Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.296.14ON60860829420.0
Smik_5.276.14ON60862425120.0
YEL060C (PRB1)6.14ON63548523930.0
Suva_5.76.14ON66448323180.0
SAKL0E01012g6.14ON54448817800.0
TDEL0G045506.14ON56448317500.0
Kwal_56.223876.14ON54348616970.0
KLTH0C11396g6.14ON55049416750.0
NCAS0F002206.14ON69545616820.0
KLLA0D00979g6.14ON56162116470.0
TBLA0A073006.14ON57347516180.0
NDAI0K028806.14ON70449116240.0
CAGL0B03619g6.14ON46847215530.0
ZYRO0C07942g6.14ON54850015480.0
ACR012C6.14ON54149915260.0
Kpol_1032.56.14ON68048815230.0
KNAG0E009206.14ON53148414690.0
KAFR0L003606.14ON50243714370.0
Kpol_1045.756.14ON47748014000.0
Ecym_30186.14ON57550414070.0
TPHA0M002306.14ON58544613141e-175
Suva_15.1786.14ON47642413021e-175
Smik_15.1726.14ON47841712831e-172
Skud_15.1646.14ON48241712821e-171
YOR003W (YSP3)6.14ON47841712531e-167
CAGL0E02651g6.14ON48543410811e-141
KAFR0B065506.14ON45641810121e-131
NCAS0D026306.14ON4514279571e-123
NDAI0I022806.14ON4823428521e-107
KNAG0F02970singletonON4203528261e-104
CAGL0L13266gsingletonON5794387942e-97
NCAS0D043906.313ON4924054922e-54
ZYRO0D08822g6.313ON4903804834e-53
Kpol_1028.616.313ON5183214751e-51
Suva_3.846.313ON5273234732e-51
Smik_3.1496.313ON4913234695e-51
SAKL0A02002g6.313ON4794294651e-50
TDEL0A072806.313ON4363734593e-50
YCR045C (RRT12)6.313ON4913274616e-50
KNAG0I024706.313ON4754064544e-49
Kpol_1018.56.313ON4653204518e-49
Skud_3.1246.313ON5403234551e-48
KAFR0J024506.313ON4783594441e-47
KLTH0A06094g6.313ON4963194352e-46
TBLA0F039706.313ON7343354444e-46
CAGL0L10802g6.313ON5173454312e-45
NDAI0I005606.313ON4833954292e-45
Ecym_21056.313ON6103224316e-45
TPHA0D037606.313ON6073204174e-43
AAR069W6.313ON7683254191e-42
Kwal_23.61836.313ON4933263975e-41
KLLA0F06028g6.313ON5083253914e-40
Kwal_33.133721.78ON3773103333e-33
TBLA0A067006.313ON4972583217e-31
KLTH0F02288g1.78ON3803683078e-30
Kpol_2000.691.78ON3863122929e-28
ZYRO0F16764g1.78ON3863552672e-24
TPHA0B045201.78ON3883532512e-22
TDEL0C062301.78ON3643342324e-20
TBLA0A054101.78ON3822802061e-16
NCAS0A008802.6ON83366790.56
SAKL0G00440g2.6ON83663790.60
ZYRO0F15598g2.6ON79063780.73
CAGL0J07546g2.6ON789248780.79
Skud_7.10na 1ON56670771.1
Skud_14.1012.6ON81967761.4
NCAS0F004905.85ON98763742.7
TBLA0B001302.6ON84259733.3
YNL238W (KEX2)2.6ON81464733.6
Suva_14.1062.6ON80964723.7
Kwal_56.233206.80ON60438724.4
KNAG0A041808.463ON85659715.3
KAFR0A080402.6ON76663715.6
Smik_14.972.6ON81464708.4
NDAI0D026205.85ON98742699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.29
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...  1137   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   972   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   926   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   897   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   690   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   678   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   658   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   649   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   652   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   639   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   627   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   630   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   602   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   600   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   592   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   591   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   570   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   558   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   543   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   546   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   510   e-175
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   506   e-175
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   498   e-172
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   498   e-171
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   487   e-167
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   421   e-141
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   394   e-131
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     373   e-123
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   332   e-107
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              322   e-104
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   310   2e-97
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   194   2e-54
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   190   4e-53
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   187   1e-51
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   186   2e-51
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   185   5e-51
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   183   1e-50
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   181   3e-50
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   182   6e-50
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   179   4e-49
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   178   8e-49
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   179   1e-48
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   175   1e-47
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   172   2e-46
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   175   4e-46
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   170   2e-45
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    169   2e-45
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   170   6e-45
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   165   4e-43
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   166   1e-42
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   157   5e-41
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   155   4e-40
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   132   3e-33
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   128   7e-31
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   122   8e-30
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   117   9e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   107   2e-24
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   101   2e-22
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    94   4e-20
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    84   1e-16
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    35   0.56 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.60 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.73 
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    35   0.79 
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    34   1.1  
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    34   1.4  
NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85 ...    33   2.7  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    33   3.3  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    33   3.6  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    32   3.7  
Kwal_56.23320 s56 complement(491440..493254) [1815 bp, 604 aa] {...    32   4.4  
KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.4...    32   5.3  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    32   5.6  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    32   8.4  
NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {O...    31   9.1  

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score = 1137 bits (2942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/608 (91%), Positives = 558/608 (91%)

Query: 1   MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE 60
           MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE
Sbjct: 1   MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE 60

Query: 61  SHEDGKHGDEEASKSDDKAHRKGGCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           SHEDGKHGDEEASKSDDKAHRKGGC                                   
Sbjct: 61  SHEDGKHGDEEASKSDDKAHRKGGCHDKKDKKDKKDKKVKSKKEKKVKSKKEKKVKSKKH 120

Query: 121 XXXTLEKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQ 180
              TLEKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQ
Sbjct: 121 HEKTLEKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQ 180

Query: 181 LQSVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPL 240
           LQSVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPL
Sbjct: 181 LQSVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPL 240

Query: 241 VDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300
           VDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG
Sbjct: 241 VDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300

Query: 301 VNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
           VNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSN
Sbjct: 301 VNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 360

Query: 361 GSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           GSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH
Sbjct: 361 GSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420

Query: 421 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG 480
           FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG
Sbjct: 421 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG 480

Query: 481 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKD 540
           SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKD
Sbjct: 481 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKD 540

Query: 541 ILFDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRD 600
           ILFDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRD
Sbjct: 541 ILFDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRD 600

Query: 601 VLDKLNII 608
           VLDKLNII
Sbjct: 601 VLDKLNII 608

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/624 (78%), Positives = 516/624 (82%), Gaps = 32/624 (5%)

Query: 1   MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE 60
           MKLENTL TLGALGSISAALVIPNLE+AAD+HELV +D  QE  G+   A G   +S K+
Sbjct: 1   MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKFASGDGEKSIKK 60

Query: 61  SHE---------------DGKHGDE-EASKSDDKAHRKGGCXXXXXXXXXXXXXXXXXXX 104
            H                 G   +E E+S  +DK HRK                      
Sbjct: 61  GHSGGGHGGSHRNGHTGGKGTKSEEGESSDDEDKPHRK----------------GGCHDK 104

Query: 105 XXXXXXXXXXXXXXXXXXXTLEKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGV 164
                              TLEK R N KLAPLVSTAQF+P A+ KIIPNRYI+VFKKGV
Sbjct: 105 KKKKGKKGKKVKSKKHDGKTLEKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGV 164

Query: 165 PQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYI 224
           P+E  +FHKESVHQAQLQSVENLSAEDAFF STRD+ LSTSE GGIQDSFNIDN+FSGYI
Sbjct: 165 PEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYI 224

Query: 225 GYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLY 284
           GYFTQEIIDLIRQNPLVDFVERDSVVEAT+FDTQNSAPWGLARISHRERLNLGSFNKYLY
Sbjct: 225 GYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLY 284

Query: 285 DDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG 344
           DDDAGRGVTSYVIDTGVN+NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG
Sbjct: 285 DDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG 344

Query: 345 XXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKS 404
                       LRSNGSGTMSDVVKGVEYAA+AHQKQAQEKKKGFKGSTANMSLGGGKS
Sbjct: 345 VAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKS 404

Query: 405 PALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKC 464
           PALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKC
Sbjct: 405 PALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKC 464

Query: 465 VDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSL 524
           VD+FAPGLNILSTYIGSD+ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFE+GQDSL
Sbjct: 465 VDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSL 524

Query: 525 TPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMD 584
           TPQQLK KLIHYSTKDILFD+PEDTPN LIYNGGGQDLSAFWNDTKKSH S  K ELNMD
Sbjct: 525 TPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMD 584

Query: 585 EFIGSKTDLIFEQVRDVLDKLNII 608
           EFIGSKTDL+FEQVRDVLDKLNII
Sbjct: 585 EFIGSKTDLLFEQVRDVLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/485 (90%), Positives = 460/485 (94%)

Query: 124 TLEKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQS 183
           TLEK RH+ +LAPLVSTAQF+P A+ KIIPNRYIIVFK+G PQE  DFHKE+V QAQLQS
Sbjct: 151 TLEKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQS 210

Query: 184 VENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDF 243
           VENLSAEDAFFIST+D+SLSTSE GGIQDSFNIDN+FSGYIGYFTQEI+DLIRQNPLVDF
Sbjct: 211 VENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDF 270

Query: 244 VERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNV 303
           VERDS+VEAT+FDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN+
Sbjct: 271 VERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 330

Query: 304 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 363
           NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG
Sbjct: 331 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSG 390

Query: 364 TMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV 423
           TMSDVVKGVEYAA+AHQK+AQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVE GIHFAV
Sbjct: 391 TMSDVVKGVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAV 450

Query: 424 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDD 483
           AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIGSDD
Sbjct: 451 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDD 510

Query: 484 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILF 543
           ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFE+GQDSLTPQQLK KLIHYSTKDILF
Sbjct: 511 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF 570

Query: 544 DVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLD 603
           D+PEDTPN LIYNGGGQDLSAFWNDTKKSHSS FKQELNMDEFIGSKTDLIF+QVRD+LD
Sbjct: 571 DIPEDTPNVLIYNGGGQDLSAFWNDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILD 630

Query: 604 KLNII 608
           KLNII
Sbjct: 631 KLNII 635

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 52/82 (63%), Gaps = 15/82 (18%)

Query: 1  MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE 60
          MKLENTL TLGALGSISAALVIPNLE+AADHHEL+ +++H ER                 
Sbjct: 1  MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHER---------------PR 45

Query: 61 SHEDGKHGDEEASKSDDKAHRK 82
            E  K  DEE S S+DK H K
Sbjct: 46 KVEFTKDDDEEPSDSEDKEHGK 67

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/483 (89%), Positives = 454/483 (93%), Gaps = 1/483 (0%)

Query: 127 KARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVEN 186
           K  H  KLAPLVST QF+P A+ KIIPNRYIIVFKK VP E   FH+E+V QAQLQSVEN
Sbjct: 182 KDHHRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVEN 241

Query: 187 LSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVER 246
           L+AEDAFFISTRD++LS+SE GGIQDSFNID++FSGYIGYFTQEI+DLIRQNPLVDFVE+
Sbjct: 242 LAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEK 301

Query: 247 DSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHK 306
           DSVVEATDFDTQNSAPWGLAR+SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHK
Sbjct: 302 DSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHK 361

Query: 307 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 366
           DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSGTMS
Sbjct: 362 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMS 421

Query: 367 DVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 426
           DV+KGVEYAA+AHQKQA+EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG
Sbjct: 422 DVLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 481

Query: 427 NENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATA 486
           NENQDACNTSPASADKAITVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIGSD+ATA
Sbjct: 482 NENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATA 541

Query: 487 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVP 546
           TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLK KLIHYSTKDILFD+P
Sbjct: 542 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIP 601

Query: 547 EDTPNALIYNGGGQDLSAFWNDTKKSHSSR-FKQELNMDEFIGSKTDLIFEQVRDVLDKL 605
           +DTPNALIYNGGGQDLSAFWNDTKKSHSS  FKQELN+DEFIGSKTDLIFEQVRDVLDKL
Sbjct: 602 DDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKL 661

Query: 606 NII 608
           NII
Sbjct: 662 NII 664

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 53/90 (58%), Gaps = 7/90 (7%)

Query: 1  MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE 60
          MKL+NTL TLGALG ISAALVIPNLE  ADH EL+ +++H +   HA     +     + 
Sbjct: 1  MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEFVEDNDRHDERP 60

Query: 61 SHEDGK--HGDEEASKSDD-----KAHRKG 83
           H+ G+    D E+   DD     + HRKG
Sbjct: 61 PHKKGRKERKDVESKDKDDEDRHARKHRKG 90

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/488 (69%), Positives = 395/488 (80%), Gaps = 19/488 (3%)

Query: 133 KLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDA 192
           KLAPLVS+ Q  PA    IIP+RYIIVFKK    E   FHKE + +A  +SV  L ++D+
Sbjct: 64  KLAPLVSSPQ--PA---NIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDS 118

Query: 193 FFISTRDSS-----LSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERD 247
           FF +T+ S+      + S  GGIQ+SF+I NM +GYIGYFT E++D IR N  V+F+E+D
Sbjct: 119 FFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKD 178

