Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.286.16ON99899844530.0
Suva_5.66.16ON999100140740.0
YEL061C (CIN8)6.16ON1000100240400.0
Smik_5.266.16ON1002100439740.0
TDEL0G045306.16ON95892923510.0
ZYRO0C07898g6.16ON97493022550.0
NDAI0D008706.16ON106993222270.0
KAFR0L003706.16ON96391921250.0
NCAS0H008806.16ON100462416630.0
Kpol_1032.66.16ON100463915880.0
CAGL0B03641g6.16ON98865315760.0
SAKL0E01078g6.16ON94869115630.0
KLLA0D01045g6.16ON96564315350.0
Kwal_56.224036.16ON94367714970.0
KNAG0M011306.16ON95069414141e-180
Ecym_30206.16ON94459914111e-179
TBLA0A072306.16ON109760914231e-179
ACR010C6.16ON94561714011e-178
TPHA0M002406.16ON93968113921e-176
KLTH0C11330g6.16ON94170413851e-175
Kpol_1045.736.16ON96264511951e-147
TPHA0J003006.16ON98292611281e-137
Suva_2.547.387ON11106387355e-81
YBL063W (KIP1)7.387ON11116227181e-78
Smik_2.537.387ON11136237135e-78
Skud_2.417.387ON11107087101e-77
ACR228C7.387ON11296127073e-77
TPHA0E008907.387ON12327896962e-75
Ecym_46887.387ON11345936881e-74
NCAS0E026407.387ON11026296773e-73
SAKL0F12298g7.387ON11126146747e-73
ZYRO0B03234g7.387ON11387096597e-71
NDAI0E043007.387ON11867326572e-70
TDEL0C016007.387ON11057156534e-70
KAFR0L017107.387ON11516746464e-69
TBLA0D006407.387ON11427145711e-59
SAKL0G18920g2.633ON6493694053e-40
Kwal_56.22407singletonOFF1081083364e-36
Kwal_47.186085.531ON4793403522e-34
KLTH0G03850g5.531ON4733023504e-34
KLLA0B00759g5.531ON4562723477e-34
Ecym_34152.633ON6624153494e-33
ADR145C2.633ON6353653484e-33
SAKL0G05016g5.531ON5042903401e-32
TPHA0D034803.528ON8475773426e-32
NDAI0I029603.528ON8684923392e-31
YGL216W (KIP3)3.528ON8054603337e-31
Smik_7.483.528ON8054383274e-30
Skud_7.533.528ON8054413265e-30
NCAS0E005503.528ON7844713256e-30
SAKL0F01760g3.528ON8094303248e-30
Suva_7.443.528ON8054523231e-29
KLLA0A01606g3.528ON7694683193e-29
AER441C3.528ON8183933193e-29
TDEL0D059603.528ON7334163166e-29
CAGL0I07029g3.528ON7053483157e-29
Kpol_423.83.528ON8064343151e-28
TBLA0C049603.528ON8014803141e-28
KNAG0B005203.528ON7233823103e-28
KAFR0F042103.528ON6724493085e-28
Ecym_40665.531ON4783263025e-28
Kwal_47.190933.528ON8193443087e-28
ZYRO0E08668g3.528ON7784363042e-27
ZYRO0D12650g5.531ON4783212972e-27
TDEL0A062408.678ON6373772995e-27
TBLA0C039403.479ON7391823005e-27
SAKL0H06490g8.678ON6573662942e-26
KLTH0G01606g3.528ON8191812953e-26
Kpol_1004.255.531ON5063042893e-26
CAGL0D04994g3.479ON6921482872e-25
KLLA0D05951g8.678ON6683672853e-25
Kpol_1013.78.678ON6203872843e-25
TPHA0D032003.479ON7241672828e-25
KAFR0H024108.678ON6583842801e-24
Kpol_1050.1033.479ON6971512801e-24
KAFR0B065903.479ON7061752801e-24
Kwal_26.88068.678ON7153592801e-24
Ecym_12003.528ON8331802802e-24
NCAS0C013508.678ON6553782782e-24
KNAG0A078803.479ON7641422792e-24
NCAS0F034703.479ON6981772782e-24
AGR253W3.479ON7091722747e-24
NDAI0B057703.479ON7631562712e-23
ZYRO0B04290g3.479ON7311732693e-23
TDEL0B072702.633ON6444152683e-23
TDEL0F036403.479ON7041732684e-23
SAKL0F03168g3.479ON7061742666e-23
ZYRO0F07414g8.678ON6542992657e-23
Ecym_44073.479ON7111662659e-23
TBLA0C053103.479ON6761812631e-22
Ecym_23958.678ON6874002631e-22
YPR141C (KAR3)3.479ON7291482613e-22
Kpol_505.393.479ON6921502603e-22
ACR145W8.678ON6854022594e-22
NDAI0E02090singletonON6854192594e-22
TPHA0D012708.678ON6963642594e-22
Skud_16.4353.479ON7291482595e-22
Smik_16.3883.479ON7291482595e-22
Suva_16.4693.479ON7311482595e-22
CAGL0M02189g8.678ON6723962577e-22
KLTH0F14498g3.479ON7021742551e-21
Kpol_1019.112.633ON6473812542e-21
KLLA0B10956g3.479ON6901632523e-21
KLTH0D11286g8.678ON6783762471e-20
YPL155C (KIP2)8.678ON7062012292e-18
Smik_6.3528.678ON7153792282e-18
Skud_16.1278.678ON7062012255e-18
TPHA0N016502.633ON6823812247e-18
Suva_16.1558.678ON7042012221e-17
TPHA0D041903.479ON6721612202e-17
KNAG0J017208.678ON6252672192e-17
NCAS0H031802.633ON6603762122e-16
TBLA0C018808.678ON4681502083e-16
YKL079W (SMY1)2.633ON6563312014e-15
Smik_11.1602.633ON6563652005e-15
TBLA0A008202.633ON8034681962e-14
Skud_11.1482.633ON6563721943e-14
Kpol_483.114.238ON25466341855e-13
NDAI0D044204.238ON19146631811e-12
CAGL0L05104g2.633ON6754281792e-12
TPHA0B008304.238ON25365331793e-12
NCAS0A024504.238ON19286961766e-12
Suva_11.1452.633ON6573691746e-12
Kwal_56.22402singletonOFF93481541e-11
YDL058W (USO1)4.238ON17905131731e-11
NDAI0C004802.633ON5983651674e-11
TPHA0H016805.414ON9895181684e-11
Kpol_1043.705.702ON13216051668e-11
Suva_4.1914.238ON17827521651e-10
Kwal_55.21164singletonOFF5881591622e-10
Kwal_YGOB_55.211643.479ON6571591622e-10
TBLA0B099704.46ON10654991586e-10
TPHA0B042101.110ON13034891552e-09
TPHA0D046105.702ON11835501542e-09
ZYRO0B12144g4.238ON20055061542e-09
TBLA0C008002.633ON6933311514e-09
Skud_4.5485.296ON8775021514e-09
YNL225C (CNM67)2.16ON5812831495e-09
CAGL0G02497g5.702ON17805191506e-09
Suva_6.1047.186ON11702681498e-09
CAGL0H01144g5.296ON8204481489e-09
TBLA0E040608.604ON8044911471e-08
CAGL0E03454g4.46ON8674411471e-08
SAKL0H03300g4.238ON17075191471e-08
TBLA0I029004.238ON17947331471e-08
NDAI0H019507.21ON8564421462e-08
CAGL0D00924g4.238ON19804921462e-08
KLLA0E05281g4.238ON17554651452e-08
Ecym_53454.238ON13664151434e-08
KAFR0G032004.238ON18694551426e-08
TBLA0A104705.267ON19996371426e-08
TPHA0D017505.296ON8814571416e-08
KAFR0H002105.702ON14546221417e-08
KNAG0A033608.604ON7564441407e-08
TBLA0C027401.295ON11194541409e-08
Skud_10.1701.295ON12304701409e-08
Ecym_11081.110ON12985451409e-08
Suva_16.536.289ON4913041381e-07
Skud_15.3838.636ON4854011371e-07
KLLA0C17204g4.46ON7684561381e-07
YDR285W (ZIP1)5.296ON8754561381e-07
NCAS0F032205.414ON9625571381e-07
KAFR0D013307.101ON10803241381e-07
ABL193C2.16ON8626071372e-07
Ecym_82315.267ON18544621372e-07
TDEL0A058208.636ON4763931352e-07
KAFR0E043404.364ON6164161353e-07
Suva_8.2698.636ON4854651343e-07
Kpol_1065.363.330ON12193391353e-07
ZYRO0G06600g5.702ON18205911354e-07
KAFR0F030204.46ON8244361344e-07
SAKL0H08426g8.604ON8164491335e-07
AAL182W1.295ON12313501336e-07
Suva_11.3315.702ON18982561336e-07
Smik_4.5345.296ON8764581327e-07
YLR309C (IMH1)4.46ON9115741327e-07
KNAG0I029604.46ON9644221327e-07
Skud_14.881.110ON13165241328e-07
TBLA0F027507.488ON14144481328e-07
TBLA0E017305.702ON18206741328e-07
TPHA0A011508.604ON8183831319e-07
Skud_4.6255.414ON9474291319e-07
KNAG0L021405.702ON16085201311e-06
YIL149C (MLP2)5.702ON16795511311e-06
KLTH0D14102g4.238ON17126381311e-06
Suva_15.2095.267ON19294561311e-06
NDAI0E050405.702ON19734281311e-06
CAGL0D00638g4.268ON6934141301e-06
Skud_16.1068.704ON8713091301e-06
SAKL0H24200g4.46ON9635501301e-06
KNAG0C050605.414ON10404111301e-06
NCAS0F005205.88ON10864681301e-06
TPHA0E023205.267ON19154251301e-06
CAGL0L02695g8.636ON4593251281e-06
Kpol_1031.155.414ON9293841292e-06
YFR031C (SMC2)7.186ON11702781292e-06
KLLA0C02915g1.110ON12964511292e-06
NCAS0D001402.16ON6024771282e-06
Smik_4.1764.238ON17955151292e-06
Skud_9.245.696ON6904511282e-06
Kpol_1059.308.636ON4573481272e-06
Suva_9.395.702ON16825371282e-06
KAFR0G020908.604ON7323261273e-06
Skud_12.3934.46ON9135181273e-06
Skud_4.1964.238ON17925161273e-06
TDEL0B021905.702ON18104561273e-06
Kpol_1051.255.267ON19685051273e-06
YDR356W (SPC110)5.414ON9444321264e-06
TBLA0A036205.414ON9703321264e-06
NCAS0A032005.702ON17884401264e-06
ZYRO0E01078g2.633ON6681411254e-06
NCAS0B036308.331ON24473311264e-06
TBLA0A105804.364ON8134741255e-06
Suva_2.3118.331ON9654301255e-06
Kpol_2001.755.702ON10065241255e-06
KLLA0C10879g5.296ON7556291246e-06
ZYRO0C01716g8.259ON14133451247e-06
TBLA0H012408.331ON17954721247e-06
YKR095W (MLP1)5.702ON18754881247e-06
NCAS0J022004.364ON7073551238e-06
CAGL0A02596g5.414ON8723301238e-06
NDAI0B055205.414ON10095461238e-06
NDAI0A026007.233ON11203231239e-06
NCAS0C040008.68ON12234401239e-06
NCAS0C052002.633ON5723231229e-06
KLLA0A03509g7.21ON7763451221e-05
KLLA0E21517g5.414ON8583661221e-05
Smik_7.3467.186ON11702821221e-05
Skud_11.3345.702ON18855301221e-05
ZYRO0A11132gsingletonON6983721211e-05
Kpol_1018.1413.425ON7642161211e-05
NCAS0B018008.604ON7914861211e-05
KAFR0E040105.414ON9054591211e-05
KNAG0M025402.633ON5221021201e-05
YNL250W (RAD50)1.110ON13124251212e-05
Smik_2.677.488ON13775721212e-05
NDAI0F002905.702ON15545261212e-05
KAFR0E017505.267ON18915511212e-05
Kwal_23.55345.267ON19075111212e-05
Skud_11.471.162ON6784251202e-05
YKL179C (COY1)1.162ON6794411202e-05
Kpol_1026.314.46ON10054651202e-05
TBLA0G035308.68ON12324181202e-05
KLTH0D14784g4.268ON6634061192e-05
NDAI0C058808.604ON8464291192e-05
Suva_15.3575.88ON11723961193e-05
AER045C4.238ON12924841193e-05
SAKL0G11110g5.267ON18714341193e-05
TBLA0B051606.188ON6524731183e-05
TPHA0H014205.696ON7033891183e-05
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Skud_5.28
         (2997 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...  1719   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...  1573   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...  1560   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...  1535   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   910   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   873   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   862   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   823   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   645   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   616   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   611   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   606   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   595   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   581   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   549   e-180
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   548   e-179
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   552   e-179
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   544   e-178
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   540   e-176
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   538   e-175
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   464   e-147
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   439   e-137
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   287   5e-81
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   281   1e-78
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   279   5e-78
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   278   1e-77
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   276   3e-77
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   272   2e-75
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   269   1e-74
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   265   3e-73
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   264   7e-73
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   258   7e-71
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   257   2e-70
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   256   4e-70
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   253   4e-69
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   224   1e-59
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   160   3e-40
Kwal_56.22407 s56 complement(113066..113392) [327 bp, 108 aa] {O...   134   4e-36
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   140   2e-34
