Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.306.12ON74743915e-51
YEL059C-A (SOM1)6.12ON74743394e-43
Smik_5.286.12ON74743195e-40
Suva_5.96.12ON73733171e-39
KLLA0D00880g6.12ON71731642e-16
Kpol_1032.36.12ON78811503e-14
Ecym_30156.12ON70731443e-13
TPHA0M002206.12ON78791356e-12
SAKL0E00924g6.12ON97801351e-11
Kwal_56.223596.12ON91731281e-10
TDEL0G045906.12ON74771261e-10
ACR014C6.12ON70731252e-10
KLTH0C11484g6.12ON89731262e-10
ZYRO0F00528g6.12ON77731182e-09
NCAS0F002106.12ON79831043e-07
KAFR0L003506.12ON7163982e-06
KNAG0E009306.12ON10964942e-05
TBLA0G009906.12ON7886740.011
TBLA0B090602.437ON33726650.50
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.30
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...   155   5e-51
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...   135   4e-43
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...   127   5e-40
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...   126   1e-39
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    68   2e-16
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    62   3e-14
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    60   3e-13
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    57   6e-12
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    57   1e-11
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    54   1e-10
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    53   1e-10
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    53   2e-10
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    53   2e-10
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    50   2e-09
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    45   3e-07
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    42   2e-06
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    41   2e-05
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    33   0.011
TBLA0B09060 Chr2 complement(2151349..2152362) [1014 bp, 337 aa] ...    30   0.50 

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score =  155 bits (391), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 61 SATDYEVTDTYTNS 74
          SATDYEVTDTYTNS
Sbjct: 61 SATDYEVTDTYTNS 74

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score =  135 bits (339), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (91%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPTTIR+RDQALAPLA LDS T C+LKELVQWECQF+ A+YVC PFKRLFE CIAPDK
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 61 SATDYEVTDTYTNS 74
          SAT+YEVTDTYTNS
Sbjct: 61 SATNYEVTDTYTNS 74

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score =  127 bits (319), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 63/74 (85%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPTTIRSRDQALAPL ALDS   CQLKELVQWECQF+ ADYVC PFKRLFE C+   K
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 61 SATDYEVTDTYTNS 74
           AT+YEVTDTYTNS
Sbjct: 61 PATNYEVTDTYTNS 74

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score =  126 bits (317), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (87%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPTTIR+RDQALAPLA LDS T C LKELVQWECQF+ ADYVC PF+RLFE C AP +
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 61 SATDYEVTDTYTN 73
          +AT+YEVTDTYTN
Sbjct: 61 AATNYEVTDTYTN 73

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 67.8 bits (164), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPT I   D        L     C LK LVQ EC F   DYVC PFKRLFE+C+  D 
Sbjct: 1  MAPPTKILGLD---TQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57

Query: 61 SATDYEVTDTYTN 73
             + EVT+  TN
Sbjct: 58 RVLNIEVTNLNTN 70

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 62.4 bits (150), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 12/81 (14%)

Query: 1  MAPPTTIRSRDQALAPLAAL----DSHTRCQLKELVQWECQFR---EADYVCFPFKRLFE 53
          MAPPT I+SR++ L     L    +   +C L  + Q++C+F    E +Y+C PFKRLFE
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 54 RCIAPDKSATDYEVTDTYTNS 74
           C     S    EVTD +TN+
Sbjct: 61 EC-----SGIRIEVTDRFTNN 76

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 60.1 bits (144), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPT I +RD+ + P+  L     C L  L+Q EC F   +YVC PFKRLFE C   +K
Sbjct: 1  MAPPTPIITRDE-VEPI--LSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTL-NK 56

Query: 61 SATDYEVTDTYTN 73
               EVTD  TN
Sbjct: 57 RRVRIEVTDISTN 69

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 56.6 bits (135), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTR--CQLKELVQWECQFREAD---YVCFPFKRLFERC 55
          MAP T +  R+   A L A     R  C+LK L Q+ECQF + +   Y+C PFKRLFE C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 56 IAPDKSATDYEVTDTYTNS 74
               + T YE T   TNS
Sbjct: 61 -----AGTSYETTAQPTNS 74

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 56.6 bits (135), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPT +  +D+  + L  +     C LK L+Q EC F   +Y+C PFKRLF+ C+   K
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPP--CTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSK 58