Query: 248 SVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 307
           S+V A++FDTQN APWGL+RISHRERLNLGSFNKYLYDDDAG+GVTSYVIDTG+NVNHKD
Sbjct: 179 SLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKD 238

Query: 308 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 367
           F  RA+WGKT+P NDED DGNGHGTHCAGTIAS+HYG            LRSNGSGTMSD
Sbjct: 239 FNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSD 298

Query: 368 VVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 427
           VVKGVE+AA++HQ+ +++ KKGFKGSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGN
Sbjct: 299 VVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 358

Query: 428 ENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATAT 487
           ENQDACNTSPA+A+ AITVGASTLSDDRAYFSNWGKCVDIFAPGLN+LSTYIGS+ ATAT
Sbjct: 359 ENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418

Query: 488 LSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPE 547
           LSGTSMASPHVAGLLTYFLSLQP SDSEFF+     +TP QLK KLI YSTKD+L+++PE
Sbjct: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEFFQAS--GITPAQLKKKLIAYSTKDVLYELPE 476

Query: 548 DTPNALIYNGGGQDLSAFWNDT----KKSHSSRFKQELNMDEFIGS---KTDLIFEQVRD 600
           DTPN LIYNGGGQDLS FW  +    K+  S +  ++  + E I S   KTDL+FE+VR 
Sbjct: 477 DTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRS 536

Query: 601 VLDKLNII 608
           V DKLNII
Sbjct: 537 VFDKLNII 544

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/483 (68%), Positives = 390/483 (80%), Gaps = 17/483 (3%)

Query: 129 RHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLS 188
           +  E +APL        +  P   P+RYI+V K   P+E    H E++ Q+QLQSV  L+
Sbjct: 96  KMGEGVAPL--------SIPPNAFPHRYIVVLKHSSPEEIA-LHMEAITQSQLQSVGELA 146

Query: 189 AEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDS 248
            +D FF     S+     TGGIQDSF++  + +GY+GYFT  +++LIR++P+VDFVE DS
Sbjct: 147 QDDPFF-----SAQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDS 201

Query: 249 VVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDF 308
            V A++FDTQN APWGL+RISHRERLNLGSFNKYL+DD+AG+GVTSYVIDTG+NV H+DF
Sbjct: 202 PVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDF 261

Query: 309 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 368
           E RA WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV
Sbjct: 262 EGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDV 321

Query: 369 VKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 428
           +KGVE+AA++HQK  ++KKKGFKGSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNE
Sbjct: 322 IKGVEFAAQSHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 381

Query: 429 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATL 488
           NQDACNTSPA+A++A+TVGASTLSDDRAYFSN+GKCVDIFAPGLNILSTYIGSDDATATL
Sbjct: 382 NQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATL 441

Query: 489 SGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPED 548
           SGTSMASPHVAGLLTYFLSLQP SDS+FF+ G   +TP+QLK KLI YSTKDIL+D+PED
Sbjct: 442 SGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPED 501

Query: 549 TPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEF---IGSKTDLIFEQVRDVLDKL 605
           TPNALIYNGGG  L  FW+   K  ++   Q+ ++ E    +G+KTD +F+QVRDVLD+L
Sbjct: 502 TPNALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRL 561

Query: 606 NII 608
           NII
Sbjct: 562 NII 564

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/486 (66%), Positives = 377/486 (77%), Gaps = 20/486 (4%)

Query: 134 LAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAF 193
           L+PLV+        M   IP+RYI+VFK  V  E  DFH E V +A  QSV  L A DAF
Sbjct: 67  LSPLVTARN-----MYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAF 121

Query: 194 FISTRDSSL---STSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVV 250
           F +T D  +   +TS  GGI DSF+++ M  GYIGYFTQEI+D IR NPLV FVE+DS+V
Sbjct: 122 FEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMV 181

Query: 251 EATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEK 310
            A +FDTQN APWGL+RISHRE+LNLGSFNKYLYDD AG+GVTSYVIDTG+N++HKDFE 
Sbjct: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241

Query: 311 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 370
           RA WGKT+P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVK
Sbjct: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVK 301

Query: 371 GVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 430
           GVE+AA++HQ   ++ KKGFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQ
Sbjct: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361

Query: 431 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSG 490
           DACN+SPA+A+ AITVGASTL+DDRAYFSNWGKCVDIFAPGLN+LSTYIGS+ ATATLSG
Sbjct: 362 DACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421

Query: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTP 550
           TSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLK KLI YSTK+ L D+PEDT 
Sbjct: 422 TSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480

Query: 551 NALIYNGGGQDLSAFW--------NDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVL 602
           N LIYNGGGQDL  FW         D K + +S F+  ++  E    KTD ++E++R++ 
Sbjct: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALE---EKTDGLYEEIREIF 537

Query: 603 DKLNII 608
           + LNII
Sbjct: 538 EGLNII 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/494 (65%), Positives = 384/494 (77%), Gaps = 26/494 (5%)

Query: 133 KLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDA 192
           +L+PLVS++    A     IP+RYI+VFK+ +  E  DFHK+ V +A LQSV  L +   
Sbjct: 65  ELSPLVSSSGKYLA-----IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHE 119

Query: 193 FFIST------RDSSL-------STSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNP 239
           FF ST      RD  L       + +  GGIQDSF++  + +GYIGYFT EI+D IR NP
Sbjct: 120 FFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNP 179

Query: 240 LVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDT 299
           LVDFVE+DSVV A +F TQN APWGL+RISHRE+LNLGSFNKYLYDDDAG+GVTSYVIDT
Sbjct: 180 LVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDT 239

Query: 300 GVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 359
           GVNV+HKDFE RA WGKTIP ND D DGNGHGTHCAGTIASKHYG            LRS
Sbjct: 240 GVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRS 299

Query: 360 NGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGI 419
           NGSG+MSDVVKGVE+AA++HQ   +E KKGFKGSTANMSLGGGKSPALD+AVNAAV+AGI
Sbjct: 300 NGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGI 359

Query: 420 HFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYI 479
           HFAVAAGNENQDACN+SPASA+ A+TVGASTL+DDRAYFSNWGKCVDIFAPGLN+LSTYI
Sbjct: 360 HFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYI 419

Query: 480 GSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTK 539
           GSD ATATLSGTSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLK KLI YSTK
Sbjct: 420 GSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTK 478

Query: 540 DILFDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELN--MDEFIGS---KTDLI 594
           ++L D+P+DT N LI+NGGG+ L  FW   K+S     +  ++  ++ FI +   KTD++
Sbjct: 479 NVLGDIPDDTVNYLIFNGGGEGLDDFWG--KESVVDEVEDTISSEIESFIDALEEKTDVL 536

Query: 595 FEQVRDVLDKLNII 608
           +E++R+V D +NII
Sbjct: 537 YEEIREVFDHMNII 550

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/456 (69%), Positives = 367/456 (80%), Gaps = 13/456 (2%)

Query: 131 NEKLAPLVSTAQFDPAA--------MPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQ 182
           N K+APLV+   +   +           IIPNRYI+VFKK +  E  DFHKE ++Q QL+
Sbjct: 70  NLKMAPLVTPTPYPVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELINQIQLE 129

Query: 183 SVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVD 242
           S   L  +D FF ++     S ++ GGI  +FNI N+ +GY+GYFT E+++LIR NPLV+
Sbjct: 130 SAAKLPKDDKFFSASAIEDESINQ-GGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVE 188

Query: 243 FVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN 302
           +VE+DS+V+AT+FD QN+APWGLARISHRERLNLGSFNKYLYDDDAG+GVT YVIDTG+N
Sbjct: 189 YVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGIN 248

Query: 303 VNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGS 362
             H DF KRA+WGKTIPLND+D+DGNGHGTHCAGTIAS HYG            LRSNGS
Sbjct: 249 TEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGS 308

Query: 363 GTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFA 422
           G+MSDV+KGVE+AA +H K A+EKKKGFKGSTANMSLGGGKSP LDLAVNAAV+AGIHFA
Sbjct: 309 GSMSDVIKGVEFAAESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFA 368

Query: 423 VAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSD 482
           VAAGNENQDACNTSPASA++AITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG D
Sbjct: 369 VAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDD 428

Query: 483 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDIL 542
           DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFF+  +  LTP Q+K KLI+YS+KD+L
Sbjct: 429 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVL 486

Query: 543 FDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFK 578
           FD+PE TPN LI+NG G +L   WN  KKS     K
Sbjct: 487 FDLPEGTPNKLIFNGAGGNLDDLWN--KKSQEEDIK 520

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 568 DTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLDKLNII 608
           D KK H  +     ++ + +G+ +D +F+Q+RD+ D+++I+
Sbjct: 656 DNKKHHQEQI-SPADLAKSLGTSSDSVFQQIRDMFDRMDIL 695

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/621 (55%), Positives = 411/621 (66%), Gaps = 73/621 (11%)

Query: 1   MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE 60
           MK ENTLLT+ AL +++ ALVIP         E+  E+ H ++   A+    SS     +
Sbjct: 1   MKFENTLLTITALSTVATALVIP---------EVNRENKHGDK-SVAIKDHASSDLDKPQ 50

Query: 61  SHEDGKHGDEEASKSDDKAHRKGGCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
            H +GK           ++  +G C                                   
Sbjct: 51  HHANGKA----------RSKSRGRCADSKK------------------------------ 70

Query: 121 XXXTLEKARHNEK----LAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESV 176
                +K R  +     LAPL +        +   IPNRYIIVFKK    +   FH+E V
Sbjct: 71  ----FDKLRPVDDASAILAPLSTVND-----IANKIPNRYIIVFKKDASADEVKFHQELV 121

Query: 177 HQAQLQSVENLSAEDAFFISTRDS-----SLSTSETGGIQDSFNIDNMFSGYIGYFTQEI 231
                +++ +L+  D FF +T          + S  GGIQDSF+I    SGY+GYFT+E+
Sbjct: 122 SVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEV 181

Query: 232 IDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRG 291
           ID IR++PLV+FVE DS+V +  F+TQNSAPWGLARISHRE+LNLGSFNKYLYDDDAG+G
Sbjct: 182 IDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKG 241

Query: 292 VTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXX 351
           VT+YV+DTGVNVNHKDF+ RA+WGKTIP +D D+DGNGHGTHCAGTI S HYG       
Sbjct: 242 VTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADI 301

Query: 352 XXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAV 411
                LRSNGSGTMSDVVKGVEY A AH+K  +E+KKGFKGSTANMSLGGGKSPALDLAV
Sbjct: 302 VAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAV 361

Query: 412 NAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPG 471
           NAAV+AG+HFAVAAGNENQDACNTSPA+A+ AITVGASTLSD+RAYFSNWGKCVDIF PG
Sbjct: 362 NAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPG 421

Query: 472 LNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKN 531
           LNILSTYIGSD ATATLSGTSMA+PHV GLLTYFLSLQP +DSE+F      +TP QLK 
Sbjct: 422 LNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAG-GITPSQLKK 480

Query: 532 KLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW-NDTKKSHSSRFKQELNMDEFIG-- 588
           KLI +STK++L D+PEDT N LIYNGGGQDL   W  D           E +++  I   
Sbjct: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSL 540

Query: 589 -SKTDLIFEQVRDVLDKLNII 608
            SKTD IF+ VR +LD+ NII
Sbjct: 541 DSKTDAIFDDVRQLLDQFNII 561

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/475 (65%), Positives = 360/475 (75%), Gaps = 12/475 (2%)

Query: 134 LAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAF 193
           +APL S +   P     IIP+RYII FKK V  E  DFH++S+++ Q QS+  L  +  +
Sbjct: 111 IAPLYSQS-LHPQ---NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166

Query: 194 FISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEAT 253
           F S     L       I DSFNI+++  GYIGYFT ++ID IR NPLV FVE+DS V   
Sbjct: 167 FNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNIN 222

Query: 254 DFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAI 313
           +FDTQN APWGLARISHRERLNLGSFNKYL+DD AG GVT+YVIDTGVNV H DFE RA 
Sbjct: 223 EFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRAS 282

Query: 314 WGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVE 373
           WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+KGVE
Sbjct: 283 WGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVE 342

Query: 374 YAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDAC 433
           YA  +H    + KK GFKGSTANMSLGGGKSP+LDLAVNAAV+AGIHFAVAAGNENQDAC
Sbjct: 343 YATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDAC 402

Query: 434 NTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSM 493
           NTSPASA  AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIGSDDATATLSGTSM
Sbjct: 403 NTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 462

Query: 494 ASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNAL 553
           ASPHVAGLL+YFLSLQP  DSEF    +  +TP QLK +LI Y TKDIL D+PE TPN L
Sbjct: 463 ASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVL 522

Query: 554 IYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLDKLNII 608
           ++NG GQDLS FWN +K +     +   N+D  +G   D++++Q   +  K+N++
Sbjct: 523 VFNGAGQDLSDFWNISKPADLESNEVYKNLD-LVG---DVLYDQFTGIFKKMNLL 573

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/491 (63%), Positives = 372/491 (75%), Gaps = 16/491 (3%)

Query: 133 KLAPLVSTAQFDPA-----AMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENL 187
           KLAPL++    D         P+I+PN+YIIVFK  +  +   +HKE + + Q QS   L
Sbjct: 215 KLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRL 274