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   139   4e-34
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   138   7e-34
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   139   4e-33
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   138   4e-33
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   135   1e-32
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   136   6e-32
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   135   2e-31
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   132   7e-31
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   130   4e-30
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   130   5e-30
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   129   6e-30
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   129   8e-30
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   129   1e-29
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   127   3e-29
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   127   3e-29
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   126   6e-29
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   125   7e-29
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   125   1e-28
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   125   1e-28
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   124   3e-28
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   123   5e-28
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   120   5e-28
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   123   7e-28
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   121   2e-27
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   119   2e-27
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   119   5e-27
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   120   5e-27
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   117   2e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   118   3e-26
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   115   3e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   115   2e-25
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   114   3e-25
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   114   3e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   113   8e-25
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   112   1e-24
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   112   1e-24
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   112   1e-24
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   112   1e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   2e-24
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   111   2e-24
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   112   2e-24
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   111   2e-24
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   110   7e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   108   2e-23
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   108   3e-23
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...   107   3e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   107   4e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   107   6e-23
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   106   7e-23
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   106   9e-23
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   105   1e-22
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...   105   1e-22
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   105   3e-22
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   104   3e-22
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   104   4e-22
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   104   4e-22
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   104   4e-22
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   104   5e-22
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   104   5e-22
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   104   5e-22
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   103   7e-22
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   102   1e-21
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...   102   2e-21
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   101   3e-21
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   100   1e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    93   2e-18
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    92   2e-18
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    91   5e-18
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    91   7e-18
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    90   1e-17
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    89   2e-17
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    89   2e-17
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     86   2e-16
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    85   3e-16
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    82   4e-15
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    82   5e-15
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    80   2e-14
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    79   3e-14
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    76   5e-13
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    74   1e-12
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    74   2e-12
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    74   3e-12
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    72   6e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    72   6e-12
Kwal_56.22402 s56 complement(111953..112234) [282 bp, 93 aa] {OF...    64   1e-11
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    71   1e-11
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    69   4e-11
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    69   4e-11
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...    69   8e-11
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    68   1e-10
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    67   2e-10
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    67   2e-10
TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]...    65   6e-10
TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {...    64   2e-09
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    64   2e-09
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    64   2e-09
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    63   4e-09
Skud_4.548 Chr4 (974878..977511) [2634 bp, 877 aa] {ON} YDR285W ...    63   4e-09
YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON} ...    62   5e-09
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    62   6e-09
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    62   8e-09
CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [246...    62   9e-09
TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8...    61   1e-08
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    61   1e-08
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    61   1e-08
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    61   1e-08
NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {O...    61   2e-08
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    61   2e-08
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...    60   2e-08
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    60   4e-08
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    59   6e-08
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    59   6e-08
TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {O...    59   6e-08
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    59   7e-08
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    59   7e-08
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    59   9e-08
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    59   9e-08
Ecym_1108 Chr1 (226176..230072) [3897 bp, 1298 aa] {ON} similar ...    59   9e-08
Suva_16.53 Chr16 complement(80323..81798) [1476 bp, 491 aa] {ON}...    58   1e-07
Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {...    57   1e-07
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    58   1e-07
YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}  ZIP1Tran...    58   1e-07
NCAS0F03220 Chr6 (653886..656774) [2889 bp, 962 aa] {ON} Anc_5.4...    58   1e-07
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    58   1e-07
ABL193C Chr2 complement(44011..46599) [2589 bp, 862 aa] {ON} Syn...    57   2e-07
Ecym_8231 Chr8 complement(471639..477203) [5565 bp, 1854 aa] {ON...    57   2e-07
TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa] ...    57   2e-07
KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {O...    57   3e-07
Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON...    56   3e-07
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    57   3e-07
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    57   4e-07
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    56   4e-07
SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {...    56   5e-07
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    56   6e-07
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    56   6e-07
Smik_4.534 Chr4 (963951..966581) [2631 bp, 876 aa] {ON} YDR285W ...    55   7e-07
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    55   7e-07
KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {O...    55   7e-07
Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250...    55   8e-07
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    55   8e-07
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    55   8e-07
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    55   9e-07
Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356...    55   9e-07
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    55   1e-06
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    55   1e-06
KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa...    55   1e-06
Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR02...    55   1e-06
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    55   1e-06
CAGL0D00638g Chr4 complement(80947..83028) [2082 bp, 693 aa] {ON...    55   1e-06
Skud_16.106 Chr16 complement(192440..195055) [2616 bp, 871 aa] {...    55   1e-06
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    55   1e-06
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    55   1e-06
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    55   1e-06
TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {...    55   1e-06
CAGL0L02695g Chr12 (317998..319377) [1380 bp, 459 aa] {ON} simil...    54   1e-06
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    54   2e-06
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    54   2e-06
KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} simil...    54   2e-06
