10 (1023529..1027566) [4038 bp, 1345 aa] {ON} highly
            similar to uniprot|P38931 Saccharomyces cerevisiae
            YDR443c SCA1 DNA-directed RNA polymerase II
          Length = 1345

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 38/85 (44%), Gaps = 5/85 (5%)

Query: 470  YKDLPNKLVKCI-----VPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRAS 524
            Y  LPNK++K       +P++  F+T+ Q    +    +       + K  M  +   ++
Sbjct: 1054 YNILPNKMIKFTHIRKQIPEKLTFKTSQQASAFKYDAYIHLAYSRSVDKQWMFAALSDSA 1113

Query: 525  GTEDAVRVYAECQDMSKLDQFCNEI 549
            G E+ ++ +      +K D+ CN I
Sbjct: 1114 GKENMMKTWYLGSSKNKFDEACNHI 1138

>Skud_15.355 Chr15 (636562..640014) [3453 bp, 1150 aa] {ON} YOR188W
           (REAL)
          Length = 1150

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 6/66 (9%)

Query: 313 SELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYIKDT-LHCP 371
           S+  FHLL           F+ + LE A L RSLK  +    Y    STAY  +T L  P
Sbjct: 269 SDAMFHLLLA-----FLRSFVPQDLESAKLPRSLKGLLFNNQYPPTKSTAYTSETILTIP 323

Query: 372 VSCTKT 377
           +   KT
Sbjct: 324 LVTLKT 329

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,973,829
Number of extensions: 2432869
Number of successful extensions: 6469
Number of sequences better than 10.0: 53
Number of HSP's gapped: 6544
Number of HSP's successfully gapped: 53
Length of query: 557
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 442
Effective length of database: 40,294,809
Effective search space: 17810305578
Effective search space used: 17810305578
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)