Query: 188 SAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERD 247
                FF ST +    +   GGI  SFNI+N+ SGY GYFTQE+IDLIR NPLV +VERD
Sbjct: 275 PPHHHFFHSTSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERD 334

Query: 248 SVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 307
           S+V+ T+F+TQN+APWGL+RISHRERLNLGSFNKYLYDDDAG+GVT +VIDTG+NVNH D
Sbjct: 335 SIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVD 394

Query: 308 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 367
           F KRAIWGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MSD
Sbjct: 395 FGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSD 454

Query: 368 VVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 427
           V+KGVE+AA  H    ++ KK +KGSTANMSLGGGKSP LDLAVNAAVEAGIHF+VAAGN
Sbjct: 455 VIKGVEFAAETHLNN-EKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGN 513

Query: 428 ENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG-SDDATA 486
           ENQDACN+SPASA+ AITVGASTLSDDRAYFSNWG+CVD+FAPGLNILSTY+G  +D TA
Sbjct: 514 ENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTA 573

Query: 487 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQD-SLTPQQLKNKLIHYSTKDILFDV 545
           TLSGTSMASPHVAGLLTYFLSLQP S S FF    D  +TP+QLK KLI YST DIL+D+
Sbjct: 574 TLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDL 633

Query: 546 PEDTPNALIYNGGGQDLSAFWNDTKKSHSSR---FKQELNMDEFIGS-----KTDLIFEQ 597
           P+ TPN LIYNG G D+S  WN   +  +      + ++N +  + S     KTDL F+Q
Sbjct: 634 PDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQ 693

Query: 598 VRDVLDKLNII 608
           +R+V +K+NII
Sbjct: 694 IRNVFEKMNII 704

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/472 (63%), Positives = 362/472 (76%), Gaps = 18/472 (3%)

Query: 151 IIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGI 210
           ++P++YI+V KKGV  EA       V  A   ++ +L  E  FF       L     GGI
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGL---PRGGI 57

Query: 211 QDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISH 270
           +D FNI+++F G IGYF + ++ L+ ++ +V+FVERDSVV A++FDTQN+APWGLARISH
Sbjct: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117

Query: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 330
           R+RLNLG+FNKYLYD+  G GVT+YVIDTG+NV H +F+ RA WGKTIPLND D+DGNGH
Sbjct: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177

Query: 331 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGF 390
           GTHCAGTIASKHYG            L+S+GSGTMSDV+KGVEYAA+AH K+++  KK F
Sbjct: 178 GTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236

Query: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450
           KGSTANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPASA+KAITVGAST
Sbjct: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296

Query: 451 LSDDRAYFSNWGKCVDIFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQ 509
           LSDDRAYFSNWGKCVDIFAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQ
Sbjct: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356

Query: 510 PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPE-DTPNALIYNGGGQDLSAFWND 568
           P SDSEF++  +  +TP QLK KLI YSTK++L D+P+ D+PN LIYNG G DL  FWN 
Sbjct: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416

Query: 569 TKKSHSS------RFKQELNMD---EFIGSK---TDLIFEQVRDVLDKLNII 608
           T     S      R   EL +D   + +G +   TD +F QVR++LDK+NII
Sbjct: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/500 (60%), Positives = 365/500 (73%), Gaps = 17/500 (3%)

Query: 124 TLEKARHNEKLAPLVSTA------QFDPAAMPK----IIPNRYIIVFKKGVPQEATDFHK 173
           + EK    ++LA   S        +F P  +P+    ++ NRYII+FKKGV  +   FH+
Sbjct: 51  SFEKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHR 110

Query: 174 ESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIID 233
           E + Q  LQ V  L  E +FF   R   +  S  GGI  +F+I+ M  GY GYF  +++D
Sbjct: 111 ELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLD 170

Query: 234 LIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVT 293
           +IR +PL++ VE+DSVV     DT+N APWGLARISHRERLNLGS+NKYLYD+  G GVT
Sbjct: 171 VIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVT 230

Query: 294 SYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXX 353
           SYVIDTGVNV+H  F  RA WGKTIP  D D DGNGHGTHCAGTI S  YG         
Sbjct: 231 SYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVA 290

Query: 354 XXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNA 413
              LRSNGSG+MSDV+KGVE+AA+ HQ   ++KK GFKGSTANMSLGGGKSP+LD AVNA
Sbjct: 291 VKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNA 350

Query: 414 AVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLN 473
           AV AG++FAVAAGNE+QDACNTSPASA   ITVGASTLSDDRAYFSN+GKCVD+FAPGLN
Sbjct: 351 AVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLN 410

Query: 474 ILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKL 533
           ILSTYIGSD +TATLSGTSMASPHVAGLL YFLSLQPGSDSE F+ G  S++P QLK KL
Sbjct: 411 ILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSE-FDAGS-SISPDQLKKKL 468

Query: 534 IHYSTKDILFDVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMD-----EFIG 588
           + +STKD+L D+P  TPN LIYNGGG DLS FW   + +    F ++++++     + +G
Sbjct: 469 LAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSKEVAQELEFNEKVDLELHDLVDELG 528

Query: 589 SKTDLIFEQVRDVLDKLNII 608
           SKTD +F Q+R ++D+L+II
Sbjct: 529 SKTDAVFGQIRGLMDRLDII 548

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/499 (59%), Positives = 362/499 (72%), Gaps = 23/499 (4%)

Query: 126 EKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVE 185
            KA+  E+ +PL     F    + + IP++YI+VF++GV  E   FH E V  A  +SV 
Sbjct: 50  RKAQGAEQQSPL-----FRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVA 104

Query: 186 NLSAEDAFFISTRDSS-----LSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPL 240
            L  + AFF STR  +      +T   GGI+  F +     GY+GYFT++++ L+R NP 
Sbjct: 105 RLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPH 164

Query: 241 VDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300
           V FVE DS+V A+DF TQN APWGLAR+SHRE+LN GSFNKYLYDD++G GVTSYVIDTG
Sbjct: 165 VHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTG 224

Query: 301 VNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
           +N++H DFE RA+WGKTIP ND D DGNGHGTHCAGTIASK YG            LRSN
Sbjct: 225 INIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSN 284

Query: 361 GSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           G+G+MSDV++GVEYA +AH+K A++  KGFKGSTANMSLGGG+S ALDLAV+AAV+AGIH
Sbjct: 285 GTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIH 344

Query: 421 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG 480
           FAVAAGNENQDACNTSPA++ KAITVGASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIG
Sbjct: 345 FAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIG 404

Query: 481 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKD 540
           SD A ATLSGTSMASPHVAGLLTYFLSLQP  DSEF    + +++P+ LK K+I + TKD
Sbjct: 405 SDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKD 462

Query: 541 ILFDVPEDTPNALIYNGGGQDLSAFW-NDTKKSHSSRFKQE-------LNMDEFI---GS 589
            L  +P  T N LIYNGGG DLS FW N  KK    +F           ++D  I    S
Sbjct: 463 ALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELES 522

Query: 590 KTDLIFEQVRDVLDKLNII 608
            TD +F   R +LD++NII
Sbjct: 523 STDAMFSGFRTILDRMNII 541

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/488 (59%), Positives = 369/488 (75%), Gaps = 20/488 (4%)

Query: 126 EKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVE 185
           EK+    K APL S        +  +IPN+YIIVFKK V  +    HK+ + +AQ Q   
Sbjct: 208 EKSGEKVKYAPLHSMENTKYENL--VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ--- 262

Query: 186 NLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVE 245
                   + S  D + S+S  GGI+++FN+ N+F GYIG+F ++++  IR +P+VDFVE
Sbjct: 263 --------YASVSDET-SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVE 313

Query: 246 RDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNH 305
           +DS+V A + DTQN+APWGLARISHR+ LNLGS+NKYLYDD AG GVT+YVIDTG+N+ H
Sbjct: 314 QDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKH 373

Query: 306 KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 365
           K+F  RA+WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSGTM
Sbjct: 374 KEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTM 433

Query: 366 SDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAA 425
           SDV+KGVEYAA +HQK  +EKKKGFKGSTANMSLGGGKS +LDLAV+AAV++GIHFAVAA
Sbjct: 434 SDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAA 493

Query: 426 GNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDAT 485
           GNENQDACN+SPA+++ AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIGSD+AT
Sbjct: 494 GNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEAT 553

Query: 486 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDV 545
           ATLSGTSMASPHVAGLL+YFLS+QP +DSEFF  G +S++P QLK KLI YSTK++  D+
Sbjct: 554 ATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDL 613

Query: 546 PEDTPNALIYNGGGQDLSAFWNDTKKSHS--SRFKQELNMDEFIGSK---TDLIFEQVRD 600
           PE TPN L+YN  G ++S FW    +S +  +   +E  +++ + S     D     ++ 
Sbjct: 614 PEKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQ 672

Query: 601 VLDKLNII 608
           V +++++ 
Sbjct: 673 VFERMDLF 680

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/484 (59%), Positives = 352/484 (72%), Gaps = 23/484 (4%)

Query: 126 EKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVE 185
           ++A   E+LAPL +       +      N+YII+FK+GV  E    HK+ + Q  L++  
Sbjct: 70  KEAHDEEELAPLYTPGSA--LSASSSRSNKYIILFKEGVTAEQISAHKQLLQQVLLET-S 126

Query: 186 NLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVE 245
           ++SA+                   + DSF+++ + SGY+   +  +++L+R++P V  VE
Sbjct: 127 DVSAQGI--------------VADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVE 172

Query: 246 RDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNH 305
           +DS V   +FDTQN+APWGLARISHR+ L+LGSFNKYLYDD AG GV SY+IDTG+NV H
Sbjct: 173 QDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKH 232

Query: 306 KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 365
           K+FE RA WGKTIP ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+M
Sbjct: 233 KEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSM 292

Query: 366 SDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAA 425
           SDV+ GVE+AA+ H  +A+   K FKGSTANMSLGGGKSP+LD  V+AAV+ G+HF+VAA
Sbjct: 293 SDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAA 352

Query: 426 GNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDAT 485
           GNENQDACNTSPA++++AITVGASTLSDDRAYFSNWG CVDIFAPGLNILSTY GSDDAT
Sbjct: 353 GNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDAT 412

Query: 486 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDV 545
           ATLSGTSMASPHVAGLLTYFLSLQP   S+F    Q  +TP+QLK KL+ YSTK +LFD+
Sbjct: 413 ATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDL 470

Query: 546 PEDTPNALIYNGGGQDLSAFWNDT-KKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLDK 604
           PEDTPNALIYNGGG DLS FW D  KKSH   F  E +    + + +D +FEQVR +  K
Sbjct: 471 PEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEYDN---VWASSDAMFEQVRAMFGK 527

Query: 605 LNII 608
           LNI 
Sbjct: 528 LNIF 531

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/437 (63%), Positives = 330/437 (75%), Gaps = 9/437 (2%)

Query: 135 APLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFF 194
           A   S A    A    IIP+RYIIVFK GV +E   FHKE +    LQ     S +   +
Sbjct: 41  AKFSSLAPVHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEY 100

Query: 195 ISTRDSSLSTS---ETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVE 251
           + T D ++  S     GGI   F+I ++ SGYI Y + E++  IR NPL+ F+E D++V 
Sbjct: 101 LQT-DINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVH 159

Query: 252 ATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 311
            TDF+TQN+APWGLARISHRE LNL +FNKYLYDDDAG+ V +YVIDTGV+VNH +F  R
Sbjct: 160 TTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSR 219

Query: 312 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKG 371
           A WGKTIPLND+D+DGNGHGTH AGTI S+HYG            LRSNGSG+MSDVVKG
Sbjct: 220 AHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKG 279

Query: 372 VEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 431
           VE+A  +H ++  + +K  KGS ANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNENQ+
Sbjct: 280 VEFAVSSHLER-MKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQN 338

Query: 432 ACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGS-DDATATLSG 490
           ACN+SPASA++A+TVGAST+SD+RAYFSNWG+CVDIFAPGLNILSTYIG+ DD TATLSG
Sbjct: 339 ACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSG 398

Query: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTP 550
           TSMASPHVAGLL Y+LSLQP   SEF      +++  QLK KLI Y+TKD+L D+PE TP
Sbjct: 399 TSMASPHVAGLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEGTP 455

Query: 551 NALIYNGGGQDLSAFWN 567
           N LIYNGGGQDLS FWN
Sbjct: 456 NVLIYNGGGQDLSDFWN 472

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/480 (57%), Positives = 337/480 (70%), Gaps = 26/480 (5%)

Query: 137 LVSTAQFDPAAM----PKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDA 192
           LV   +  PA++     ++IP  YI+VF +GV Q     H E++ Q QLQSV +L  +  
Sbjct: 16  LVLPEEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHE 75

Query: 193 FF-ISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVE 251
           FF IST     S    GG++D F I N   GY G FT E+++ +R +PLV F+ERDS+V 
Sbjct: 76  FFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVH 135

Query: 252 ATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 311
            T+  TQ +APWGLARISHR RLNL +FNKYLYDD  G+GV +YVIDTG+N+ + DF  R
Sbjct: 136 TTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGR 195