NCAS0D00140 Chr4 complement(9836..11644) [1809 bp, 602 aa] {ON} ...    54   2e-06
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    54   2e-06
Skud_9.24 Chr9 (55176..57248) [2073 bp, 690 aa] {ON} YIL144W (REAL)    54   2e-06
Kpol_1059.30 s1059 (64396..65769) [1374 bp, 457 aa] {ON} (64396....    54   2e-06
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    54   2e-06
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    54   3e-06
Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {...    54   3e-06
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    54   3e-06
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...    54   3e-06
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...    54   3e-06
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    53   4e-06
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...    53   4e-06
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    53   4e-06
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    53   4e-06
NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8....    53   4e-06
TBLA0A10580 Chr1 (2617516..2619957) [2442 bp, 813 aa] {ON} Anc_4...    53   5e-06
Suva_2.311 Chr2 (551150..554047) [2898 bp, 965 aa] {ON} YDR150W ...    53   5e-06
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    53   5e-06
KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly...    52   6e-06
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    52   7e-06
TBLA0H01240 Chr8 complement(272947..278334) [5388 bp, 1795 aa] {...    52   7e-06
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    52   7e-06
NCAS0J02200 Chr10 complement(425055..427178) [2124 bp, 707 aa] {...    52   8e-06
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    52   8e-06
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    52   8e-06
NDAI0A02600 Chr1 complement(580677..584039) [3363 bp, 1120 aa] {...    52   9e-06
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....    52   9e-06
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    52   9e-06
KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {...    52   1e-05
KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa]...    52   1e-05
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    52   1e-05
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...    52   1e-05
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    51   1e-05
Kpol_1018.141 s1018 complement(374392..376686) [2295 bp, 764 aa]...    51   1e-05
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    51   1e-05
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    51   1e-05
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    51   1e-05
YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Sub...    51   2e-05
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    51   2e-05
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    51   2e-05
KAFR0E01750 Chr5 (356404..362079) [5676 bp, 1891 aa] {ON} Anc_5....    51   2e-05
Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR0...    51   2e-05
Skud_11.47 Chr11 complement(97012..99048) [2037 bp, 678 aa] {ON}...    51   2e-05
YKL179C Chr11 complement(110464..112503) [2040 bp, 679 aa] {ON} ...    51   2e-05
Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {...    51   2e-05
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    51   2e-05
KLTH0D14784g Chr4 (1213137..1215128) [1992 bp, 663 aa] {ON} simi...    50   2e-05
NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8...    50   2e-05
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    50   3e-05
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    50   3e-05
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...    50   3e-05
TBLA0B05160 Chr2 complement(1214624..1216582) [1959 bp, 652 aa] ...    50   3e-05
TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {O...    50   3e-05
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    50   3e-05
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    50   3e-05
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    50   4e-05
Kpol_1066.8 s1066 (12763..14607) [1845 bp, 614 aa] {ON} (12763.....    50   4e-05
KNAG0F00130 Chr6 complement(7147..8238) [1092 bp, 363 aa] {ON} A...    49   4e-05
KLLA0D19580g Chr4 (1650584..1652848) [2265 bp, 754 aa] {ON} weak...    49   5e-05
NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {...    49   5e-05
KAFR0I00250 Chr9 complement(53495..55828) [2334 bp, 777 aa] {ON}...    49   5e-05
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    49   5e-05
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    49   6e-05
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    49   6e-05
Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON...    49   6e-05
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    49   6e-05
TDEL0E03590 Chr5 complement(670913..676561) [5649 bp, 1882 aa] {...    49   6e-05
ZYRO0C11066g Chr3 (851369..857125) [5757 bp, 1918 aa] {ON} simil...    49   6e-05
Suva_7.183 Chr7 (340138..342027) [1890 bp, 629 aa] {ON} YGL086W ...    49   6e-05
Kpol_1018.23 s1018 complement(59840..61795) [1956 bp, 651 aa] {O...    49   6e-05
Skud_4.182 Chr4 complement(319563..321665) [2103 bp, 700 aa] {ON...    49   7e-05
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    49   7e-05
ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {...    49   7e-05
AER241W Chr5 (1082034..1084592) [2559 bp, 852 aa] {ON} Syntenic ...    49   7e-05
Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {...    49   7e-05
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    49   8e-05
SAKL0A05170g Chr1 complement(466816..468768) [1953 bp, 650 aa] {...    49   9e-05
Ecym_7101 Chr7 (194579..196732) [2154 bp, 717 aa] {ON} similar t...    49   9e-05
Kpol_1055.27 s1055 (70806..73295) [2490 bp, 829 aa] {ON} (70806....    49   9e-05
Kpol_269.2 s269 (2702..5299) [2598 bp, 865 aa] {ON} (2702..5299)...    49   9e-05
NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] ...    49   1e-04
SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly...    48   1e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    48   1e-04
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    48   1e-04
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...    48   1e-04
NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa]...    48   1e-04
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    48   1e-04
YBR148W Chr2 (537876..539705) [1830 bp, 609 aa] {ON}  YSW1Protei...    48   1e-04
Skud_7.196 Chr7 (350356..352593) [2238 bp, 745 aa] {ON} YGL086W ...    48   2e-04
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    48   2e-04
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...    48   2e-04
Ecym_2368 Chr2 (715575..717851) [2277 bp, 758 aa] {ON} similar t...    47   2e-04
TPHA0H00930 Chr8 complement(192292..194943) [2652 bp, 883 aa] {O...    47   2e-04
NDAI0G05870 Chr7 (1456354..1457745) [1392 bp, 463 aa] {ON} Anc_1...    47   2e-04
TPHA0F03220 Chr6 complement(702115..703551) [1437 bp, 478 aa] {O...    47   2e-04
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    47   2e-04
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    47   2e-04
CAGL0J07348g Chr10 (711496..713091) [1596 bp, 531 aa] {ON} weakl...    47   2e-04
Kpol_529.7 s529 complement(14735..16807) [2073 bp, 690 aa] {ON} ...    47   3e-04
TBLA0H03720 Chr8 complement(904264..906969) [2706 bp, 901 aa] {O...    47   3e-04
TPHA0C04540 Chr3 (977635..980451) [2817 bp, 938 aa] {ON}               47   3e-04
TBLA0J00960 Chr10 complement(215541..218597) [3057 bp, 1018 aa] ...    47   3e-04
ZYRO0F16038g Chr6 complement(1315669..1319583) [3915 bp, 1304 aa...    47   3e-04
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    47   3e-04
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    47   3e-04
TBLA0C01020 Chr3 complement(201774..203645) [1872 bp, 623 aa] {O...    47   3e-04
Smik_2.270 Chr2 complement(480391..481668) [1278 bp, 425 aa] {ON...    46   4e-04
CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} simi...    47   4e-04
TPHA0E03680 Chr5 (779557..780873) [1317 bp, 438 aa] {ON} Anc_1.4...    46   4e-04
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    47   4e-04
KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} simila...    47   4e-04
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    47   4e-04
NDAI0J00340 Chr10 complement(56120..58030) [1911 bp, 636 aa] {ON...    46   4e-04
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    46   5e-04
TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {...    46   5e-04
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    46   5e-04
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    46   5e-04
Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON} (19685.....    46   6e-04
NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {O...    46   6e-04
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    46   6e-04
TDEL0D05180 Chr4 complement(940548..943061) [2514 bp, 837 aa] {O...    46   6e-04
Suva_5.26 Chr5 (46040..48943) [2904 bp, 967 aa] {ON} YEL043W (REAL)    46   6e-04
TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3....    46   7e-04
TBLA0G03150 Chr7 (832779..834314) [1536 bp, 511 aa] {ON} Anc_3.1...    45   7e-04
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    45   7e-04
YDR150W Chr4 (755628..763874) [8247 bp, 2748 aa] {ON}  NUM1Prote...    46   7e-04
Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W...    45   8e-04
YJR134C Chr10 complement(673729..675852) [2124 bp, 707 aa] {ON} ...    45   8e-04
TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.2...    45   8e-04
NDAI0E03740 Chr5 (811831..814764) [2934 bp, 977 aa] {ON} Anc_7.3...    45   8e-04
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...    45   9e-04
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    45   9e-04
YPL253C Chr16 complement(71063..73006) [1944 bp, 647 aa] {ON}  V...    45   0.001
Smik_9.25 Chr9 (55776..57854) [2079 bp, 692 aa] {ON} YIL144W (REAL)    45   0.001
Suva_4.175 Chr4 complement(313538..315640) [2103 bp, 700 aa] {ON...    45   0.001
YBR130C Chr2 complement(495592..496869) [1278 bp, 425 aa] {ON}  ...    45   0.001
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    45   0.001
TPHA0M01780 Chr13 (368492..371146) [2655 bp, 884 aa] {ON} Anc_3....    45   0.001
ZYRO0G16588g Chr7 complement(1356025..1358808) [2784 bp, 927 aa]...    45   0.001
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    45   0.001
TDEL0C05910 Chr3 complement(1063668..1067585) [3918 bp, 1305 aa]...    45   0.001
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...    45   0.001
TBLA0E03890 Chr5 complement(977425..981744) [4320 bp, 1439 aa] {...    45   0.001
NDAI0E01450 Chr5 (288999..290555) [1557 bp, 518 aa] {ON} Anc_8.6...    45   0.001
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    45   0.001
Smik_1.16 Chr1 complement(37947..39830) [1884 bp, 627 aa] {ON} Y...    45   0.001
Kwal_27.11183 s27 (675668..677650) [1983 bp, 660 aa] {ON} YGL086...    45   0.001
Kwal_23.5662 s23 complement(1259373..1260641) [1269 bp, 422 aa] ...    44   0.001
Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195...    45   0.001
TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4...    45   0.001
Kwal_14.2326 s14 (707822..710593) [2772 bp, 923 aa] {ON} YLR309C...    45   0.001
TBLA0I01280 Chr9 complement(271364..274147) [2784 bp, 927 aa] {O...    45   0.001
TPHA0M00410 Chr13 complement(79537..80919) [1383 bp, 460 aa] {ON...    44   0.001
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    45   0.002
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    45   0.002
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    45   0.002
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...    45   0.002
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    45   0.002
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...    45   0.002
KLLA0E19141g Chr5 (1703466..1705412) [1947 bp, 648 aa] {ON} simi...    44   0.002
KAFR0C01340 Chr3 complement(279474..281588) [2115 bp, 704 aa] {O...    44   0.002
KAFR0B03130 Chr2 complement(649445..651979) [2535 bp, 844 aa] {O...    44   0.002
ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic ho...    44   0.002
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    44   0.002
Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa]...    44   0.002
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    44   0.002
NCAS0B01760 Chr2 (290690..292162) [1473 bp, 490 aa] {ON} Anc_8.6...    44   0.002
Kpol_1009.17 s1009 (37274..41821) [4548 bp, 1515 aa] {ON} (37274...    44   0.002
ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON...    44   0.002
YOR195W Chr15 (712866..715331) [2466 bp, 821 aa] {ON}  SLK19Kine...    44   0.002
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    44   0.002
NDAI0I02760 Chr9 complement(646478..649687) [3210 bp, 1069 aa] {...    44   0.003
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    44   0.003
TDEL0C04720 Chr3 complement(855282..858650) [3369 bp, 1122 aa] {...    44   0.003
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...    44   0.003
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...    44   0.003
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...    44   0.003
CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {...    44   0.003
TPHA0A01520 Chr1 complement(296953..302685) [5733 bp, 1910 aa] {...    44   0.003
KAFR0H00740 Chr8 (139077..140207) [1131 bp, 376 aa] {ON} Anc_3.3...    43   0.003
Kpol_YGOB_1055.70 s1055 complement(184555..186555) [2001 bp, 666...    44   0.003
Kpol_1055.70 s1055 complement(184555..186561) [2007 bp, 668 aa] ...    44   0.003
Suva_11.45 Chr11 complement(95306..97351) [2046 bp, 681 aa] {ON}...    44   0.003
TPHA0J02260 Chr10 (502547..504697) [2151 bp, 716 aa] {ON} Anc_6....    44   0.003
KNAG0A02280 Chr1 complement(208088..210670) [2583 bp, 860 aa] {O...    44   0.003
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    44   0.003
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    44   0.003
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    44   0.003
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    44   0.003
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...    43   0.004
CAGL0M13123g Chr13 complement(1289611..1291605) [1995 bp, 664 aa...    43   0.004
TBLA0F03670 Chr6 (899616..902108) [2493 bp, 830 aa] {ON} Anc_8.2...    43   0.004
Kwal_23.4424 s23 complement(713602..716448) [2847 bp, 948 aa] {O...    43   0.004
YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON} ...    43   0.005
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    43   0.005
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    43   0.005
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...    43   0.005
Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {...    43   0.005
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    43   0.005
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    43   0.005
TDEL0E02100 Chr5 complement(395609..397894) [2286 bp, 761 aa] {O...    43   0.005
SAKL0D14454g Chr4 (1186923..1189358) [2436 bp, 811 aa] {ON} weak...    43   0.005
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    43   0.006
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    43   0.006
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    43   0.006
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    43   0.006
KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {...    42   0.006
KAFR0H01130 Chr8 complement(208194..212312) [4119 bp, 1372 aa] {...    43   0.006
NDAI0D01830 Chr4 complement(424039..429711) [5673 bp, 1890 aa] {...    43   0.006
SAKL0E09350g Chr5 complement(778947..779414,779476..779493) [486...    40   0.006
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    43   0.007
Suva_10.263 Chr10 complement(467506..469209,469243..469413) [187...    42   0.007
KLLA0F00770g Chr6 (65967..67853) [1887 bp, 628 aa] {ON} some sim...    42   0.007
Skud_1.13 Chr1 complement(30899..32809) [1911 bp, 636 aa] {ON} Y...    42   0.007
AEL270W Chr5 (132790..134703) [1914 bp, 637 aa] {ON} Syntenic ho...    42   0.007
Ecym_4024 Chr4 (57388..59376) [1989 bp, 662 aa] {ON} similar to ...    42   0.007
TBLA0A00590 Chr1 complement(115712..116875) [1164 bp, 387 aa] {O...    42   0.007
NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496...    42   0.007
KLLA0E08031g Chr5 complement(722953..724179) [1227 bp, 408 aa] {...    42   0.007
TPHA0N00350 Chr14 (63601..66156) [2556 bp, 851 aa] {ON} Anc_7.39...    42   0.007
Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {...    42   0.007
NCAS0E00730 Chr5 complement(132088..135330) [3243 bp, 1080 aa] {...    42   0.008
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    42   0.008
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    42   0.008
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    42   0.008
Suva_8.254 Chr8 complement(457591..459003) [1413 bp, 470 aa] {ON...    42   0.008
CAGL0F00671g Chr6 complement(73893..78593) [4701 bp, 1566 aa] {O...    42   0.008
TPHA0F00540 Chr6 (126413..126452,126544..127139) [636 bp, 211 aa...    41   0.008
TBLA0I01170 Chr9 (245439..252158) [6720 bp, 2239 aa] {ON}              42   0.008
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    42   0.009
TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {O...    42   0.010
Smik_14.247 Chr14 complement(458876..459475) [600 bp, 199 aa] {O...    40   0.010
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    42   0.010
NDAI0J00690 Chr10 (145016..148705) [3690 bp, 1229 aa] {ON} Anc_7...    42   0.010
Skud_15.365 Chr15 complement(657763..659175) [1413 bp, 470 aa] {...    42   0.010
YOR198C Chr15 complement(718653..720065) [1413 bp, 470 aa] {ON} ...    42   0.010
SAKL0H20174g Chr8 (1764879..1769282) [4404 bp, 1467 aa] {ON} wea...    42   0.010
TBLA0J00690 Chr10 (157822..163251) [5430 bp, 1809 aa] {ON} Anc_5...    42   0.011
KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] ...    42   0.011
NCAS0F01210 Chr6 (235930..236592) [663 bp, 220 aa] {ON} Anc_5.55...    40   0.012
KLTH0F16742g Chr6 (1357590..1358402) [813 bp, 270 aa] {ON} simil...    41   0.012
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    42   0.012
NDAI0K01100 Chr11 complement(256280..258946) [2667 bp, 888 aa] {...    42   0.013
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    42   0.013
ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic h...    42   0.013
YFR016C Chr6 complement(177042..180743) [3702 bp, 1233 aa] {ON} ...    42   0.013
TPHA0J01590 Chr10 (365984..369814) [3831 bp, 1276 aa] {ON} Anc_8...    42   0.013
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}            42   0.014
KLLA0E17931g Chr5 complement(1598775..1599242,1599482..1599499) ...    39   0.016
YPL174C Chr16 complement(220167..222773) [2607 bp, 868 aa] {ON} ...    41   0.016
AAL109W Chr1 (150547..153291) [2745 bp, 914 aa] {ON} Syntenic ho...    41   0.017
Ecym_7269 Chr7 complement(566660..569602) [2943 bp, 980 aa] {ON}...    41   0.017
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    41   0.017
TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON...    41   0.017
NDAI0G01310 Chr7 complement(290871..293945) [3075 bp, 1024 aa] {...    41   0.017
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    41   0.017
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    41   0.017
KLTH0F03058g Chr6 (264710..268606) [3897 bp, 1298 aa] {ON} simil...    41   0.018
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    41   0.018
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....    41   0.018
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...    41   0.018
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    41   0.018
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    41   0.018
Smik_15.402 Chr15 complement(697238..698785) [1548 bp, 515 aa] {...    41   0.019
TPHA0H01250 Chr8 (278379..280088) [1710 bp, 569 aa] {ON} Anc_5.5...    41   0.019
Kpol_292.1 s292 complement(1..1737) [1737 bp, 579 aa] {ON} compl...    41   0.019
TPHA0M00170 Chr13 complement(33610..35478) [1869 bp, 622 aa] {ON...    41   0.020
Kwal_23.3059 s23 complement(138649..139194) [546 bp, 181 aa] {ON...    39   0.020
Smik_6.457 Chr6 (751338..753281) [1944 bp, 647 aa] {ON} YPL253C ...    41   0.020
TDEL0E01020 Chr5 complement(208284..210287) [2004 bp, 667 aa] {O...    41   0.020
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    41   0.020
KNAG0F02120 Chr6 complement(403190..405319) [2130 bp, 709 aa] {O...    41   0.021
Kwal_26.8487 s26 (806801..808978) [2178 bp, 725 aa] {ON} YOR195W...    41   0.021
TPHA0C02960 Chr3 complement(647899..648384) [486 bp, 161 aa] {ON...    39   0.021
KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {...    41   0.021
KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]...    41   0.021
Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}...    41   0.021
CAGL0H08558g Chr8 (837576..840908) [3333 bp, 1110 aa] {ON} simil...    41   0.023
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    41   0.023
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    41   0.023
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}              41   0.023
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...    41   0.023
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    40   0.023
NDAI0F02570 Chr6 complement(630462..634955) [4494 bp, 1497 aa] {...    41   0.023
YJR140C Chr10 complement(690750..695696) [4947 bp, 1648 aa] {ON}...    41   0.024
NDAI0A08140 Chr1 (1865702..1867156) [1455 bp, 484 aa] {ON}             40   0.024
Skud_14.251 Chr14 complement(468833..469432) [600 bp, 199 aa] {O...    39   0.024
KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {...    41   0.024
Kpol_344.6 s344 (13142..19165) [6024 bp, 2007 aa] {ON} (13142..1...    41   0.024
NCAS0E01770 Chr5 (344556..346253) [1698 bp, 565 aa] {ON} Anc_7.204     40   0.025
YAL047C Chr1 complement(54989..56857) [1869 bp, 622 aa] {ON}  SP...    40   0.026
Smik_15.457 Chr15 complement(788706..790682) [1977 bp, 658 aa] {...    40   0.026