Query: 61 S-------ATDYEVTDTYTN 73
          +           E+TD +TN
Sbjct: 59 TKDGRTSRTVRIEITDRHTN 78

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 53.9 bits (128), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPT +  +++ L PL   +    C  K L Q EC F    YVC PFKR+F+ C    K
Sbjct: 1  MAPPTVVFGKEE-LEPLLR-NVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK 58

Query: 61 SATDYEVTDTYTN 73
          S    EVTD  TN
Sbjct: 59 SIR-IEVTDRNTN 70

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 53.1 bits (126), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREAD---YVCFPFKRLFERCIA 57
          MAPPT + +R++    L  +     C LK L Q++CQ R A    Y C PFKRLF+ C  
Sbjct: 1  MAPPTPVLAREE----LPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRD 56

Query: 58 P-DKSATDYEVTDTYTN 73
          P  +  +  EVT   TN
Sbjct: 57 PSGRFKSRIEVTSPLTN 73

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 52.8 bits (125), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPT + +R++ +AP  AL +   C L  L Q EC F    YVC PF+RLF  C   +K
Sbjct: 1  MAPPTPVLTREE-VAP--ALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTL-NK 56

Query: 61 SATDYEVTDTYTN 73
               E+T+  TN
Sbjct: 57 RRVRIEITERNTN 69

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 53.1 bits (126), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAPPT +  +++         +   C LK LVQ EC+F   +YVC PFKRLF+ C A  K
Sbjct: 1  MAPPTLVFGKEELKGIWE--KAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGA-GK 57

Query: 61 SATDYEVTDTYTN 73
               EVTD  TN
Sbjct: 58 RIVRIEVTDQDTN 70

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 50.1 bits (118), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 1  MAPPTTIRSRDQALAP---LAALDSHTRCQLKELVQWECQFRE-ADYVCFPFKRLFERCI 56
          MAPPT I + +Q       +  L    +C+LK L Q  C      +Y+C PFKR+FE+C+
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 57 APDKSATDYEVTD 69
                TD +  D
Sbjct: 61 GHALEVTDADTND 73

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 44.7 bits (104), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 15/83 (18%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTR---------CQLKELVQWECQFRE-ADYVCFPFKR 50
          MAPP  +  +D      A  ++ T          C+  +L Q++CQ  E   Y+CFPFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 51 LFERCIAPDKSATDYEVTDTYTN 73
          +F+ C          EVT+  +N
Sbjct: 61 VFQEC-----QGVRTEVTNVDSN 78

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 42.4 bits (98), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYV-CFPFKRLFERCIAPD 59
          MAP   +   D A   +   +    CQL  LVQ+ C++R    + CFPFKR+F  C+  D
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEG---CQLYSLVQYNCEYRVGGTLECFPFKRMFLECL--D 55

Query: 60 KSA 62
          KS 
Sbjct: 56 KSG 58

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 40.8 bits (94), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60
          MAP   + +R+    P         C LKELVQ+ C+     + C PF+RLFE+C  P +
Sbjct: 1  MAPNVRVLTRNDVPLP----QPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC--PSQ 54

Query: 61 SATD 64
            T+
Sbjct: 55 EGTN 58

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 33.1 bits (74), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 22/86 (25%)

Query: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKE------------LVQWECQFREADYV-CFP 47
          MAPP TI+++++    L  L+   R   K+            + Q+EC   +   + CFP
Sbjct: 1  MAPPVTIQTKEE----LDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFP 56

Query: 48 FKRLFERCIAPDKSATDYEVTDTYTN 73
          FKR+F++           E+TD  TN
Sbjct: 57 FKRIFQQV-----GEYRREITDETTN 77

>TBLA0B09060 Chr2 complement(2151349..2152362) [1014 bp, 337 aa]
           {ON} Anc_2.437 YMR111C
          Length = 337

 Score = 29.6 bits (65), Expect = 0.50,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 21/26 (80%)

Query: 9   SRDQALAPLAALDSHTRCQLKELVQW 34
           +R+QA+  +A+++S+ RC L +LVQ+
Sbjct: 290 TREQAIRAVASVESYERCTLPKLVQY 315

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.132    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,661,195
Number of extensions: 223564
Number of successful extensions: 315
Number of sequences better than 10.0: 19
Number of HSP's gapped: 309
Number of HSP's successfully gapped: 19
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)