Query: 312 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKG 371
           A WGKTIP  + ++DGNGHGTH AGTIAS HYG            LRSNG+G+MSDV+KG
Sbjct: 196 AYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKG 255

Query: 372 VEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 431
           VEY   AHQ+       GFKGS ANMSLGGGKS +LDLAVNAAV AG+HFAVAAGNENQD
Sbjct: 256 VEYVVGAHQRDV--GTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQD 313

Query: 432 ACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGT 491
           ACNTSPA+A++AITVGASTLSD RAYFSNWG+CV IFAPGLNILSTYIGS DATATLSGT
Sbjct: 314 ACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGT 373

Query: 492 SMASPHVAGLLTYFLSLQPGSDSEFFEMGQ-DSLTPQQLKNKLIHYSTKDILFDVPEDTP 550
           SMASPH+AGL+ YFLSLQP   S+F+  GQ  ++TP QLK K++ + TK+ L D+P +TP
Sbjct: 374 SMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTP 433

Query: 551 NALIYNGGGQDLSAFW--NDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLDKLNII 608
           N + YNG G+ L  FW  ND  K++ S                 +I EQ++ +L+K+NI 
Sbjct: 434 NVIAYNGAGKSLEDFWNANDYVKNYQSL----------------VITEQLQFILNKMNIF 477

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/504 (55%), Positives = 354/504 (70%), Gaps = 32/504 (6%)

Query: 132 EKLAPLVSTAQFDPAA------------MPKIIPNRYIIVFKKGVPQEATDFHKESVHQA 179
           +K++P+    +FD +               + IP+RYI++FK GV       H++ V  A
Sbjct: 77  DKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTA 136

Query: 180 QLQSVENLSAEDAFFISTR----DSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLI 235
            ++++  L    +FF +T     +   + S  GGI++ F I     GY GYFT  ++DLI
Sbjct: 137 HMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLI 196

Query: 236 RQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSY 295
           R++ LV  +E+DS+V A+DF+TQ  APWGLAR+SHRERLNLGSFNKYLYDD+AG+GVT+Y
Sbjct: 197 RESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAY 256

Query: 296 VIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXX 355
           VIDTG+N++H +FE RA WGKTIP ND D DGNGHGTHCAGTIASK YG           
Sbjct: 257 VIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVK 316

Query: 356 XLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAV 415
            LR+NG+GTMSDV++GVEY    H+K + +    FKGSTANMSLGGGKS AL+LAV+AAV
Sbjct: 317 VLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN--FKGSTANMSLGGGKSAALELAVDAAV 374

Query: 416 EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL 475
            AGIHFAVAAGNENQDACNTSPAS+ K ITV ASTLSDDRAYFSNWG CVDIFAPGLNIL
Sbjct: 375 AAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNIL 434

Query: 476 STYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIH 535
           STYIGSD A ATLSGTSMASPHVAGLL YFLSLQP S SE++     S++P+ LK K++ 
Sbjct: 435 STYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYT--GSSISPEALKKKIVA 492

Query: 536 YSTKDILFDVPEDTPNALIYNGGGQDLSAFWN------DTKKSHSSR-----FKQELNMD 584
           Y +K++L +VP  T N LI+NGGG  L +FWN      + +K  SS      F+ E  MD
Sbjct: 493 YGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMD 552

Query: 585 EFIGSKTDLIFEQVRDVLDKLNII 608
             + S +  +F ++R+ LD+L++I
Sbjct: 553 -CLHSTSHSLFGEIRNFLDRLDLI 575

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  510 bits (1314), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 265/446 (59%), Positives = 326/446 (73%), Gaps = 15/446 (3%)

Query: 154 NRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGIQDS 213
           +RYIIVFKKGV +E  D H +      + ++    +E+    +   +S        + D+
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLK-----MMSALFRRLSEEQRPAAAPGASALRDGFDRVMDT 188

Query: 214 FNIDNMFSGYIGYF-TQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRE 272
           F +   FSGYI    + +I+D IR NPLVD+VE+DSVV + D +TQN+APWGLARISHRE
Sbjct: 189 FEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHRE 247

Query: 273 RLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHG 331
            LNLG+FNKYLY  + AG+GVT+YV+DTG++V+H +F +RA WGKTIP+ND D+DGNGHG
Sbjct: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHG 307

Query: 332 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKK--- 388
           THCAGTI S+HYG            LRS+GSGTMSDV+KGVE+ A  H K  +E +K   
Sbjct: 308 THCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKN 367

Query: 389 -GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVG 447
             +KG+TANMSLGGGKSPALD AVNAAV+AG+HFAVAAGNENQDACN+SPA+A+ AITVG
Sbjct: 368 SNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVG 427

Query: 448 ASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLS 507
           ASTLSDDRAYFSN+GKCVDIFAPGLNILSTYIG++DATATLSGTSMASPHVAGLLTY LS
Sbjct: 428 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLS 487

Query: 508 LQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFWN 567
           LQP   SEF+ +    LTP Q+K K+I Y+TK+ L D+P DTPN LIYNGG    + FW 
Sbjct: 488 LQPDKGSEFY-VPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TDFWA 545

Query: 568 DTKKSHSSRFK-QELNMDEFIGSKTD 592
                 S + K    ++  F+ S  D
Sbjct: 546 SAAAPQSHKVKTNRYSLGSFLDSIQD 571

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 6/37 (16%)

Query: 1  MKLENTLLTLGALGSISAALVIPNLE------HAADH 31
          MKL+NTL++     S++ ALVIP L+      HA DH
Sbjct: 35 MKLQNTLVSAVIAASVAEALVIPALDQGRGRGHALDH 71

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  506 bits (1302), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 239/424 (56%), Positives = 316/424 (74%), Gaps = 11/424 (2%)

Query: 149 PKII------PNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSL 202
           PK++      P RYII F +     + + HK  + + Q +SV  L+ +DAFF+ST  S+ 
Sbjct: 58  PKVVYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAP 115

Query: 203 STSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAP 262
           S  + GGI   F+I+ +F GY GYFT+E+I  + Q+P++ F+E++S V+ T+   Q  AP
Sbjct: 116 SDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAP 175

Query: 263 WGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLND 322
           WGL RISHRE+   G   +YLY+D AGRGVTSYV+DTG+++NH+DFE RA+WG  IP ND
Sbjct: 176 WGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDND 235

Query: 323 EDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQ 382
           E  D NGHGTHCAG I S+H+G            LRSNG GT+SDV+KG+EY  + H   
Sbjct: 236 EASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDS 295

Query: 383 AQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK 442
           +++    FKGSTAN+SLG  KSPA+++AVNAAVE+G+HFA+AAGNE++DAC +SPA A+K
Sbjct: 296 SKKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEK 355

Query: 443 AITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLL 502
           +ITVGAST SDDRA+FS+WG CVD+FAPG+NILSTYIGS +A+ +LSGTSMA+PHVAG+L
Sbjct: 356 SITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGIL 415

Query: 503 TYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDL 562
           +YFLSLQP SDSEFF+    +++PQQLK K+I++ST+ +L DV EDTPN LIYNGGG+ L
Sbjct: 416 SYFLSLQPSSDSEFFD---STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKL 472

Query: 563 SAFW 566
             FW
Sbjct: 473 DNFW 476

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  498 bits (1283), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 232/417 (55%), Positives = 309/417 (74%), Gaps = 3/417 (0%)

Query: 150 KIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGG 209
           ++IP RYI+VF + +  ++ + H++ V +A   SV  L+ +D F      S     + GG
Sbjct: 65  ELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGG 124

Query: 210 IQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARIS 269
           I  SF+I+ +F GY GYFT EI++L+ Q+PL+ F+E++S V  ++   Q  APWGL RIS
Sbjct: 125 IDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRIS 184

Query: 270 HRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 329
           HRE+   G   +YLY+D AGRGVTSYV+DTG++  H+DFE RA+WG  IP NDE  D NG
Sbjct: 185 HREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNG 244

Query: 330 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG 389
           HGTHCAG I SKHYG            LRSNG GT+SDV+KG+EY AR H + +++K K 
Sbjct: 245 HGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKE 304

Query: 390 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449
           FKGSTAN+SLG  KS A+++AV+AAV++G+HFA+AAGNEN+DAC +SPA A K+ITVGAS
Sbjct: 305 FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGAS 364

Query: 450 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQ 509
           T SDDRA+FSNWG CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+YFLSLQ
Sbjct: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSLQ 424

Query: 510 PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW 566
           P  DSE+F+   ++L+PQ+LK K++ +ST  +L D+ ++TPN LIYNGGG+ L   W
Sbjct: 425 PAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  498 bits (1282), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 231/417 (55%), Positives = 305/417 (73%), Gaps = 3/417 (0%)

Query: 150 KIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGG 209
           K +P RYIIVF + +     + H + + +AQ  SV  ++ +D+F  +   S+    + GG
Sbjct: 67  KSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGG 126

Query: 210 IQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARIS 269
           I  SF+I+ +F GY GYFT E+I+++ Q+PLV F+E +S V  ++   Q  APWGL RIS
Sbjct: 127 IDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRIS 186

Query: 270 HRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 329
           HRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D NG
Sbjct: 187 HRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNG 246

Query: 330 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG 389
           HGTHCAG I S+H+G            LRSNG GT+SDV+KG+EY A+ H   ++++   
Sbjct: 247 HGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSK 306

Query: 390 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449
           FKGSTAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGAS
Sbjct: 307 FKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGAS 366

Query: 450 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQ 509
           T SDDRA+FSNWG CVD+FAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSLQ
Sbjct: 367 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQ 426

Query: 510 PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW 566
           P  DSEFF    D+++PQQLK K++ +ST+ +L DV E+TPN L+YNGGG+ L  FW
Sbjct: 427 PAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  487 bits (1253), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 231/417 (55%), Positives = 306/417 (73%), Gaps = 3/417 (0%)

Query: 150 KIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGG 209
           + +P RY+IVF + +  +    H + V +    SV  L+  DAF+     S  S S+ GG
Sbjct: 65  EFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQFGG 124

Query: 210 IQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARIS 269
           I + F+I+ +F GY GYFT EII +I Q+P++ FVE+++ V+ ++   Q  APWGL R+S
Sbjct: 125 IDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRVS 184

Query: 270 HRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 329
           HRE+   G   +YLY+D AG+GVTSYV+DTG++  H+DFE RA WG  IP NDE  D NG
Sbjct: 185 HREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNG 244

Query: 330 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG 389
           HGTHCAG I SKH+G            LRSNG GT+SDV+KG+EY  + H + +++K K 
Sbjct: 245 HGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKE 304

Query: 390 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449
           FKGSTAN+SLG  KS A+++AVNAAV++G+HFA+AAGNE++DAC +SPA A+K+ITVGAS
Sbjct: 305 FKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGAS 364

Query: 450 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQ 509
           T SDDRA+FSNWG CVD+FAPG+NI+STYIGS +AT +LSGTSMASPHVAG+L+YFLSLQ
Sbjct: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSLQ 424

Query: 510 PGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFW 566
           P  DSEFF    D+ +PQ+LK K++ +ST+ +L D+ +DTPN LIYNGGG+ L  FW
Sbjct: 425 PAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  421 bits (1081), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 220/434 (50%), Positives = 288/434 (66%), Gaps = 17/434 (3%)

Query: 139 STAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFF---- 194
           S   FD A    IIPNRYI++FK        DF  +   Q+ L ++E +++   F     
Sbjct: 61  SKIYFDSAKNDMIIPNRYIVLFK--------DFVTDKEIQSHLSAIEEINSSSIFLQDSD 112

Query: 195 --ISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEA 252
              +T+ + +ST   G +Q  F+I    +GYIGYFT+     I  +PLV+ VE DS+V  
Sbjct: 113 FGKATQYNDISTRGIG-LQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRI 171

Query: 253 TDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRA 312
            ++  Q   PWGL RIS RE+L +     Y YDD  G+   ++VIDTG+ V+H+DFE RA
Sbjct: 172 NNYKMQEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRA 231

Query: 313 IWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGV 372
            WGKTI  ND D D NGHGTHCAGTIASKHYG            LRS+GSG+MSDV++GV
Sbjct: 232 SWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGV 291

Query: 373 EYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDA 432
           EY   A+    ++ K   KG+  NMSLG  KS AL+ A++AA  AGI FAVAAGNE+ DA
Sbjct: 292 EYTVEAYN-DLKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDA 350

Query: 433 CNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTS 492
           CN+SPASA   ITVG STLSDD A+FSN+G+CVDIFAPG+NI+STYIGS +AT +LSGTS
Sbjct: 351 CNSSPASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTS 410

Query: 493 MASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNA 552
           M+SPHVAG+L Y+LSLQP   S+F+     +++P+ LK K+++Y+T   L  +P +T N 
Sbjct: 411 MSSPHVAGVLAYYLSLQPDHKSQFYHE-HSAISPKILKKKVLNYATNGTLSYLPAETVNL 469

Query: 553 LIYNGGGQDLSAFW 566
           L+YNGGG++LS FW
Sbjct: 470 LVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  394 bits (1012), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 199/418 (47%), Positives = 263/418 (62%), Gaps = 21/418 (5%)