AFL065C Chr6 complement(312000..313979) [1980 bp, 659 aa] {ON} S...    40   0.026
KLLA0B04136g Chr2 (373969..375975) [2007 bp, 668 aa] {ON} simila...    40   0.027
NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {O...    40   0.027
Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {...    40   0.027
KLLA0C12573g Chr3 (1068765..1071257) [2493 bp, 830 aa] {ON} simi...    40   0.028
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    40   0.029
SAKL0B07062g Chr2 complement(611326..614658) [3333 bp, 1110 aa] ...    40   0.030
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    40   0.030
KLLA0F22451g Chr6 (2098204..2099559) [1356 bp, 451 aa] {ON} simi...    40   0.030
CAGL0H09680g Chr8 (943940..947986) [4047 bp, 1348 aa] {ON} simil...    40   0.030
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...    40   0.031
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...    40   0.031
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...    40   0.031
KLLA0D02310g Chr4 complement(196687..198294) [1608 bp, 535 aa] {...    40   0.032
Kpol_1033.33 s1033 (91526..93262) [1737 bp, 578 aa] {ON} (91526....    40   0.033
KNAG0C00940 Chr3 complement(178596..180593) [1998 bp, 665 aa] {O...    40   0.035
KLLA0C10967g Chr3 (943312..944514) [1203 bp, 400 aa] {ON} simila...    40   0.037
YEL043W Chr5 (70478..73348) [2871 bp, 956 aa] {ON} Predicted cyt...    40   0.038
TBLA0I01560 Chr9 complement(340408..341091) [684 bp, 227 aa] {ON...    39   0.039
Kpol_1032.80 s1032 complement(173475..174347) [873 bp, 290 aa] {...    39   0.039
TPHA0E01060 Chr5 (218359..219696) [1338 bp, 445 aa] {ON}               40   0.040
CAGL0J07788g Chr10 complement(759175..763092) [3918 bp, 1305 aa]...    40   0.040
Suva_15.96 Chr15 (171608..172963) [1356 bp, 451 aa] {ON} YOL069W...    40   0.040
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....    40   0.040
NCAS0B02980 Chr2 (514099..515658) [1560 bp, 519 aa] {ON} Anc_8.4...    40   0.042
SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} simi...    40   0.045
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    40   0.046
TPHA0F02570 Chr6 (562455..563102) [648 bp, 215 aa] {ON} Anc_6.62...    39   0.048
TPHA0F00340 Chr6 (70646..73366) [2721 bp, 906 aa] {ON} Anc_4.32 ...    40   0.049
TBLA0H03270 Chr8 complement(798333..799568) [1236 bp, 411 aa] {O...    39   0.050
NCAS0J01800 Chr10 complement(336846..338093) [1248 bp, 415 aa] {...    39   0.050
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    40   0.051
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    40   0.051
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    40   0.051
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...    40   0.052
TPHA0A04070 Chr1 (913518..915056) [1539 bp, 512 aa] {ON} Anc_3.2...    39   0.055
YNL079C Chr14 complement(478566..479165) [600 bp, 199 aa] {ON}  ...    38   0.057
NDAI0G05120 Chr7 complement(1244017..1245948) [1932 bp, 643 aa] ...    39   0.060
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    39   0.061
TPHA0C02780 Chr3 complement(607856..608953) [1098 bp, 365 aa] {O...    39   0.062
TBLA0G01730 Chr7 complement(451840..454089) [2250 bp, 749 aa] {O...    39   0.062
KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly...    39   0.063
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    39   0.063
Skud_4.198 Chr4 (348379..350895) [2517 bp, 838 aa] {ON} YDL056W ...    39   0.063
NCAS0C01160 Chr3 (214545..217124) [2580 bp, 859 aa] {ON} Anc_8.7...    39   0.064
TDEL0C02520 Chr3 (438435..441068) [2634 bp, 877 aa] {ON} Anc_1.4...    39   0.064
TBLA0C06000 Chr3 (1455431..1458295) [2865 bp, 954 aa] {ON} Anc_1...    39   0.065
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...    39   0.066
Ecym_7456 Chr7 complement(935231..938503) [3273 bp, 1090 aa] {ON...    39   0.066
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    39   0.067
CAGL0D06622g Chr4 complement(629323..632859) [3537 bp, 1178 aa] ...    39   0.067
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    39   0.067
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...    39   0.068
TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8...    39   0.074
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    39   0.077
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    39   0.078
SAKL0B09218g Chr2 (782333..782947) [615 bp, 204 aa] {ON} similar...    38   0.080
TBLA0E04530 Chr5 (1151440..1153530) [2091 bp, 696 aa] {ON} Anc_4...    39   0.080
Sklu_YGOB_Anc_5.296 Chr7 (891742..892812) [1071 bp, 356 aa] {ON}...    39   0.080
TBLA0I02150 Chr9 (496050..498299) [2250 bp, 749 aa] {ON} Anc_3.3...    39   0.081
NCAS0A07500 Chr1 complement(1490789..1493320) [2532 bp, 843 aa] ...    39   0.083
TPHA0L02220 Chr12 (463956..465104) [1149 bp, 382 aa] {ON} Anc_5....    39   0.084
SAKL0D11990g Chr4 complement(994808..997408) [2601 bp, 866 aa] {...    39   0.084
YKL073W Chr11 (296430..299075) [2646 bp, 881 aa] {ON}  LHS1Molec...    39   0.084
Smik_11.231 Chr11 (380726..381541) [816 bp, 271 aa] {ON} YKL023W...    38   0.086
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    39   0.087
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...    39   0.087
TPHA0F00360 Chr6 (80013..83468) [3456 bp, 1151 aa] {ON} Anc_4.39...    39   0.088
KNAG0H00820 Chr8 (127894..131364) [3471 bp, 1156 aa] {ON} Anc_3....    39   0.088
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...    39   0.090
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....    39   0.090
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...    39   0.090
KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON} Anc_...    39   0.094
KLTH0H04774g Chr8 complement(426645..428621) [1977 bp, 658 aa] {...    39   0.10 
TBLA0B03680 Chr2 (848989..850977) [1989 bp, 662 aa] {ON} Anc_8.7...    39   0.10 
Suva_13.373 Chr13 (627318..629513) [2196 bp, 731 aa] {ON} YMR192...    39   0.11 
TBLA0B07540 Chr2 complement(1792231..1795248) [3018 bp, 1005 aa]...    39   0.11 
TBLA0A03020 Chr1 complement(723036..726128) [3093 bp, 1030 aa] {...    39   0.11 
NDAI0K01840 Chr11 (410462..413713) [3252 bp, 1083 aa] {ON} Anc_2...    39   0.11 
NDAI0F02790 Chr6 (685315..688629) [3315 bp, 1104 aa] {ON} Anc_2....    39   0.11 
TPHA0G01360 Chr7 complement(271772..276250) [4479 bp, 1492 aa] {...    39   0.12 
TBLA0E04620 Chr5 (1178465..1183159) [4695 bp, 1564 aa] {ON} Anc_...    39   0.12 
TPHA0D03910 Chr4 (819917..821374) [1458 bp, 485 aa] {ON} Anc_6.3...    38   0.12 
Kpol_1002.14 s1002 (40319..41014) [696 bp, 231 aa] {ON} (40319.....    37   0.13 
Smik_14.107 Chr14 complement(202094..203842) [1749 bp, 582 aa] {...    38   0.13 
NDAI0G05680 Chr7 complement(1410181..1412061) [1881 bp, 626 aa] ...    38   0.13 
TBLA0B02370 Chr2 (552419..554335) [1917 bp, 638 aa] {ON} Anc_3.1...    38   0.13 
Skud_16.26 Chr16 complement(45266..47215) [1950 bp, 650 aa] {ON}...    38   0.14 
Kpol_489.8 s489 (26766..28883) [2118 bp, 705 aa] {ON} (26766..28...    38   0.14 
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       38   0.14 
KAFR0A02280 Chr1 complement(473811..476303) [2493 bp, 830 aa] {O...    38   0.14 
TDEL0E00510 Chr5 complement(114384..117194) [2811 bp, 936 aa] {O...    38   0.15 
TPHA0B03530 Chr2 (823638..826523) [2886 bp, 961 aa] {ON}               38   0.15 
YPR055W Chr16 (667676..670873) [3198 bp, 1065 aa] {ON}  SEC8Esse...    38   0.15 
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    38   0.15 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    38   0.15 
KAFR0H01060 Chr8 (192119..195664) [3546 bp, 1181 aa] {ON} Anc_3....    38   0.15 
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    38   0.15 
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...    38   0.15 
TBLA0I03420 Chr9 (824623..828363) [3741 bp, 1246 aa] {ON} Anc_3....    38   0.15 
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...    38   0.15 
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    38   0.16 
Kpol_1061.15 s1061 (41409..42257) [849 bp, 282 aa] {ON} (41409.....    37   0.16 
KLTH0D07568g Chr4 complement(655143..655811) [669 bp, 222 aa] {O...    37   0.16 
KLLA0D10439g Chr4 complement(879449..880906) [1458 bp, 485 aa] {...    38   0.16 
TPHA0A04300 Chr1 (967312..968208) [897 bp, 298 aa] {ON}                37   0.16 
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    38   0.18 
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...    38   0.18 
NCAS0B08400 Chr2 (1604783..1606876) [2094 bp, 697 aa] {ON} Anc_1...    38   0.18 
TPHA0I02320 Chr9 (512963..514018) [1056 bp, 351 aa] {ON} Anc_7.1...    37   0.18 
Smik_4.2 Chr4 complement(4408..6789) [2382 bp, 793 aa] {ON} YDL2...    38   0.19 
TPHA0J01440 Chr10 (334822..337212) [2391 bp, 796 aa] {ON} Anc_5....    38   0.19 
CAGL0K10318g Chr11 (1004753..1007506) [2754 bp, 917 aa] {ON} wea...    38   0.19 
KLLA0C06512g Chr3 (570575..571810) [1236 bp, 411 aa] {ON} simila...    37   0.20 
NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1....    38   0.20 
Ecym_8321 Chr8 complement(652652..653986) [1335 bp, 444 aa] {ON}...    37   0.21 
Ecym_3417 Chr3 complement(786420..787850) [1431 bp, 476 aa] {ON}...    37   0.21 
NCAS0G01370 Chr7 complement(244659..246122) [1464 bp, 487 aa] {O...    37   0.21 
KAFR0F00970 Chr6 complement(181476..183227) [1752 bp, 583 aa] {O...    37   0.23 
TBLA0F03440 Chr6 complement(849971..851734) [1764 bp, 587 aa] {O...    37   0.23 
CAGL0D03564g Chr4 complement(361241..362260) [1020 bp, 339 aa] {...    37   0.24 
TBLA0C03320 Chr3 complement(803654..805771) [2118 bp, 705 aa] {O...    37   0.24 
Smik_7.197 Chr7 (341623..343776) [2154 bp, 717 aa] {ON} YGL086W ...    37   0.24 
TPHA0P00280 Chr16 (56338..58731) [2394 bp, 797 aa] {ON} Anc_8.48...    37   0.24 
TBLA0D05000 Chr4 (1232161..1234590) [2430 bp, 809 aa] {ON} Anc_1...    37   0.25 
ZYRO0F01188g Chr6 (94085..96631) [2547 bp, 848 aa] {ON} similar ...    37   0.25 
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    37   0.25 
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    37   0.26 
Smik_10.150 Chr10 (249211..252732) [3522 bp, 1173 aa] {ON} YJL09...    37   0.26 
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    37   0.26 
Kwal_33.13526 s33 (264384..268280) [3897 bp, 1298 aa] {ON} YNL25...    37   0.26 
TBLA0C04920 Chr3 (1195902..1200074) [4173 bp, 1390 aa] {ON} Anc_...    37   0.27 
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...    37   0.27 
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...    37   0.27 
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...    37   0.27 
Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar ...    37   0.27 
TPHA0H02420 Chr8 (567257..573022) [5766 bp, 1921 aa] {ON} Anc_6....    37   0.27 
YDR299W Chr4 (1059627..1061231) [1605 bp, 534 aa] {ON}  BFR2Esse...    37   0.29 
Kwal_55.21515 s55 complement(868702..870405) [1704 bp, 567 aa] {...    37   0.30 
TDEL0E03150 Chr5 (592206..594128) [1923 bp, 640 aa] {ON} Anc_5.3...    37   0.31 
SAKL0G18414g Chr7 complement(1588834..1590873) [2040 bp, 679 aa]...    37   0.31 
TPHA0H02060 Chr8 (487254..489296) [2043 bp, 680 aa] {ON} Anc_6.2...    37   0.31 