Query: 151 IIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGI 210
           II ++YI++FK        + H         + ++N     ++    +D   S       
Sbjct: 59  IIKDQYIVIFKNSAMMAEKELH--------FKQLKNFIKTYSYEWDEKDDHKSN------ 104

Query: 211 QDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISH 270
            + F I    SGYI     E + L+RQ+P+V  +E DS V A     Q   PWGL+RIS 
Sbjct: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164

Query: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 330
           R R+ +G    Y YDD     VT+YV+DTG+ ++H+ F  RA WGKTI  ND D D +GH
Sbjct: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224

Query: 331 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGF 390
           GTH AG IAS  +G            LRSNG G MSDV+KG+E+    H K     K   
Sbjct: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKN----KNYS 280

Query: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450
           KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +AITVGAS 
Sbjct: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340

Query: 451 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 510
            SD+RA+FSNWG+CVD+FAPG+N++STYIGSD+AT +LSGTS A+P+ AGL+ Y+LSLQP
Sbjct: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQP 400

Query: 511 GSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFWND 568
             DS +F      +TP +LK K++ + +KD+L+++PE+TPN +IYNG G++LS FW D
Sbjct: 401 DKDSGYF---TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  373 bits (957), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 198/427 (46%), Positives = 262/427 (61%), Gaps = 28/427 (6%)

Query: 146 AAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTS 205
           AA P  IPN+YI++FK     + TD  +E+ H A L S                  L+T 
Sbjct: 49  AASP--IPNQYIVLFKS----DTTDIQRET-HLATLNSWL----------------LNTD 85

Query: 206 ETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGL 265
               I  SF + +   GY     +++I  +  +P++  +E+DS V A     Q  +PWGL
Sbjct: 86  PQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGL 145

Query: 266 ARISHRERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTI-PLNDE 323
           ARIS RERL L     Y YDD  A      Y++DTG+N NH +F+ RA WG    P+   
Sbjct: 146 ARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPN 205

Query: 324 DLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAH-QKQ 382
             D NGHGTHCAG I S  YG            L + G G MS V++G+EY  + H Q  
Sbjct: 206 QEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDM 265

Query: 383 AQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK 442
            ++ + GFKGS  N+SLG GKSPAL   + AAV+ G+HFAVAAGNE+ DAC+TSPA +  
Sbjct: 266 KKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPH 325

Query: 443 AITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGL 501
           A+TVGAS+ SDDR +FSNWG CVD+FAPG+NI+STYIG  ++ T +LSGTSM++P V GL
Sbjct: 326 ALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGL 385

Query: 502 LTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQD 561
           + YFLSLQP + S+F+  G  S TP QLK K+I +ST+ +L ++PE TPN ++YNGGG  
Sbjct: 386 IAYFLSLQPDTKSQFY-TGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHS 444

Query: 562 LSAFWND 568
           L  FWN+
Sbjct: 445 LKDFWNN 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  332 bits (852), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 228/342 (66%), Gaps = 14/342 (4%)

Query: 240 LVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDD-AGRGVTSYVID 298
           ++  +ERDS V    F TQ  + WGL+RIS R  L L     Y YDD+ +G+GV  Y++D
Sbjct: 143 IIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILD 202

Query: 299 TGVNVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXL 357
           TG+N NH +FE RA WG ++P+ +  L D NGHGTHCAG I SK YG            L
Sbjct: 203 TGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVL 262

Query: 358 RSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG------FKGSTANMSLGGGKSPALDLAV 411
              G G+MSDV+ G+E+ A +H  +             FKGS  N+SLG  KSP+LD+A+
Sbjct: 263 DFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIAL 322

Query: 412 NAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPG 471
            +A + GIH  VAAGNE++DAC TSPA +   ITVGAS+ SDDRA+FSNWG CVD+FAPG
Sbjct: 323 ESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPG 382

Query: 472 LNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSL-TPQQL 529
           +NI STYIG +++ T +LSG+SM+SP V+GL  Y+LSLQP   S+F     DSL TP QL
Sbjct: 383 INIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQF----HDSLMTPDQL 438

Query: 530 KNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAFWNDTKK 571
           K K+I +ST  +L ++P DT N L+YNGGG+DLS FWN T+K
Sbjct: 439 KRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRK 480

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  322 bits (826), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 225/352 (63%), Gaps = 9/352 (2%)

Query: 212 DSFNIDNMFSGY-IGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISH 270
           + F+I +   G+ +  F    +  + Q P V+ VE +S V A +   Q   PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 271 RERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 329
           R+R+ +G    Y YD   + + V  Y++DTG+ V+H++FE RA WGKTI  ND D D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 330 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKG 389
           HGTHCAG +    YG            L + G G MSDV++G+E+A   H  + Q++   
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDE--- 251

Query: 390 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449
            +GS  N+SLG G+SPAL   V AA+  G+HFAVAAGNE+ +AC +SPA+ D  +TVG S
Sbjct: 252 VRGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGS 311

Query: 450 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSL 508
           T SDDRA+FSNWG C+D+FAPG+N+ S+Y+G + + T +LSGTS ++PHVAGL+ Y LSL
Sbjct: 312 TFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSL 371

Query: 509 QPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQ 560
           +P + S+F     +   P QLK KL+  +T+  LF+VP+DT N +I+NG  Q
Sbjct: 372 EPDTKSQFHTAWSN---PAQLKQKLVSLATEGKLFEVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  310 bits (794), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 254/438 (57%), Gaps = 10/438 (2%)

Query: 135 APLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFF 194
           APLV+    +      I+P RYI++FK          H ++V + QL+   +L+  D FF
Sbjct: 52  APLVAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFF 111

Query: 195 ISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATD 254
             TRD   ST E GG+  +F+I + F+GY+GYFT E+++ IR+  +VD+VE DS++   D
Sbjct: 112 HHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDD 171

Query: 255 FDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIW 314
            +T +++ W LARISHR +L L +FN+Y +D + G+ + +Y++DTGV   H  + +R I 
Sbjct: 172 KETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIR 231

Query: 315 GKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEY 374
           G  I  N+++ D NGHGT  AG +  +  G            L   G GT+S+++KG+ +
Sbjct: 232 GIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSF 291

Query: 375 AARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACN 434
               H ++ +  K G  G+    S+ G KS +L+ A +  V +GIH  V AG +  +ACN
Sbjct: 292 VNHHHPQRIE--KNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACN 349

Query: 435 TSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATAT----LSG 490
           +SPAS+ K ITV   +++D+     NWG CVDI+ PG  + +TY   +    T    ++G
Sbjct: 350 SSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTG 409

Query: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTP 550
           +S A+  VAGLL YF SLQPG  +         LTP++LK +LI + TK  L ++   +P
Sbjct: 410 SSAAAAQVAGLLAYFASLQPGLGTP----DVIPLTPEELKERLIDFGTKGKLTNLERMSP 465

Query: 551 NALIYNGGGQDLSAFWND 568
           N + +NG G +L +F+ND
Sbjct: 466 NIIAFNGAGGNLDSFFND 483

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  194 bits (492), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 148/405 (36%), Positives = 207/405 (51%), Gaps = 71/405 (17%)

Query: 197 TRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATD-- 254
           TR  S+       I  +F+I + F G+    T ++++ I++NPLV  V  +  V A +  
Sbjct: 45  TRGRSVKEYLRDKIGKTFSIGS-FKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDV 103

Query: 255 -----------FD-----------TQNSAPWGLARISHRERLN---------LGSFNKYL 283
                      FD            Q  AP  LAR+S R++L          L S  KY 
Sbjct: 104 KDEEGDDDGGQFDNKMQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYF 162

Query: 284 YDDDA-GRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASK 341
           YD  + G  V +Y+ID+G+ + H++F  RAI G  I L  E   D NGHGTH AG + SK
Sbjct: 163 YDKRSQGASVNAYIIDSGIYLEHEEFNGRAIPG--IDLTGEGSGDYNGHGTHVAGIVGSK 220

Query: 342 HYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGG 401
            YG            L   G G+++ V+ G+E+A +  Q+ +++ +       AN+SLG 
Sbjct: 221 SYGVAKKVKLIEIKVLNRLGQGSLAMVLGGIEFAVKHCQETSKKGR-----CVANLSLGS 275

Query: 402 GKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AY 457
            ++  L+ A+ AA++AG+   VAAGN N +AC  SPASA +AITVGA    DDR    A 
Sbjct: 276 MRTAILNKAIKAAIDAGLVVVVAAGNNNLNACWYSPASAPEAITVGAF---DDRIDAIAK 332

Query: 458 FSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSE-- 515
           FSNWG+C+DIFAPG+ I S  I  D    T SGTSMASP VAGL    L+L  G  +E  
Sbjct: 333 FSNWGQCLDIFAPGVVIKSLSIFKDKEDVTYSGTSMASPTVAGLAA--LTLDQGVSAEEV 390

Query: 516 ---FFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNG 557
                EMG D++           +  + +LF     TPN + +NG
Sbjct: 391 KDYILEMGTDNV-----------FHRRSLLFK--PGTPNKICFNG 422

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  190 bits (483), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 134/380 (35%), Positives = 178/380 (46%), Gaps = 64/380 (16%)

Query: 220 FSGYIGYFTQEIIDLIRQNPLV-------DFVERDSVVEATDFD---------------- 256
           F G     +Q++++ IR NPLV        F   D V+   +                  
Sbjct: 61  FRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNP 120

Query: 257 ----TQNSAPWGLARISHRERLNLG---------SFNKYLYDDDAGRGVTSYVIDTGVNV 303
                Q  AP  LAR+S R  L            SFN Y Y    GR + +Y+IDTG+  
Sbjct: 121 FKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYK 180

Query: 304 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 363
            HKDF  RAI+G+     +   D NGHGTH AG + S ++G            L + G G
Sbjct: 181 EHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQG 239

Query: 364 TMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV 423
            ++ V+  VE+A          K  G KG  AN+SLG  ++  ++ A+ AA EAG+   V
Sbjct: 240 NLTTVISAVEFAVN------HCKSSGKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVV 293

Query: 424 AAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSD 482
           AAGN N +AC  SPASA +AITVGA    +D  A FSNWG CVDIFA G+ + S      
Sbjct: 294 AAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPP 353

Query: 483 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDI- 541
                 SGTSMASP V GL+   L                 + P+ +K KL+  +T D+ 
Sbjct: 354 HKPIAFSGTSMASPSVTGLVAILL--------------DKGVEPENIKAKLVELATHDLL 399

Query: 542 ----LFDVPEDTPNALIYNG 557
               LF  P  TPN + +NG
Sbjct: 400 QRRTLFFKP-GTPNRIAFNG 418

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  187 bits (475), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 128/321 (39%), Positives = 164/321 (51%), Gaps = 40/321 (12%)

Query: 256 DTQNSAPWGLARISHRERL--------NLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHK 306
           + Q  AP  L RIS R +L            F  Y Y+D   G  + +Y++DTG+   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 307 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 366
           DFE R I G  +   +   D NGHGTH AG + SK +G            L   GSG ++
Sbjct: 212 DFENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 367 DVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 426
            V+ G+++A   H +  +E +   K   ANMSLG  ++  ++ A++ A +AG+   VAAG
Sbjct: 271 TVLSGIQFAVD-HCRLMRETQG--KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 427 NENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNI--LSTYIG 480
           N N  AC TSPASA  AITVGA    DDR    AYFSNWG CVDIFAPG+ I  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 481 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKD 540
           S     T SGTSMASP VAGL    L                 + P  +K+KL+H STKD
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL--------------DKGVEPFDVKDKLLHLSTKD 430

Query: 541 IL----FDVPEDTPNALIYNG 557
           +           TPN + YNG
Sbjct: 431 VFNKLTLFFKYGTPNKIAYNG 451

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  186 bits (473), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 170/323 (52%), Gaps = 36/323 (11%)

Query: 251 EATDFDTQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGV 301
           EA +   Q  AP  LARIS   +L             FN Y  D+  G+GV +Y++DTG+
Sbjct: 154 EAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGI 213

Query: 302 NVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
           +  H +FE R I G  + L  E   D NGHGTH AG + S+ +G            L  +
Sbjct: 214 HAEHPEFEDRVIQG--VDLTKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKD 271

Query: 361 GSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           GSG  S+V+ G+E+      K ++ + K      AN+SLG  +SP +++AV  A+E GI 
Sbjct: 272 GSGEASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIV 328

Query: 421 FAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYI 479
           F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV+IFAPG+ I S   
Sbjct: 329 FVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSH 388

Query: 480 GSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTK 539
            +D+ +  LSGTSM++P V G+    LS                + P+ +  ++ + ST+
Sbjct: 389 LNDNESLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPELIAQEIEYLSTR 434

Query: 540 DI-----LFDVPEDTPNALIYNG 557
           ++     LF  P  TPN ++YNG
Sbjct: 435 NVFHRRTLFFKP-STPNQILYNG 456

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  185 bits (469), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 168/323 (52%), Gaps = 36/323 (11%)

Query: 251 EATDFDTQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGV 301
           E  +   Q+ AP  LARIS   +L             FN Y  DD  G+ V +Y++DTG+
Sbjct: 118 EEQNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGI 177

Query: 302 NVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
             +H +FE R I G  I L  E   D NGHGTH AG + SK YG            L  +
Sbjct: 178 FADHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKD 235

Query: 361 GSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           GSG  S+V+ G+E+      + ++ + K      AN+SLG  +SP +++AV  A+E GI 
Sbjct: 236 GSGEASNVLSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIV 292

Query: 421 FAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYI 479
           F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV+IFAPG+ I S   
Sbjct: 293 FVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSH 352

Query: 480 GSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTK 539
            + + T  LSGTSM++P V G+    LS                + P+ +  +L + ST+
Sbjct: 353 LNFNDTLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPEMIAQELEYLSTR 398

Query: 540 DI-----LFDVPEDTPNALIYNG 557
           ++     LF  P  TPN ++YNG
Sbjct: 399 NVFHRRTLFFKPS-TPNQILYNG 420

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  183 bits (465), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 137/429 (31%), Positives = 195/429 (45%), Gaps = 76/429 (17%)

Query: 156 YIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGIQDSFN 215
           Y++  K   P+  T F +  +    L+S          F+STR           I  +F+
Sbjct: 21  YLVRLKS--PKSLTKFMESKIGDMSLKS----------FVSTR-----------ISKTFS 57

Query: 216 IDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATD------------FDTQNSAPW 263
               F G+   F ++ ++ +++NPLV  V  +SV    D            +  Q  AP 
Sbjct: 58  FGK-FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPR 116

Query: 264 GLARISHRERLNLGS-------FNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGK 316
            LAR+S R  L           FN Y      G  V +Y+IDTG+   HKD   RA +G 
Sbjct: 117 HLARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGA 176

Query: 317 TIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAA 376
            + + +   D NGHGTH AG + S+ +G            L + G G ++ V+  +E++ 
Sbjct: 177 DM-VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV 235

Query: 377 RAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTS 436
              +K             AN+SLG  ++  L+ AV AAVE+G+   VAAGN N +AC  S
Sbjct: 236 NHCKKSGML-------CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNS 288

Query: 437 PASADKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTS 492
           PASA  AITVGA    DDR    A FSNWG CVD+FA G+ ++S            SGTS
Sbjct: 289 PASAISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTS 345

Query: 493 MASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDIL----FDVPED 548
           MASP VAGL    L                 + P  +K K+I  +T+++           
Sbjct: 346 MASPSVAGLAAVLL--------------DSGIDPPDIKQKIIDLATENVFQKRTLVFKPG 391

Query: 549 TPNALIYNG 557
           TPN + +NG
Sbjct: 392 TPNRIAFNG 400

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  181 bits (459), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 129/373 (34%), Positives = 183/373 (49%), Gaps = 61/373 (16%)

Query: 229 QEIIDLIRQNPLV-------DFVERDS-VVEATDFDT-----QNSAPWGLARISHRERLN 275
           ++++D IR++PLV        FV  D    E  +F++     Q  AP  L+R+S R +L 
Sbjct: 72  RDLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLP 131

Query: 276 L----------GSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL 325
                      GSFN Y  +   G G+ +Y+IDTG+   H +F  RA++G       EDL
Sbjct: 132 YDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFG-------EDL 184

Query: 326 ------DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAH 379
                 DGNGHGTH AG + S  YG            L + G G ++ V+  +E+A   H
Sbjct: 185 TGEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVN-H 243

Query: 380 QKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPAS 439
            + ++ K     G   N+SLG  ++  ++ AV AA EAGI   VAAGN N +AC  SPAS
Sbjct: 244 CRSSEGK-----GCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPAS 298

Query: 440 ADKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHV 498
           A +AITVGA    +D  A FSNWG CVDIFAPG+ + S            SGTSMASP +
Sbjct: 299 APEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSI 358

Query: 499 AGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDIL----FDVPEDTPNALI 554
            GL    L               + +   ++K+ ++  +T D+           TPN + 
Sbjct: 359 TGLAAILL--------------DEGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVA 404

Query: 555 YNGGGQDLSAFWN 567
           +NG  ++   F N
Sbjct: 405 FNGVKKNDDKFSN 417

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  182 bits (461), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 124/327 (37%), Positives = 168/327 (51%), Gaps = 36/327 (11%)

Query: 247 DSVVEATDFDTQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVI 297
           + V E  +   Q  AP  LARIS   +L             FN Y   D  G+ V +Y++
Sbjct: 114 EDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIM 173

Query: 298 DTGVNVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXX 356
           DTG+  +H +FE R I G  I L  E   D NGHGTH AG + SK YG            
Sbjct: 174 DTGIFADHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKV 231

Query: 357 LRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVE 416
           L  +GSG  S+V+ G+E+      K ++ + K      AN+SLG  +SP +++AV  A+E
Sbjct: 232 LGKDGSGEASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIE 288

Query: 417 AGIHFAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNIL 475
            GI F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV+IFAPG+ I 
Sbjct: 289 EGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIE 348

Query: 476 STYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIH 535
           S    + + T  LSGTSM++P V G+    LS                + P+ +  ++ +
Sbjct: 349 SLSHLNYNDTLILSGTSMSTPIVTGVAAILLS--------------KGIEPEMIAQEIEY 394

Query: 536 YSTKDI-----LFDVPEDTPNALIYNG 557
            ST+++     LF  P  TPN ++YNG
Sbjct: 395 LSTRNVFHRRTLFFKP-STPNQILYNG 420

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  179 bits (454), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 137/406 (33%), Positives = 192/406 (47%), Gaps = 54/406 (13%)

Query: 181 LQSVENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPL 240
           L ++ + S  + F  S     L     G I   F I  +  G     + +++D I+++P 
Sbjct: 23  LVTLNDDSRSERFMNSVLSKDLKWFMGGKINKRFQIGEL-KGLTMNLSHDVLDKIKRHPF 81

Query: 241 VDFVERDSVVEATDFDT------------QNSAPWGLARISHRERLNLGSFNK------- 281
           V  V  + +V+A + D             Q  AP  LARIS R +L     NK       
Sbjct: 82  VKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSF 141

Query: 282 -YLYDDDA-GRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIA 339
            Y YD  A G    +Y++DTGV  +HK+FE R  +G       E  D NGHGTH AG + 
Sbjct: 142 NYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVG 200

Query: 340 SKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSL 399
           SK +G            L + G+GT+  ++  +E+A +  Q+    +         NMSL
Sbjct: 201 SKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQDCQEHEDSQ------CVLNMSL 254

Query: 400 GGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR---- 455
           G  KS  L+ A+N   + GI   VAAGN N +AC TSP+SA  AITVGA    DDR    
Sbjct: 255 GSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDTI 311

Query: 456 AYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSE 515
           A FSNWG CVDIFAPG+N+ S       +    SGTSMASP V G++   L         
Sbjct: 312 AKFSNWGPCVDIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLLD-------- 363

Query: 516 FFEMGQDSLTPQQLKNKLIHYSTKDIL----FDVPEDTPNALIYNG 557
                 D + P+ +++ L   +T  +           TPN+++YNG
Sbjct: 364 ------DGVPPEDIRDYLQELATDGVFKKRTLVFKPGTPNSVLYNG 403

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  178 bits (451), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 125/320 (39%), Positives = 167/320 (52%), Gaps = 47/320 (14%)

Query: 258 QNSAPWGLARISHRERL-----NLGSF-NKYLYDDDA---GRGVTSYVIDTGVNVNHKDF 308
           Q  AP  L+R+S R +L     N+  + N + Y  DA   G  V +Y+IDTG+   H +F
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 309 EKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 367
           E R  +   I L  E   D NGHGTH AG + SK +G            L   G G +S 
Sbjct: 175 EGRVKFA--IDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLST 232

Query: 368 VVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 427
           ++K +E+  R H K++ +KK       AN+S G  ++  +D A+  A  AGI   VAAGN
Sbjct: 233 ILKALEFTIR-HCKESVDKK-----CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGN 286

Query: 428 ENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNI--LSTYIGS 481
            N DAC  SPAS+   ITVGA    DDR    A FSNWG CVD+FAPG+ +  LS   GS
Sbjct: 287 SNIDACWNSPASSKDVITVGAF---DDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGS 343

Query: 482 DDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDI 541
           D     LSGTSMASP V+G+    L                 L P+ +K+K+I  STK+I
Sbjct: 344 D--VLLLSGTSMASPSVSGIAAILL--------------DKGLNPKFVKSKIIESSTKNI 387

Query: 542 L----FDVPEDTPNALIYNG 557
                  +  +TPN +++NG
Sbjct: 388 FHQGTIMIKPNTPNLIVFNG 407

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 123/323 (38%), Positives = 167/323 (51%), Gaps = 36/323 (11%)

Query: 251 EATDFDTQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGV 301
           EA +   Q+ AP  LARIS   +L             FN Y  DD  G+ V +Y++DTG+
Sbjct: 167 EAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGI 226

Query: 302 NVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
             +H +FE R I G  I L  E   D NGHGTH AG + SK YG            L  +
Sbjct: 227 FSDHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKD 284

Query: 361 GSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           GSG  S+V+ G+E+      + ++ + K      AN+SLG  +SP +++AV  A+E GI 
Sbjct: 285 GSGEASNVLSGLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIV 341

Query: 421 FAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYI 479
           F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV+IFAPG+ I S   
Sbjct: 342 FVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSH 401

Query: 480 GSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTK 539
            + + T  LSGTSM++P V G+    LS                + P  +  ++ + ST+
Sbjct: 402 LNYEDTLILSGTSMSTPIVTGVAAVLLS--------------KGIEPALIAQEIEYLSTR 447

Query: 540 DI-----LFDVPEDTPNALIYNG 557
           ++     LF  P  T N ++YNG
Sbjct: 448 NVFHRRTLFFKP-STANQILYNG 469

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  175 bits (444), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 182/359 (50%), Gaps = 53/359 (14%)

Query: 229 QEIIDLIRQNPLVDFVERDSVVEATDFD--------------TQNSAPWGLARISHRERL 274
           Q+I++ ++QNPLV  +  + + +A + D               Q+ AP  LARIS R++L
Sbjct: 76  QKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKL 135

Query: 275 -----NLGS----FNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL 325
                N+ S    FN Y   +  G  V +Y++D+GV+ N  DFE R  +G      D + 
Sbjct: 136 PYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEG 194

Query: 326 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQE 385
           D NGHGTH AG + SK YG            L   G GT+  V+  +E+A     +  ++
Sbjct: 195 DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPEK 254

Query: 386 KKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAIT 445
           +        AN+SLG  K+  ++ A+ AA E G+   VAAGN N +AC TSPASA++AIT
Sbjct: 255 R------CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAIT 308

Query: 446 VGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGL 501
           VGA    DDR    A FSNWG CVDI+APG+ + S          + SGTSMASP V G 
Sbjct: 309 VGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQ 365

Query: 502 LTYFLSLQPGSD---SEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNG 557
           +   L     +D   S   +M  D +           +  + +LF    +TPN +++NG
Sbjct: 366 VAILLDKGIPNDDIKSTLIKMATDDV-----------FQKRTLLFK--PNTPNRVLFNG 411

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  172 bits (435), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 119/319 (37%), Positives = 162/319 (50%), Gaps = 46/319 (14%)

Query: 258 QNSAPWGLARISHR-------ERLNLGSFN-KYLYDDD-AGRGVTSYVIDTGVNVNHKDF 308
           Q  AP  LARIS R       E +++ + N  Y YDD+ +G  V +YVIDTG+   H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 309 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 368
           E RA +G  + + +   D NGHGTH AG I S+ +G            L + G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 369 VKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 428
           +  +E+            +K  +G  AN+SLG  ++  L+ AV AA+EAG+   VAAGN 
Sbjct: 254 ISAIEF-------TVNHCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 429 NQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGSDDA 484
           N +AC +SPAS+  AITVGA    DDR    A FSNWG CVDIFAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 485 TATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYST------ 538
               SGTSMASP V+G++   L                 + P  +K +LI  +T      
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL--------------DSGIHPFDIKTELIDLATDSVFHK 409

Query: 539 KDILFDVPEDTPNALIYNG 557
           + +LF     TPN + + G
Sbjct: 410 RTLLFK--PGTPNRVAFTG 426

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  175 bits (444), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 167/335 (49%), Gaps = 43/335 (12%)

Query: 253 TDFDTQNSAPWGLARISHRERL-----NLGSFNK---YLYDD-DAGRGVTSYVIDTGVNV 303
           + F  Q  AP  LARIS R++L     N   F +   Y YDD D G GV +YVIDTG+  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 304 NHKDFEKRAIWGKTIPLNDEDLDG------NGHGTHCAGTIASKHYGXXXXXXXXXXXXL 357
            HKDFE R  +G        DL G      NGHGTH AG I SK YG            +
Sbjct: 342 EHKDFEDRVEFGT-------DLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAV 394

Query: 358 RSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEA 417
              GS  +S +++ +EY       +  +K         NMSLG      ++ AV +A+  
Sbjct: 395 SLTGSTQLSHIIEAIEYTVNDCNSRVDKK-----ACVVNMSLGSFYVKVINEAVESAIAE 449

Query: 418 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLN 473
           G+ F VAAGN N DAC +SP S+  AITVGA    DDR    A FSNWG+CVDIFA G+ 
Sbjct: 450 GVVFVVAAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVE 506