TPHA0D01850 Chr4 complement(386116..388167) [2052 bp, 683 aa] {O...    37   0.31 
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    37   0.31 
NDAI0C03280 Chr3 complement(745118..747277) [2160 bp, 719 aa] {O...    37   0.31 
TPHA0J02580 Chr10 (572213..574462) [2250 bp, 749 aa] {ON} Anc_6....    37   0.32 
TDEL0H04300 Chr8 (739853..742180) [2328 bp, 775 aa] {ON} Anc_7.2...    37   0.32 
Smik_4.410 Chr4 complement(744262..747228) [2967 bp, 988 aa] {ON...    37   0.33 
KLLA0B12133g Chr2 (1058858..1061998) [3141 bp, 1046 aa] {ON} sim...    37   0.34 
KAFR0A08490 Chr1 complement(1700790..1704548) [3759 bp, 1252 aa]...    37   0.34 
TBLA0G01790 Chr7 complement(464679..468977) [4299 bp, 1432 aa] {...    37   0.35 
NCAS0B02730 Chr2 complement(459931..464904) [4974 bp, 1657 aa] {...    37   0.35 
Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON} (14919....    37   0.35 
CAGL0B00924g Chr2 complement(81492..82808) [1317 bp, 438 aa] {ON...    37   0.36 
TBLA0A01670 Chr1 complement(396377..401803) [5427 bp, 1808 aa] {...    37   0.36 
SAKL0H07524g Chr8 (653641..654999) [1359 bp, 452 aa] {ON} simila...    37   0.36 
KNAG0K00940 Chr11 complement(184711..186111) [1401 bp, 466 aa] {...    37   0.36 
TBLA0E04090 Chr5 complement(1029923..1031368) [1446 bp, 481 aa] ...    37   0.37 
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    37   0.37 
Skud_4.60 Chr4 complement(102282..103841) [1560 bp, 519 aa] {ON}...    37   0.38 
Skud_8.98 Chr8 complement(167764..168102) [339 bp, 113 aa] {ON} ...    34   0.39 
Suva_4.179 Chr4 (320539..322200,322254..322490) [1899 bp, 632 aa...    37   0.40 
TBLA0C04610 Chr3 complement(1116152..1118056) [1905 bp, 634 aa] ...    37   0.40 
TBLA0A06330 Chr1 complement(1555490..1557406) [1917 bp, 638 aa] ...    37   0.40 
Kpol_1065.2 s1065 complement(2038..3972) [1935 bp, 644 aa] {ON} ...    37   0.40 
NDAI0G05070 Chr7 (1231923..1232627) [705 bp, 234 aa] {ON} Anc_8....    36   0.40 
NDAI0D04300 Chr4 complement(1008897..1011128) [2232 bp, 743 aa] ...    37   0.42 
TPHA0B01780 Chr2 (395221..396279) [1059 bp, 352 aa] {ON} Anc_4.3...    36   0.42 
TPHA0H02980 Chr8 (712882..715305) [2424 bp, 807 aa] {ON} Anc_7.2...    37   0.42 
Kpol_1045.30 s1045 (68925..71675) [2751 bp, 916 aa] {ON} (68927....    37   0.43 
YLL016W Chr12 (112847..115993) [3147 bp, 1048 aa] {OFF}  SDC25No...    37   0.44 
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    37   0.45 
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    37   0.45 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    37   0.45 
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    37   0.45 
AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic...    37   0.45 
TBLA0A03310 Chr1 (787743..792512) [4770 bp, 1589 aa] {ON} Anc_5....    37   0.46 
TBLA0C05170 Chr3 complement(1250142..1255004) [4863 bp, 1620 aa]...    37   0.46 
Smik_13.427 Chr13 (691248..696173) [4926 bp, 1641 aa] {ON} YMR21...    37   0.46 
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...    37   0.46 
TBLA0H02840 Chr8 (664282..665604) [1323 bp, 440 aa] {ON}               36   0.47 
CAGL0K10384g Chr11 complement(1011380..1017694) [6315 bp, 2104 a...    37   0.47 
TPHA0I02610 Chr9 complement(573932..575278) [1347 bp, 448 aa] {O...    36   0.47 
TDEL0F04560 Chr6 (855489..862637) [7149 bp, 2382 aa] {ON} Anc_8....    37   0.48 
NCAS0B06280 Chr2 complement(1185096..1186547) [1452 bp, 483 aa] ...    36   0.49 
CAGL0M12903g Chr13 complement(1274920..1275807) [888 bp, 295 aa]...    36   0.50 
NDAI0F03790 Chr6 (900580..902166) [1587 bp, 528 aa] {ON}               36   0.50 
Skud_11.249 Chr11 (450052..451668) [1617 bp, 538 aa] {ON} YKR016...    36   0.50 
Suva_11.248 Chr11 (453665..455284) [1620 bp, 539 aa] {ON} YKR016...    36   0.50 
YGL228W Chr7 (67598..69331) [1734 bp, 577 aa] {ON}  SHE10Putativ...    36   0.51 
Kpol_274.3 s274 (2546..4291) [1746 bp, 581 aa] {ON} (2546..4291)...    36   0.51 
Kpol_274.4 s274 (5051..6838) [1788 bp, 595 aa] {ON} (5051..6838)...    36   0.52 
SAKL0H16720g Chr8 (1472129..1472144,1472210..1472880) [687 bp, 2...    35   0.52 
NCAS0E00380 Chr5 (63083..64957) [1875 bp, 624 aa] {ON} Anc_3.546...    36   0.52 
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    36   0.53 
Kpol_1071.4 s1071 (9071..9763) [693 bp, 230 aa] {ON} (9071..9763...    35   0.53 
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    36   0.53 
Ecym_3250 Chr3 complement(473064..475115) [2052 bp, 683 aa] {ON}...    36   0.54 
KAFR0D02270 Chr4 (459308..461437) [2130 bp, 709 aa] {ON} Anc_5.6...    36   0.54 
TPHA0L00650 Chr12 complement(116502..118703) [2202 bp, 733 aa] {...    36   0.54 
KAFR0C02470 Chr3 complement(479994..482387) [2394 bp, 797 aa] {O...    36   0.55 
TBLA0D03450 Chr4 complement(854472..856931) [2460 bp, 819 aa] {O...    36   0.56 
CAGL0L12452g Chr12 complement(1344233..1346914) [2682 bp, 893 aa...    36   0.56 
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    36   0.57 
Kpol_1067.28 s1067 (63984..67145) [3162 bp, 1053 aa] {ON} (63984...    36   0.58 
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    36   0.59 
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...    36   0.59 
TPHA0D02460 Chr4 (507413..508633) [1221 bp, 406 aa] {ON} Anc_5.5...    36   0.60 
TBLA0B09660 Chr2 (2292300..2297510) [5211 bp, 1736 aa] {ON} Anc_...    36   0.61 
ZYRO0D11506g Chr4 (968503..969858) [1356 bp, 451 aa] {ON} simila...    36   0.62 
Kpol_298.1 s298 (667..2073) [1407 bp, 468 aa] {ON} (667..2073) [...    36   0.63 
TPHA0A03000 Chr1 (649118..661423) [12306 bp, 4101 aa] {ON} Anc_1...    36   0.64 
ZYRO0F10978g Chr6 complement(895804..897255) [1452 bp, 483 aa] {...    36   0.64 
TBLA0A05120 Chr1 (1257807..1259270) [1464 bp, 487 aa] {ON} Anc_1...    36   0.64 
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    36   0.65 
CAGL0I04092g Chr9 (358219..359889) [1671 bp, 556 aa] {ON} weakly...    36   0.67 
TBLA0H01070 Chr8 (238649..240349) [1701 bp, 566 aa] {ON} Anc_8.3...    36   0.67 
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    36   0.68 
SAKL0F15994g Chr6 complement(1293064..1294998) [1935 bp, 644 aa]...    36   0.69 
TBLA0B04890 Chr2 complement(1152059..1154065) [2007 bp, 668 aa] ...    36   0.70 
NCAS0J00620 Chr10 complement(93216..95240) [2025 bp, 674 aa] {ON...    36   0.70 
NDAI0C03710 Chr3 complement(847460..848455,848555..848557) [999 ...    35   0.71 
YMR167W Chr13 (594886..597195) [2310 bp, 769 aa] {ON}  MLH1Prote...    36   0.72 
NCAS0A02440 Chr1 complement(460788..463250) [2463 bp, 820 aa] {O...    36   0.73 
Skud_13.186 Chr13 complement(318929..321460) [2532 bp, 843 aa] {...    36   0.73 
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     36   0.74 
TDEL0C02150 Chr3 (370261..372897) [2637 bp, 878 aa] {ON} Anc_7.3...    36   0.74 
NCAS0E02200 Chr5 (423754..426438) [2685 bp, 894 aa] {ON} Anc_7.3...    36   0.74 
Kpol_1029.20 s1029 complement(39953..42688) [2736 bp, 911 aa] {O...    36   0.74 
NDAI0I01280 Chr9 complement(307589..310537) [2949 bp, 982 aa] {O...    36   0.75 
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    36   0.76 
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...    36   0.77 
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    36   0.77 
YJL080C Chr10 complement(285558..289226) [3669 bp, 1222 aa] {ON}...    36   0.77 
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....    36   0.77 
TBLA0D02460 Chr4 (609615..613799) [4185 bp, 1394 aa] {ON} Anc_8....    36   0.78 
TBLA0J01220 Chr10 (277965..283214) [5250 bp, 1749 aa] {ON} Anc_1...    36   0.80 
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...    36   0.80 
TBLA0B04530 Chr2 (1042985..1050010) [7026 bp, 2341 aa] {ON} Anc_...    36   0.81 
SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 a...    36   0.83 
Suva_10.333 Chr10 (581322..582761) [1440 bp, 479 aa] {ON} YLR238...    35   0.84 
TBLA0I01870 Chr9 complement(419817..421310) [1494 bp, 497 aa] {O...    35   0.85 
Kpol_2001.15 s2001 complement(41752..43254) [1503 bp, 500 aa] {O...    35   0.85 
CAGL0I05258g Chr9 (498808..500331) [1524 bp, 507 aa] {ON} simila...    35   0.85 
Skud_11.213 Chr11 complement(388301..388825) [525 bp, 174 aa] {O...    34   0.87 
TBLA0I02990 Chr9 (710633..712255) [1623 bp, 540 aa] {ON} Anc_4.2...    35   0.87 
YGL095C Chr7 complement(328874..330607) [1734 bp, 577 aa] {ON}  ...    35   0.89 
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...    35   0.89 
TPHA0D00910 Chr4 (180414..182294) [1881 bp, 626 aa] {ON} Anc_8.1...    35   0.91 
NCAS0B08730 Chr2 (1682303..1682992) [690 bp, 229 aa] {ON} Anc_1....    35   0.93 
TPHA0N00500 Chr14 complement(96352..97044) [693 bp, 230 aa] {ON}...    35   0.93 
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...    35   0.94 
TBLA0D03470 Chr4 (863767..866046) [2280 bp, 759 aa] {ON} Anc_6.1...    35   0.94 
TBLA0D00920 Chr4 complement(237094..239409) [2316 bp, 771 aa] {O...    35   0.95 
KAFR0F01520 Chr6 (298731..301094) [2364 bp, 787 aa] {ON} Anc_1.1...    35   0.95 
TBLA0A00970 Chr1 complement(216127..216831) [705 bp, 234 aa] {ON...    35   0.95 
TPHA0J01460 Chr10 (339107..340132) [1026 bp, 341 aa] {ON} Anc_5....    35   0.95 
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...    35   0.96 
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    35   0.96 
TPHA0L01290 Chr12 (271693..274362) [2670 bp, 889 aa] {ON} Anc_8....    35   0.97 
YBR079C Chr2 complement(395383..398277) [2895 bp, 964 aa] {ON}  ...    35   0.98 
Skud_16.341 Chr16 (632523..635729) [3207 bp, 1068 aa] {ON} YPR05...    35   1.00 
ZYRO0C15686g Chr3 complement(1228374..1231691) [3318 bp, 1105 aa...    35   1.0  
TPHA0I01890 Chr9 (423724..427086) [3363 bp, 1120 aa] {ON} Anc_8....    35   1.0  
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...    35   1.0  
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    35   1.0  
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    35   1.0  
KLLA0F12452g Chr6 complement(1152209..1156510) [4302 bp, 1433 aa...    35   1.0  
Kpol_423.4 s423 complement(5205..6128,6130..6216,6218..6445) [12...    35   1.0  
TPHA0B01870 Chr2 (417669..418922) [1254 bp, 417 aa] {ON} Anc_4.3...    35   1.0  
Suva_10.461 Chr10 (805763..807067) [1305 bp, 434 aa] {ON} YLR360...    35   1.1  
NDAI0B01600 Chr2 complement(382282..383592) [1311 bp, 436 aa] {O...    35   1.1  
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    34   1.1  
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...    35   1.1  
Skud_12.313 Chr12 (559031..560467) [1437 bp, 478 aa] {ON} YLR238...    35   1.1  
TPHA0C02110 Chr3 (477769..479232) [1464 bp, 487 aa] {ON} Anc_8.4...    35   1.1  
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    35   1.1  
CAGL0I07271g Chr9 complement(701045..702652) [1608 bp, 535 aa] {...    35   1.1  
YKR016W Chr11 (469717..471339) [1623 bp, 540 aa] {ON}  FCJ1Mitoc...    35   1.1  
Kpol_228.1 s228 (611..2293) [1683 bp, 560 aa] {ON} (611..2293) [...    35   1.2  
Suva_13.316 Chr13 (519713..520254,520783..521103,521223..522051)...    35   1.2  