Query: 474 ILSTYIGSDDATATLSGTSMASPHVAGLLTYFLS--LQPGSDSEFFEMGQDSLTPQQLKN 531
           + S            SGTSMASP V G ++  LS  ++P    E  EM + S      + 
Sbjct: 507 VKSLSSQVPYKYIKYSGTSMASPIVCGFVSILLSQGVKPNDVQE--EMVKLSTKGDFTRR 564

Query: 532 KLIH--YSTKDILFD--VPEDT-PNALIYNGGGQD 561
            LI   +++  ILF+   P D+  N  + N  G+D
Sbjct: 565 SLIFKPFTSNRILFNGMDPRDSYENDEMENDCGED 599

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 159/345 (46%), Gaps = 62/345 (17%)

Query: 257 TQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 307
           TQ+ AP  LAR+S R +L             FN Y Y    GR V +YV+D+GV ++H D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 308 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 367
           FE RA +G     +    D NGHGTH AG I SK YG            L S GSGT+  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 368 VVKGVEYAAR-----------------------AHQKQAQEKKKGFKGSTANMSLGGGKS 404
           V+ G+E+ +                        +H    + K+        N+SLG  +S
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKR-----CVINLSLGTFRS 333

Query: 405 PALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSN 460
             ++ A+   ++ GI   VAAGN N +AC TSPAS    ITVGA    DDR    A FSN
Sbjct: 334 TIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSN 390

Query: 461 WGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMG 520
           WG CVDIFAPG+ + S            +GTSMA+P V GL+   L              
Sbjct: 391 WGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL-------------- 436

Query: 521 QDSLTPQQLKNKLIHYSTKDIL----FDVPEDTPNALIYNGGGQD 561
              + P Q+K +L   +T +I           TPN + +NG  +D
Sbjct: 437 DSGIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRD 481

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  169 bits (429), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 139/395 (35%), Positives = 194/395 (49%), Gaps = 72/395 (18%)

Query: 208 GGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFD----------- 256
           G I  +F+  + F G     T++++  I++NPLV  V  +  + A D+D           
Sbjct: 54  GKISKTFSFGS-FRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 257 ---------------TQNSAPWGLARISHRERLNLGSFNKYLYDDDA---------GRGV 292
                           QN AP  LAR+S R  L     +K  Y+D           G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 293 TSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXX 351
            +Y+ID+G+++N ++FE RA  G  + L  E   D NGHGTH AG + SK YG       
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHG--LDLTGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTL 230

Query: 352 XXXXXLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAV 411
                L   GSG++  V+  +E+    H  +++ KK       AN+SLG    P L+ A+
Sbjct: 231 VEVKALDRQGSGSLITVISALEFVVN-HCGKSKSKK-----CVANLSLGAFMMPLLNEAI 284

Query: 412 NAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDI 467
            A V++G+   VAAGN N DAC  SPAS   AITVGA    DDR    A FSNWG CVDI
Sbjct: 285 KATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDI 341

Query: 468 FAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSE-----FFEMGQD 522
           FAPG+ I S  I  +  +   SGTSMASP VAG+++  + L  G ++E      FE+  D
Sbjct: 342 FAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVS--ILLDQGVENEDIRDYLFELATD 399

Query: 523 SLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNG 557
            +           +  + +LF  P  TPN + +NG
Sbjct: 400 DV-----------FQKRTLLFK-PR-TPNRITFNG 421

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  170 bits (431), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 166/322 (51%), Gaps = 37/322 (11%)

Query: 258 QNSAPWGLARISHRERLNLGS-------FNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEK 310
           Q+ AP  LAR   R  L   +       FN Y   +  G  V  Y++D+G++ +H +FE 
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 311 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 370
           RA++G     N+   D NGHGTH AG + SK YG            +  +G G+ S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 371 GVEYAARAHQKQAQEKKKGFKGSTANMSLGG---GKSPALDLAVNAAVEAGIHFAVAAGN 427
           GVE+A + H +Q+ +K        ANMSLGG   G S ALD AV AA+E G+ F VAAGN
Sbjct: 389 GVEFAVK-HCQQSGKK------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 428 ENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATA 486
             + AC  SPA    AITVGA    SD  A FSN+GKCVDIFAPG+ + S      +   
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 487 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFD-- 544
            L+GTSM++P  AG++   L                 +  + +K +LI  STK +     
Sbjct: 501 VLNGTSMSAPITAGVVAVLL--------------DQGVKHEDVKERLIDLSTKGVFHRRR 546

Query: 545 -VPEDTPNALIYNGGGQDLSAF 565
            V   TP+  ++NG  Q+   F
Sbjct: 547 LVSSRTPDRTLFNGVPQEDDVF 568

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  165 bits (417), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 157/320 (49%), Gaps = 40/320 (12%)

Query: 256 DTQNSAPWGLARISHRERL--------NLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHK 306
           D Q  AP  L ++S R +L            F  Y YD    G     Y+IDTGV   HK
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 307 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 366
           +F  R  +G    + +   D NGHGTH AG I SK +G            L   G G ++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 367 DVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 426
            V++G+E+A    + + Q   K       NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNNCKLKQQPMGKN---CVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 427 NENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIGSD 482
           N N  AC TSPAS++ AITVGA    DDR    A FSNWG+CVDIFAPG+ I S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 483 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDI- 541
           +     SGTSMASP VAGL+   +      D              ++K KLI  S+K I 
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILMEKGYKCD--------------EIKQKLIDDSSKSIF 426

Query: 542 ----LFDVPEDTPNALIYNG 557
               LF     TPN +IYNG
Sbjct: 427 SKLTLF-FKYGTPNRVIYNG 445

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  166 bits (419), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 163/325 (50%), Gaps = 37/325 (11%)

Query: 255 FDTQNSAPWGLARISHRERLNLG-------SFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 307
           +  Q  AP  LAR   R  L          +FN Y  ++  G GV  YV+D+G+  +H +
Sbjct: 425 YAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPE 484

Query: 308 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 367
           F+ RA +G      +   D NGHGTH AG + S+ +G            +  +G G+ S+
Sbjct: 485 FDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSN 543

Query: 368 VVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGG---GKSPALDLAVNAAVEAGIHFAVA 424
           ++ GVE+A +  Q+         K   ANMSLGG   G S ALD AV AA+E G+ F VA
Sbjct: 544 IIAGVEFAVKHCQQSG-------KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVA 595

Query: 425 AGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDD 483
           AGN  + AC  SPA    AITVGA    SD  A FSN+GKCVDIFAPG+ + S      +
Sbjct: 596 AGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSN 655

Query: 484 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILF 543
               L+GTSM++P  AG++   L                 + P ++K+ L+  STK +  
Sbjct: 656 TMRVLNGTSMSAPITAGVVAVLL--------------DQGIEPHEVKDHLLSISTKGLFH 701

Query: 544 D---VPEDTPNALIYNGGGQDLSAF 565
               V   TP+  ++ G  ++  +F
Sbjct: 702 KRRLVSSRTPDRALFTGVKREDDSF 726

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  157 bits (397), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 166/326 (50%), Gaps = 46/326 (14%)

Query: 251 EATDFDTQNSAPWGLARISHRERLNLGSFN--------KYLYDDD-AGRGVTSYVIDTGV 301
           E  DF  Q +AP  LARIS R  L     N         Y YDD   G  V +YVIDTG+
Sbjct: 126 EFPDFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGI 185

Query: 302 NVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNG 361
              H+ F+ RA +G  + + +   D NGHGTH AG I S+ YG            L + G
Sbjct: 186 FKEHRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKG 244

Query: 362 SGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHF 421
            G ++ V+  +E+    H ++++      +G  AN+SLG  ++  L+ AV AA+EAG+  
Sbjct: 245 QGNLTSVISAIEFTVN-HCRKSK------RGCVANLSLGSFRNSVLNQAVEAALEAGVVV 297

Query: 422 AVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILST 477
            VAAGN N +AC +SPAS+  AI+VGA    DDR    A FSNWG CVD+FAPG+ I S 
Sbjct: 298 VVAAGNSNANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASL 354

Query: 478 YIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYS 537
                  +   SGTSMASP V G++   L                 + P  +K +LI+ +
Sbjct: 355 SNIPPFKSVAYSGTSMASPLVTGMVAVLL--------------DSGIHPFDIKEELINTA 400

Query: 538 T------KDILFDVPEDTPNALIYNG 557
           T      + +LF     TPN + + G
Sbjct: 401 TDSVFHKRALLFK--PGTPNRVAFTG 424

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  155 bits (391), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 128/325 (39%), Positives = 168/325 (51%), Gaps = 44/325 (13%)

Query: 254 DFDTQNSAPWGLARISHRERLNL------GSFNKYLYDDD-AGRGVTSYVIDTGVNVNHK 306
           DF +Q+ AP  LARIS R +L +       S  KY Y ++  G GV  YV+D+GVN +H 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 307 DFEKRAIWG-KTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 365
           DFE RA+ G  T      DL   GHGTH AG I SK YG            L S G GT+
Sbjct: 210 DFEGRAMKGIDTTGEGSGDL--VGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTV 267

Query: 366 SDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGG-GKSPALDLAVNAAVEAGIHFAVA 424
           +++++G+EY    +Q   +++K        NMSLG  G    LD AV+A +E G+   VA
Sbjct: 268 TNIIEGLEYV--VNQCIGKKRK-----CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVA 320

Query: 425 AGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDIFAPGLNILSTYIG 480
            GN   +AC  SPA   KAITV A    DDR    A FSNWG C+DI+APG+N+ S    
Sbjct: 321 GGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-N 376

Query: 481 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKD 540
               T  LSGTSMASP VAG    +L           + G D   P +++  L   +T+ 
Sbjct: 377 KGRGTFVLSGTSMASPIVAGAAAIYL-----------DQGAD---PAEVRKILSKTATRG 422

Query: 541 IL----FDVPEDTPNALIYNGGGQD 561
           +       V   TPN ++Y G  Q+
Sbjct: 423 VFKKRAIAVRPRTPNKVLYTGNNQE 447

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  132 bits (333), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 157/310 (50%), Gaps = 17/310 (5%)

Query: 205 SETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWG 264
           S+ GG+  + ++ N F    G F Q +++ +  +  +  +  D ++   ++  Q  AP  
Sbjct: 41  SDNGGV-GAISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAH 99

Query: 265 LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED 324
           LAR+S +  L  GS   Y+Y  + G GV  Y++DTG++  H + E R    K   L    
Sbjct: 100 LARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRV--QKIADLTSNP 156

Query: 325 L---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYAARAHQK 381
           +   D +GHGT  AG I S  +G              S G+ T+  V++ +E+A++    
Sbjct: 157 VSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASKLASV 216

Query: 382 QAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAV-EAGIHFAVAAGNENQDACNTSPASA 440
             +        S   +     K+  L+ A+ A + +  +   VA GN NQ+AC++SPASA
Sbjct: 217 TQRP-------SVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASA 269

Query: 441 DKAITVGA--STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHV 498
             A+T+G+   T  D  A F+N+G C+D FA G+NI S   G  ++    SGTS+++   
Sbjct: 270 YGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIA 329

Query: 499 AGLLTYFLSL 508
           +G++ Y++SL
Sbjct: 330 SGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  128 bits (321), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 87/258 (33%), Positives = 125/258 (48%), Gaps = 13/258 (5%)

Query: 255 FDTQNSAPWGLARISHRERLNLGS---FNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 311
           + TQ +AP  L+R S   +L   S   +N Y   D  G  VT YV+D+G+ ++H +FE R
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 312 AIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 370
            +  +     D  + D  GHGT  AG I SK YG            L + G G +  +++
Sbjct: 202 IL--EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 371 GVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 430
           G+++      K  +E   G      N SLG      L+ A      AGI    AAGN   
Sbjct: 260 GLQFIT----KHCEENTNG--NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 431 DACNTSPASADKAITVGASTLSDDR-AYFSNWGKCVDIFAPGLNILSTYIGSDDATATLS 489
           +AC  +PA +    TVG+    DD  A FSNWG+CVD+ APG+ + +    +   +   S
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESS 373

Query: 490 GTSMASPHVAGLLTYFLS 507
           GTS+++P V GL    LS
Sbjct: 374 GTSVSTPIVTGLAAILLS 391

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  122 bits (307), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 106/368 (28%), Positives = 184/368 (50%), Gaps = 40/368 (10%)

Query: 203 STSETGGIQDSFNIDNMFSGYIGYFTQEII-DLIRQNPLVDFVERDSVVEATDFDTQNSA 261
           + +  GG   +  + N F    G F Q+++ D  R   +V  +  D  +   ++  Q  A
Sbjct: 38  AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVA-MSMDRPLGVAEYMVQQHA 96

Query: 262 PWGLARISHRERLNLGSFN---KYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTI 318
           P  LAR+S +  L  G+ +    Y+Y  +AG GV  Y++DTG++  H  FE R    K  
Sbjct: 97  PNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRV--QKAA 154

Query: 319 PLNDEDL---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYA 375
             + + +   D +GHGT  AG I S  +G              S G  ++  V++ +E+A
Sbjct: 155 DFSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHA 214

Query: 376 ARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAV-EAGIHFAVAAGNENQDACN 434
           +    K A   K+    S   + L   ++  L+ AV A V +  I   VAAGNEN+ AC+
Sbjct: 215 S----KLAAVTKRP---SLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACS 267

Query: 435 TSPASADKAITVGASTLS--DDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATA-TLSGT 491
            SPA A  A+T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G D ++   LSGT
Sbjct: 268 VSPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGT 325

Query: 492 SMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTP- 550
           S+++   +GL+ Y++S+           G D++      NK+   S  +++ ++ + +P 
Sbjct: 326 SISAGVASGLVAYYMSIG--------HYGMDAV------NKIKLLSLPNVIPNLQQRSPE 371

Query: 551 --NALIYN 556
             NA++ N
Sbjct: 372 TRNAILQN 379

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  117 bits (292), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 153/312 (49%), Gaps = 24/312 (7%)

Query: 212 DSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISH- 270
           D   I + F G+ G F  E++  +  +P V  +  D ++   ++  QN AP  LAR+S+ 
Sbjct: 53  DKIVIGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNG 112

Query: 271 --RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL--- 325
               R++  + N +++   AG GV  Y++D+G++  H  F  R I  K I L D  +   
Sbjct: 113 VSNSRVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVG 171

Query: 326 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGT-MSDVVKGVEYAARAHQKQAQ 384
           D +GHGT  AG + S  +G            + +  +G  +S ++K +E+          
Sbjct: 172 DPHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFI-------EN 224

Query: 385 EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 444
             +   + S A +     K+  L+ A+  ++   I   V AGN++  ACN SPASA  + 
Sbjct: 225 HSRATMRPSVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQ 283

Query: 445 TVGASTLSDDR-----AYFSNWGKCVDIFAPGLNI--LSTYIGSDD-ATATLSGTSMASP 496
           ++ +    D R     A FSN+G+CVD+F  G+ +  L     SD+   + +SGTSM+  
Sbjct: 284 SILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCA 343

Query: 497 HVAGLLTYFLSL 508
             AG + Y++SL
Sbjct: 344 IAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  107 bits (267), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 97/355 (27%), Positives = 159/355 (44%), Gaps = 45/355 (12%)

Query: 201 SLSTSETGG-IQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQN 259
           +LS+ + G  I D F + + F  + G F+  I+  +  +P V  + RD  ++  +   QN
Sbjct: 35  ALSSDQQGPEITDIFELGS-FRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQN 93

Query: 260 SAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIW----- 314
           +AP  L  +S    L   S   ++Y  + G GV  Y++DTG+++ H +  K  I      
Sbjct: 94  NAPSHLVGLSSISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADL 150

Query: 315 -GKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVE 373
               +P   +  D  GHGT  AG IAS+ +G              SNG   +S +++ + 
Sbjct: 151 TQSPVP---QGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALT 207

Query: 374 YAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDAC 433
              R       E  K        + +  G +P L  A+ A+ +  +   + AGN  QDA 
Sbjct: 208 LTQRHI-----EGTKRPSVVVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDAL 261

Query: 434 NTSPASAD----KAITVGASTLSDDRAYFSNWGKCVDIFAPGLNI-------LSTYIGSD 482
           N SPA+ +      I VG+  ++++   F+N+G  VD+F  G  I       L +   S+
Sbjct: 262 NFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSN 321

Query: 483 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYS 537
             T  +SGTS +S   AG++ Y++SL               L   Q  NK++ YS
Sbjct: 322 SLTRQVSGTSASSAITAGVIGYYMSL--------------GLNSTQSINKVLQYS 362

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 92/353 (26%), Positives = 161/353 (45%), Gaps = 43/353 (12%)

Query: 178 QAQLQSVENLSAEDAFF----ISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIID 233
           Q  +Q VEN +  +AF     I   DS++   E G         N F  + G  ++E + 
Sbjct: 23  QYIIQLVEN-TQVNAFLKKHDIDVMDSNILPIEIG---------NSFIAFSGDLSKEQVS 72

Query: 234 LIRQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSF----NKYLYDDDAG 289
            + ++     +  +  +E   +  Q  AP  L R++ ++ +    +    N+Y++ D +G
Sbjct: 73  SVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSG 131

Query: 290 RGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL---DGNGHGTHCAGTIASKHYGXX 346
            GV  Y++DTG+++ H  + +  I  K I L    +   D NGHGT  AG I S  +G  
Sbjct: 132 NGVDIYIVDTGIDIQHPIYLQNNIH-KLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVL 190

Query: 347 XXXXXXXXXXLRSNGS-GTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSP 405
                     + +N    TMS V+  +    +  QK         + S   +     K+ 
Sbjct: 191 KSANLVDVRVVDANTKHATMSRVLSALSLIEKHEQKT-------MRPSIIVLPFQTEKNT 243

Query: 406 ALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK---AITVGASTLSDDRAY----- 457
            L+ A+   +   I   + AGN++Q+AC  SP    K    + VG+   S+++ Y     
Sbjct: 244 ILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAK 302

Query: 458 FSNWGKCVDIFAPGLNILSTYIGSD---DATATLSGTSMASPHVAGLLTYFLS 507
           FSN+G CVDI+  G++I +    S+   +    ++GTS +   VAG++ Y++S
Sbjct: 303 FSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 152/334 (45%), Gaps = 27/334 (8%)

Query: 184 VENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDF 243
           V  L+++ +    +RD S S        +   + + F    G F+ E ++ +  +  V  
Sbjct: 17  VVQLASDTSLVELSRDCSFSIGVGKNFIEMITVGDQFKALAGEFSVEDLEYLYHDERVVA 76

Query: 244 VERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNV 303
           + RD  ++  ++  Q  +P  L+++S       GSF    +D  +G  V  YV DTG++ 
Sbjct: 77  ISRDRDLKLQEYKVQYGSPRHLSQLSSG-----GSFT---FDPVSGNLVDVYVFDTGIDF 128

Query: 304 NHKDFE-----KRAIWGKT-IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXL 357
            H   +     K A +  + +P      D +GHGT  AG IAS+ +G             
Sbjct: 129 KHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTMMAGLIASETFGVLKSCSLVDVRVA 185

Query: 358 RSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEA 417
             +G   +S ++KG+  A+ AH +  +         T      G K+  LD  + A +  
Sbjct: 186 DKDGEVKLSTLMKGIS-ASVAHARFTKRPSVFVLPMTI-----GKKNHILDNFLQA-IPK 238

Query: 418 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL-- 475
            I   + AGN+  DAC+ SP +    + +G+    +  A FSN+G CVD++  G +IL  
Sbjct: 239 DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNYGNCVDVYTSGTDILTL 298

Query: 476 -STYIGSDDATATLSGTSMASPHVAGLLTYFLSL 508
            ST  G++    + +GTS +    AG++ Y +S+
Sbjct: 299 RSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 120/280 (42%), Gaps = 30/280 (10%)

Query: 244 VERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNV 303
           +  D  +E  +   Q  AP  L ++   E  +    N+++YD  AG GV  Y+ DTG+  
Sbjct: 83  ISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTGIAR 138

Query: 304 NHKDFEKRAIWGKT----IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 359
           N        I         P+ D+++    HGT  +G I S  +G               
Sbjct: 139 NSPGLSASRIHDMPGMPGPPIRDQEIL--EHGTAMSGLIGSPAFGVLKKCNLIDVNVGDE 196

Query: 360 NGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGI 419
           NG   MS V+KG+           Q  K   + S  N S    K+  L+ A +      +
Sbjct: 197 NGKVFMSKVLKGLNLV-------QQHVKHTNRPSVINFSYCTLKNAILNSAFD-NFPRDV 248

Query: 420 HFAVAAGNENQDACNTSPASADK---AITVGASTLSDD---RAYFSNWGKCVDIFAPGLN 473
             AVAAGN  Q  C+ SP    +    +  G+  ++DD    + FSN+G CV  +APG  
Sbjct: 249 PIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEG 308

Query: 474 ILSTYI------GSDDATATLSGTSMASPHVAGLLTYFLS 507
           +L+  I       S D    +SGTS +S   AG++ Y+++
Sbjct: 309 LLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 281 KYLYDDDAGRGVTSYVIDTGV---NVNHKD-FEKRAIW--GKTIPLNDEDLDGNGHGTHC 334
           +  Y++  G G+ + ++D GV   N N KD F +   W      PL    L  + HGT C
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRC 242

Query: 335 AGTIAS 340
           AG IA+
Sbjct: 243 AGEIAA 248

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNVNHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 337
           Y++  G GV + ++D G++  ++D    F     W      PL    L  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 338 IAS 340
           IA+
Sbjct: 245 IAA 247

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNVNHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 337
           Y++  G GV + ++D G++   +D    F K   W       L    LD + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 338 IAS 340
           IA+
Sbjct: 214 IAA 216

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 90/248 (36%), Gaps = 34/248 (13%)

Query: 288 AGRGVTSYVIDTGVNVNHKD----FEKRAIW----GKTIPLNDEDLDGNGHGTHCAGTIA 339
            G+GV + +ID GV+    D    F K   W     + +P+    L  + HGT CAG IA
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPM--PLLSDDNHGTRCAGEIA 226

Query: 340 S---KHYGXXXXXXXXXXXXLRS-NGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTA 395
           +    +Y             +R  +G  T  D     E A+  H     +      G T 
Sbjct: 227 AIRNNNYCGVGVAYDAKVSGIRILSGPLTAED-----EAASLVHALDVNDIYSCSWGPTD 281

Query: 396 NMSLGGGKSPALDLAVNAAVEAG-------IHFAVAAGNENQDACNTSP-ASADKAITVG 447
           +     G SP +  A+   V  G         FA   G  + D CN     ++  +ITVG
Sbjct: 282 DGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNSIYSITVG 341

Query: 448 ASTLSDDRAYFSNWGKCVDIFAPGLNILS-TYIGSDDATATL----SGTSMASPHVAGLL 502
           A         +S    C  +     +  S  YI S D          GTS A+P  AG+ 
Sbjct: 342 AIDHKGLHPPYSE--SCSAVLVVTYSSGSGEYIHSTDINGGCYDRHGGTSAAAPIAAGIY 399

Query: 503 TYFLSLQP 510
              L   P
Sbjct: 400 ALVLEANP 407

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 474 ILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKL 533
           +L  Y   D +      +S  S      L+Y+ +L+PG  ++F+++ Q SL P +   KL
Sbjct: 24  LLMVYYSVDLSVPVQHSSSDRSNSCDRCLSYYETLEPGWSNDFYDVNQKSLAPAEDVIKL 83

Query: 534 IHYSTKDILF 543
           +   T+ I+F
Sbjct: 84  V---TRIIIF 90

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 281 KYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHC 334
           K  Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT C
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRC 217

Query: 335 AGTIASK 341
           AG IA+K
Sbjct: 218 AGEIAAK 224

>NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85
           YGR240C
          Length = 987

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 359 SNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAG 418
           +N S + SDV +    +A    KQ    +K  K   A M+  GG SP ++ AV A V  G
Sbjct: 174 ANVSESSSDVSRDASLSAINMLKQTLSGQK--KKKIAVMT-SGGDSPGMNAAVRAVVRTG 230

Query: 419 IHF 421
           IHF
Sbjct: 231 IHF 233

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 288 AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGTIAS 340
            G+ VT  ++D GV+  ++D + +  +  +   ND        L  + HGT CAG IA+
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAA 224

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 337
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 338 IASK 341
           IA+K
Sbjct: 221 IAAK 224

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 337
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 338 IASK 341
           IA+K
Sbjct: 221 IAAK 224

>Kwal_56.23320 s56 complement(491440..493254) [1815 bp, 604 aa] {ON}
           YLR286C (CTS1) - Endochitinase [contig 181] FULL
          Length = 604

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 247 DSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLY 284
           D+VV+  DFD ++S P G A ++ R R N  S +K  Y
Sbjct: 143 DAVVDGFDFDIEDSQPEGYAALAKRLRKNFDSASKEYY 180

>KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.463
           YDR239C
          Length = 856

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 285 DDDAGRGVTSYVIDTGVNVNH-KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKH 342
           D+++     S ++ +GVNV+H K+F +   + K +PL  +D + N H T+  G + S +
Sbjct: 690 DENSNPDFNSKLLQSGVNVDHTKEFHR--FFNKDLPLGSDDDEFNEHDTNADGDLRSDY 746

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNVNHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 337
           Y +  G+GV + V+D G++  + D    F K   W       L    L  + HGT CAG 
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGE 211

Query: 338 IAS 340
           IA+
Sbjct: 212 IAA 214

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 337
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDYHGTRCAGE 220

Query: 338 IASK 341
           IA+K
Sbjct: 221 IAAK 224

>NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {ON}
           Anc_5.85
          Length = 987

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 5/42 (11%)

Query: 380 QKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHF 421
           Q  A +KKK     T+     GG SP ++ AV A V  GIHF
Sbjct: 197 QSLAGQKKKKIAVMTS-----GGDSPGMNAAVRAVVRTGIHF 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,014,583
Number of extensions: 2656486
Number of successful extensions: 6793
Number of sequences better than 10.0: 91
Number of HSP's gapped: 6774
Number of HSP's successfully gapped: 100
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)