NDAI0B05540 Chr2 (1355086..1356843) [1758 bp, 585 aa] {ON} Anc_5...    35   1.2  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    35   1.2  
KLLA0B10329g Chr2 (902691..904532) [1842 bp, 613 aa] {ON} weakly...    35   1.2  
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    35   1.2  
Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] ...    35   1.2  
KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {O...    35   1.2  
Smik_4.162 Chr4 complement(300502..302598) [2097 bp, 698 aa] {ON...    35   1.2  
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    35   1.3  
TBLA0A07110 Chr1 complement(1756627..1759200) [2574 bp, 857 aa] ...    35   1.3  
Kpol_1024.15 s1024 (57277..58317) [1041 bp, 346 aa] {ON} (57277....    35   1.3  
KAFR0F01890 Chr6 complement(372764..373837) [1074 bp, 357 aa] {O...    35   1.3  
CAGL0E00957g Chr5 (86682..89627) [2946 bp, 981 aa] {ON} similar ...    35   1.3  
TPHA0D02430 Chr4 complement(499608..502574) [2967 bp, 988 aa] {O...    35   1.3  
KLLA0E21451g Chr5 (1914249..1917266) [3018 bp, 1005 aa] {ON} sim...    35   1.3  
KAFR0B02340 Chr2 complement(456758..457867) [1110 bp, 369 aa] {O...    35   1.3  
CAGL0J06556g Chr10 (630978..634214) [3237 bp, 1078 aa] {ON} weak...    35   1.3  
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    35   1.3  
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    35   1.3  
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    35   1.3  
KAFR0B03285 Chr2 (683307..687806) [4500 bp, 1499 aa] {ON}              35   1.4  
Kpol_414.1 s414 (1989..6635) [4647 bp, 1548 aa] {ON} (1989..6635...    35   1.4  
NCAS0J01590 Chr10 (286539..287759) [1221 bp, 406 aa] {ON} Anc_4....    35   1.4  
ZYRO0G07832g Chr7 (628580..634129) [5550 bp, 1849 aa] {ON} simil...    35   1.4  
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...    35   1.4  
Suva_12.45 Chr12 (61680..62951) [1272 bp, 423 aa] {ON} YJL036W (...    35   1.4  
KLLA0B10582g Chr2 (924069..931958) [7890 bp, 2629 aa] {ON} simil...    35   1.4  
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    35   1.4  
KLTH0D10274g Chr4 complement(849747..851162) [1416 bp, 471 aa] {...    35   1.4  
KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa] ...    34   1.5  
YGL005C Chr7 complement(489708..490547) [840 bp, 279 aa] {ON}  C...    34   1.5  
SAKL0D05896g Chr4 complement(481745..483304) [1560 bp, 519 aa] {...    35   1.5  
YMR014W Chr13 (298868..300427) [1560 bp, 519 aa] {ON}  BUD22Prot...    35   1.5  
TBLA0J01720 Chr10 complement(380082..381659) [1578 bp, 525 aa] {...    35   1.5  
TBLA0B04595 Chr2 (1066340..1067950) [1611 bp, 536 aa] {ON}             35   1.5  
KAFR0E01370 Chr5 (272717..274522) [1806 bp, 601 aa] {ON} Anc_5.3...    35   1.5  
TPHA0O00230 Chr15 (30550..32424) [1875 bp, 624 aa] {ON} Anc_1.51...    35   1.6  
KLLA0F13002g Chr6 complement(1197689..1199593) [1905 bp, 634 aa]...    35   1.6  
CAGL0K04873g Chr11 complement(471872..473896) [2025 bp, 674 aa] ...    35   1.6  
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    35   1.6  
TPHA0G02330 Chr7 (471826..473943) [2118 bp, 705 aa] {ON} Anc_2.4...    35   1.6  
KLLA0F08305g Chr6 (773720..774685) [966 bp, 321 aa] {ON} similar...    34   1.6  
NDAI0I02420 Chr9 complement(550464..552689) [2226 bp, 741 aa] {O...    35   1.6  
Kpol_192.1 s192 complement(1..2325) [2325 bp, 775 aa] {ON} compl...    35   1.6  
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    35   1.7  
KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {O...    35   1.7  
TBLA0E00290 Chr5 (51098..53737) [2640 bp, 879 aa] {ON} Anc_3.554...    35   1.7  
SAKL0H14762g Chr8 (1280740..1283439) [2700 bp, 899 aa] {ON} simi...    35   1.7  
NDAI0B01390 Chr2 (321257..324073) [2817 bp, 938 aa] {ON} Anc_2.590     35   1.7  
Skud_4.424 Chr4 complement(755616..758534) [2919 bp, 972 aa] {ON...    35   1.7  
Kpol_2000.75 s2000 complement(165198..165908) [711 bp, 236 aa] {...    34   1.7  
Kpol_479.4 s479 (6018..8993) [2976 bp, 991 aa] {ON} (6018..8993)...    35   1.7  
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    35   1.7  
TBLA0D01950 Chr4 (484101..487634) [3534 bp, 1177 aa] {ON}              35   1.7  
KLTH0D15752g Chr4 (1294994..1298956) [3963 bp, 1320 aa] {ON} sim...    35   1.8  
TPHA0K00980 Chr11 complement(203232..207518) [4287 bp, 1428 aa] ...    35   1.8  
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    35   1.8  
NDAI0A08650 Chr1 (1993764..1998506) [4743 bp, 1580 aa] {ON} Anc_...    35   1.8  
ZYRO0D06358g Chr4 complement(539347..540546) [1200 bp, 399 aa] {...    34   1.8  
CAGL0M01518g Chr13 complement(174378..175595) [1218 bp, 405 aa] ...    34   1.8  
Kpol_1055.35 s1055 complement(85381..91668) [6288 bp, 2095 aa] {...    35   1.8  
KLTH0G12144g Chr7 complement(1020201..1030949) [10749 bp, 3582 a...    35   1.9  
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     34   2.0  
Smik_11.273 Chr11 (457103..458722) [1620 bp, 539 aa] {ON} YKR016...    34   2.0  
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...    34   2.0  
NCAS0A13330 Chr1 complement(2623468..2625228) [1761 bp, 586 aa] ...    34   2.0  
NCAS0A12210 Chr1 (2420135..2421028) [894 bp, 297 aa] {ON} Anc_1....    34   2.0  
Suva_15.75 Chr15 (118591..120414) [1824 bp, 607 aa] {ON} YOL091W...    34   2.0  
ZYRO0B08536g Chr2 complement(664054..666126) [2073 bp, 690 aa] {...    34   2.1  
YKL016C Chr11 complement(407465..407989) [525 bp, 174 aa] {ON}  ...    33   2.1  
TBLA0B05740 Chr2 (1356539..1358689) [2151 bp, 716 aa] {ON} Anc_5...    34   2.1  
Kpol_1054.20 s1054 (47968..50184) [2217 bp, 738 aa] {ON} (47968....    34   2.1  
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    34   2.1  
NDAI0E02810 Chr5 (595594..597864) [2271 bp, 756 aa] {ON} Anc_8.542     34   2.1  
CAGL0M02893g Chr13 (326338..328779) [2442 bp, 813 aa] {ON} simil...    34   2.2  
Kpol_1062.48 s1062 (101524..103968) [2445 bp, 814 aa] {ON} (1015...    34   2.2  
NCAS0I03010 Chr9 complement(552260..554812) [2553 bp, 850 aa] {O...    34   2.2  
NDAI0C03980 Chr3 complement(901982..904702) [2721 bp, 906 aa] {O...    34   2.2  
NDAI0D03650 Chr4 (866072..869002) [2931 bp, 976 aa] {ON} Anc_4.9...    34   2.2  
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    34   2.2  
CAGL0I05412g Chr9 (512839..515919) [3081 bp, 1026 aa] {ON} simil...    34   2.2  
TBLA0I03360 Chr9 (812803..815988) [3186 bp, 1061 aa] {ON} Anc_3....    34   2.2  
Kwal_27.12530 s27 complement(1261137..1264400) [3264 bp, 1087 aa...    34   2.3  
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    34   2.3  
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    34   2.3  
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    34   2.3  
TPHA0F02780 Chr6 (617242..621093) [3852 bp, 1283 aa] {ON} Anc_6....    34   2.3  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    34   2.3  
Kpol_2000.34 s2000 complement(63284..67201) [3918 bp, 1305 aa] {...    34   2.3  
Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250...    34   2.3  
TPHA0I02100 Chr9 complement(464168..468394) [4227 bp, 1408 aa] {...    34   2.3  
Kwal_14.1970 s14 (555700..556857) [1158 bp, 385 aa] {ON} YER149C...    34   2.3  
Smik_5.278 Chr5 complement(434036..439219) [5184 bp, 1727 aa] {O...    34   2.4  
Smik_11.163 Chr11 complement(279164..280516) [1353 bp, 450 aa] {...    34   2.5  
NDAI0G04510 Chr7 (1079325..1080725) [1401 bp, 466 aa] {ON} Anc_2...    34   2.5  
NCAS0E04150 Chr5 complement(816663..817481) [819 bp, 272 aa] {ON...    33   2.5  
TPHA0N00810 Chr14 complement(179351..180937) [1587 bp, 528 aa] {...    34   2.6  
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    34   2.6  
TPHA0A05190 Chr1 complement(1167058..1167912) [855 bp, 284 aa] {...    33   2.6  
Kwal_23.3081 s23 (148637..150271) [1635 bp, 544 aa] {ON} YIL136W...    34   2.6  
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    34   2.6  
TBLA0B02090 Chr2 (481247..483112) [1866 bp, 621 aa] {ON} Anc_1.4...    34   2.7  
NCAS0C01410 Chr3 complement(258350..259258) [909 bp, 302 aa] {ON}      33   2.7  
Suva_8.324 Chr8 complement(578609..580591) [1983 bp, 660 aa] {ON...    34   2.7  
Smik_13.397 Chr13 (631479..633656) [2178 bp, 725 aa] {ON} YMR192...    34   2.8  
Smik_11.239 Chr11 complement(394398..394922) [525 bp, 174 aa] {O...    33   2.8  
TBLA0A05620 Chr1 complement(1394838..1397228) [2391 bp, 796 aa] ...    34   2.8  
YHR156C Chr8 complement(411384..412406) [1023 bp, 340 aa] {ON}  ...    33   2.9  
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    33   2.9  
Kwal_27.10756 s27 (483546..486314) [2769 bp, 922 aa] {ON} YER111...    34   2.9  
Kpol_1002.17 s1002 complement(45456..48299) [2844 bp, 947 aa] {O...    34   2.9  
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...    34   2.9  
Kpol_298.2 s298 complement(2201..5314) [3114 bp, 1037 aa] {ON} c...    34   2.9  
ADL307W Chr4 (155322..158540) [3219 bp, 1072 aa] {ON} Syntenic h...    34   2.9  
Kpol_1037.10 s1037 complement(21480..22553) [1074 bp, 357 aa] {O...    33   3.0  
CAGL0L06622g Chr12 complement(745599..749012) [3414 bp, 1137 aa]...    34   3.0  
Smik_8.174 Chr8 complement(273775..274744,274864..274988) [1095 ...    33   3.0  
KAFR0C03390 Chr3 (690243..690953) [711 bp, 236 aa] {ON} Anc_8.53...    33   3.0  
TBLA0H00440 Chr8 (83907..87962) [4056 bp, 1351 aa] {ON} Anc_8.46...    34   3.0  
NCAS0C01010 Chr3 complement(183823..188271) [4449 bp, 1482 aa] {...    34   3.0  
TBLA0D01930 Chr4 complement(469678..474135) [4458 bp, 1485 aa] {...    34   3.0  
TDEL0B07300 Chr2 (1285590..1286828) [1239 bp, 412 aa] {ON} Anc_2...    33   3.1  
YLR454W Chr12 (1043998..1051884) [7887 bp, 2628 aa] {ON}  FMP27P...    34   3.2  
KLTH0F11396g Chr6 (967691..968962) [1272 bp, 423 aa] {ON} some s...    33   3.2  
NCAS0A11970 Chr1 (2373050..2374366) [1317 bp, 438 aa] {ON} Anc_5...    33   3.2  
Skud_3.33 Chr3 complement(56442..57770) [1329 bp, 442 aa] {ON} Y...    33   3.2  
TPHA0F03150 Chr6 complement(689259..690071) [813 bp, 270 aa] {ON...    33   3.3  
TBLA0H02620 Chr8 complement(619758..621266) [1509 bp, 502 aa] {O...    33   3.3  
Smik_8.108 Chr8 complement(166728..167066) [339 bp, 113 aa] {ON}...    32   3.4  
Smik_2.306 Chr2 (555052..555885) [834 bp, 277 aa] {ON} YBR165W (...    33   3.4  
Ecym_2576 Chr2 complement(1125210..1126919) [1710 bp, 569 aa] {O...    33   3.5  
Kpol_1011.2 s1011 complement(2303..4057) [1755 bp, 584 aa] {ON} ...    33   3.5  
TBLA0I03410 Chr9 complement(821181..822974) [1794 bp, 597 aa] {O...    33   3.5  
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    33   3.6  
CAGL0G06688g Chr7 complement(640320..642332) [2013 bp, 670 aa] {...    33   3.6  
TPHA0L00910 Chr12 (184324..186357) [2034 bp, 677 aa] {ON} Anc_8....    33   3.6  
NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852 ...    33   3.7  
Smik_16.43 Chr16 (75638..77893) [2256 bp, 751 aa] {ON} YGR264C (...    33   3.7  
TPHA0F02270 Chr6 complement(495236..496192) [957 bp, 318 aa] {ON...    33   3.7  
YLR319C Chr12 complement(769318..771684) [2367 bp, 788 aa] {ON} ...    33   3.7  
SAKL0A08184g Chr1 (725533..727902) [2370 bp, 789 aa] {ON} weakly...    33   3.7  
TDEL0A04100 Chr1 complement(730582..731568) [987 bp, 328 aa] {ON...    33   3.7  
SAKL0B00770g Chr2 complement(67494..70085) [2592 bp, 863 aa] {ON...    33   3.8  
ZYRO0B00484g Chr2 complement(28527..31286) [2760 bp, 919 aa] {ON...    33   3.8  
NCAS0A09840 Chr1 complement(1965276..1968074) [2799 bp, 932 aa] ...    33   3.8  
KAFR0B04670 Chr2 (972408..973442) [1035 bp, 344 aa] {ON} Anc_2.3...    33   3.8  
NDAI0K01780 Chr11 (397438..398121) [684 bp, 227 aa] {ON} Anc_2.5...    33   3.8  
Smik_4.121 Chr4 complement(230683..231405,231406..231663,231734....    33   3.9  
TPHA0G02180 Chr7 complement(448303..448347,448420..449430) [1056...    33   3.9  
ZYRO0F13332g Chr6 (1096774..1099980) [3207 bp, 1068 aa] {ON} sim...    33   3.9  
Smik_16.297 Chr16 (544357..547563) [3207 bp, 1068 aa] {ON} YPR05...    33   3.9  
YDL115C Chr4 complement(253995..254974,255045..255126) [1062 bp,...    33   3.9  
Suva_2.529 Chr2 complement(946024..946392) [369 bp, 122 aa] {ON}...    32   3.9  
Suva_4.134 Chr4 (247333..251643) [4311 bp, 1436 aa] {ON} YDL112W...    33   4.0  
NDAI0A00530 Chr1 complement(94089..94802) [714 bp, 237 aa] {ON} ...    33   4.0  
KAFR0F00630 Chr6 complement(124513..125226) [714 bp, 237 aa] {ON...    33   4.0  
Smik_13.393 Chr13 complement(620696..621409) [714 bp, 237 aa] {O...    33   4.0  
NDAI0H02590 Chr8 (635376..639824) [4449 bp, 1482 aa] {ON}              33   4.0  
Kpol_1075.5 s1075 complement(13967..20494) [6528 bp, 2175 aa] {O...    33   4.1  
Smik_8.159 Chr8 (244291..244854) [564 bp, 187 aa] {ON} YHR081W (...    32   4.2  
Smik_3.48 Chr3 complement(70262..71590) [1329 bp, 442 aa] {ON} Y...    33   4.2  
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...    33   4.2  
NDAI0A04970 Chr1 (1131663..1133069) [1407 bp, 468 aa] {ON} Anc_3...    33   4.3  
NCAS0B08810 Chr2 (1692462..1693919) [1458 bp, 485 aa] {ON} Anc_1...    33   4.4  
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    33   4.4  
Skud_11.205 Chr11 (374630..375448) [819 bp, 272 aa] {ON} YKL023W...    33   4.4  
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...    33   4.4  
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    33   4.5  
NDAI0I00860 Chr9 complement(197860..199491) [1632 bp, 543 aa] {O...    33   4.5  
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    33   4.5  
TDEL0G00350 Chr7 (69338..70180) [843 bp, 280 aa] {ON} Anc_5.12 Y...    33   4.5  
Suva_15.227 Chr15 complement(394489..394827) [339 bp, 113 aa] {O...    31   4.6  
Suva_16.342 Chr16 (599111..600922) [1812 bp, 603 aa] {ON} YPR018...    33   4.6  
TBLA0A03640 Chr1 (909142..910971) [1830 bp, 609 aa] {ON} Anc_5.4...    33   4.6  
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    33   4.7  
KLLA0E13003g Chr5 (1151967..1153988) [2022 bp, 673 aa] {ON} simi...    33   4.7  
TBLA0J01560 Chr10 (349382..351526) [2145 bp, 714 aa] {ON} Anc_7....    33   4.8  
NDAI0C01830 Chr3 complement(400269..402434) [2166 bp, 721 aa] {O...    33   4.8  
Suva_8.125 Chr8 complement(226677..228902) [2226 bp, 741 aa] {ON...    33   4.8  
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    33   4.9  
KAFR0A08120 Chr1 complement(1634616..1636997) [2382 bp, 793 aa] ...    33   4.9  
Smik_14.287 Chr14 complement(523278..525800) [2523 bp, 840 aa] {...    33   4.9  
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    33   4.9  
Suva_2.110 Chr2 complement(193029..195728) [2700 bp, 899 aa] {ON...    33   5.0  
NDAI0A03300 Chr1 (747732..750479) [2748 bp, 915 aa] {ON}               33   5.0  
Smik_6.170 Chr6 (280902..283706) [2805 bp, 934 aa] {ON} YGR089W ...    33   5.0  
Skud_2.203 Chr2 complement(363149..366031) [2883 bp, 960 aa] {ON...    33   5.0  
Smik_2.212 Chr2 complement(377076..379970) [2895 bp, 964 aa] {ON...    33   5.0  
KLLA0E10077g Chr5 (891885..892901) [1017 bp, 338 aa] {ON} weakly...    33   5.0  
Skud_6.84 Chr6 (157156..157827) [672 bp, 223 aa] {ON} YFR008W (R...    32   5.0  
CAGL0L01837g Chr12 (213115..213789) [675 bp, 224 aa] {ON} highly...    32   5.0  
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    33   5.0  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...    33   5.1  
KLLA0D09042g Chr4 (760795..761832) [1038 bp, 345 aa] {ON} some s...    33   5.1  
TDEL0B06460 Chr2 complement(1142191..1142868) [678 bp, 225 aa] {...    32   5.1  
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    33   5.1  
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    33   5.1  
NCAS0A06010 Chr1 complement(1187345..1190737) [3393 bp, 1130 aa]...    33   5.1  
Ecym_7018 Chr7 (35174..36235) [1062 bp, 353 aa] {ON} similar to ...    33   5.1  
NDAI0H03540 Chr8 (865090..865617) [528 bp, 175 aa] {ON} Anc_1.37...    32   5.1  
KAFR0E01390 Chr5 (277260..280913) [3654 bp, 1217 aa] {ON} Anc_5....    33   5.1  
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    33   5.2  
TPHA0D01820 Chr4 complement(376666..380529) [3864 bp, 1287 aa] {...    33   5.2  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....    33   5.2  
ZYRO0F18172g Chr6 (1502682..1503794) [1113 bp, 370 aa] {ON} weak...    33   5.2  
TBLA0B00140 Chr2 (17297..18001) [705 bp, 234 aa] {ON}                  32   5.2  
Kpol_1010.72 s1010 (178801..179937) [1137 bp, 378 aa] {ON} (1788...    33   5.3  
Skud_15.358 Chr15 (643401..648257) [4857 bp, 1618 aa] {ON} YOR19...    33   5.3  
Smik_9.33 Chr9 (71291..72472) [1182 bp, 393 aa] {ON} YIL136W (REAL)    33   5.3  
CAGL0J04686g Chr10 complement(446347..447576) [1230 bp, 409 aa] ...    33   5.4  
KAFR0C00560 Chr3 (110562..111944) [1383 bp, 460 aa] {ON} Anc_3.2...    33   5.6  
Suva_16.136 Chr16 complement(230590..232062) [1473 bp, 490 aa] {...    33   5.8  
Kpol_520.42 s520 (101479..102954) [1476 bp, 491 aa] {ON} (101479...    33   5.8  
TPHA0C01360 Chr3 (309327..310937) [1611 bp, 536 aa] {ON} Anc_7.2...    33   5.9  
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    33   5.9  
TPHA0H00790 Chr8 (162043..163785) [1743 bp, 580 aa] {ON} Anc_3.1...    33   6.0  
CAGL0K02453g Chr11 complement(223090..224844) [1755 bp, 584 aa] ...    33   6.0  
TPHA0L01930 Chr12 (405472..407280) [1809 bp, 602 aa] {ON} Anc_2....    33   6.1  
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    33   6.1  
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    33   6.2  
KAFR0A05740 Chr1 (1163369..1165411) [2043 bp, 680 aa] {ON} Anc_4...    33   6.2  
KLLA0C18359g Chr3 (1622747..1624840) [2094 bp, 697 aa] {ON} simi...    33   6.2  
NCAS0G00280 Chr7 (47258..49393) [2136 bp, 711 aa] {ON} Anc_5.696...    33   6.3  
TBLA0I01660 Chr9 complement(367039..369207) [2169 bp, 722 aa] {O...    33   6.3  
TDEL0G04080 Chr7 complement(743675..744285,744344..744377) [645 ...    32   6.4  
Ecym_2309 Chr2 (599775..602249) [2475 bp, 824 aa] {ON} similar t...    33   6.4  
TBLA0G00460 Chr7 (92898..95387) [2490 bp, 829 aa] {ON} Anc_6.52 ...    33   6.4  
TDEL0E04620 Chr5 complement(865883..866386) [504 bp, 167 aa] {ON...    32   6.4  
Kwal_23.3786 s23 complement(434953..435921) [969 bp, 322 aa] {ON...    32   6.5  
TBLA0G03050 Chr7 complement(805292..807865) [2574 bp, 857 aa] {O...    33   6.5  
KAFR0D02860 Chr4 (570412..571395) [984 bp, 327 aa] {ON} Anc_2.42...    32   6.5  
KNAG0J00190 Chr10 complement(21137..23836) [2700 bp, 899 aa] {ON...    33   6.5  
TBLA0B08490 Chr2 complement(2030030..2032744) [2715 bp, 904 aa] ...    33   6.5  
CAGL0G02959g Chr7 (272520..275276) [2757 bp, 918 aa] {ON} simila...    33   6.5  
Skud_7.385 Chr7 (642159..644966) [2808 bp, 935 aa] {ON} YGR089W ...    33   6.5  
KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa] ...    32   6.6  
Suva_5.232 Chr5 complement(356932..358038,358606..360747) [3249 ...    33   6.7  
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    33   6.7  
TBLA0B04140 Chr2 complement(946856..950221) [3366 bp, 1121 aa] {...    33   6.7  
Suva_7.113 Chr7 (213621..217007) [3387 bp, 1128 aa] {ON} YGL151W...    33   6.7  
TPHA0K01540 Chr11 complement(320704..324177) [3474 bp, 1157 aa] ...    33   6.7  
YAL001C Chr1 complement(147594..151006,151097..151166) [3483 bp,...    33   6.7  
KLLA0C02717g Chr3 complement(242948..246508) [3561 bp, 1186 aa] ...    33   6.7  
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....    33   6.7  
Suva_15.354 Chr15 (611006..614695) [3690 bp, 1229 aa] {ON} YHR15...    33   6.7  
KAFR0C03560 Chr3 complement(727092..730946) [3855 bp, 1284 aa] {...    33   6.8  
KLLA0A09867g Chr1 (864111..865193) [1083 bp, 360 aa] {ON} simila...    32   6.8  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....    33   6.8  
KAFR0I00410 Chr9 complement(86806..87918) [1113 bp, 370 aa] {ON}...    32   6.9  
NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3....    33   6.9  
TBLA0E04520 Chr5 complement(1149865..1151130) [1266 bp, 421 aa] ...    32   7.2  
Smik_4.502 Chr4 complement(911449..912714) [1266 bp, 421 aa] {ON...    32   7.2  
Ecym_2412 Chr2 complement(801242..802564) [1323 bp, 440 aa] {ON}...    32   7.3  
Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON...    32   7.5  
TPHA0L00620 Chr12 complement(108463..109866) [1404 bp, 467 aa] {...    32   7.5  
Suva_10.350 Chr10 complement(611601..612167) [567 bp, 188 aa] {O...    32   7.5  
KAFR0H02830 Chr8 complement(539280..540695) [1416 bp, 471 aa] {O...    32   7.5  
TBLA0H00800 Chr8 (179344..180789) [1446 bp, 481 aa] {ON} Anc_8.4...    32   7.5  
Suva_16.448 Chr16 (778841..780310) [1470 bp, 489 aa] {ON} YPR119...    32   7.6  
CAGL0K03949g Chr11 complement(365526..367043) [1518 bp, 505 aa] ...    32   7.6  
TBLA0F01440 Chr6 complement(353215..354744) [1530 bp, 509 aa] {O...    32   7.6  
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...    32   7.8  
NDAI0C04990 Chr3 (1160758..1162486) [1729 bp, 576.333333333333 a...    32   7.9  
Smik_7.31 Chr7 (62391..64133) [1743 bp, 580 aa] {ON} YGL228W (REAL)    32   7.9  
TBLA0C00170 Chr3 complement(21948..23762) [1815 bp, 604 aa] {ON}...    32   8.0  
KAFR0A04990 Chr1 (989509..991371) [1863 bp, 620 aa] {ON} Anc_6.7...    32   8.0  
Kwal_23.5731 s23 complement(1296239..1298104) [1866 bp, 621 aa] ...    32   8.0  
YBR215W Chr2 (653356..653368,653453..655317) [1878 bp, 625 aa] {...    32   8.0  
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    32   8.0  
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...    32   8.1  
ABL071W Chr2 (267074..269065) [1992 bp, 663 aa] {ON} Syntenic ho...    32   8.1  
KLLA0C03113g Chr3 (277789..279804) [2016 bp, 671 aa] {ON} unipro...    32   8.1  
TBLA0E03820 Chr5 complement(961022..963049) [2028 bp, 675 aa] {O...    32   8.2  
KAFR0G03310 Chr7 (682336..684366) [2031 bp, 676 aa] {ON} Anc_4.2...    32   8.2  
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...    32   8.2  
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...    32   8.2  
Kpol_1036.99 s1036 (259079..259699) [621 bp, 206 aa] {ON} (25907...    32   8.2  
TDEL0A06490 Chr1 complement(1135618..1137783) [2166 bp, 721 aa] ...    32   8.2  
Suva_4.425 Chr4 complement(748613..750856) [2244 bp, 747 aa] {ON...    32   8.3  
Ecym_5536 Chr5 complement(1083280..1085571) [2292 bp, 763 aa] {O...    32   8.3  
NDAI0G04310 Chr7 complement(1036686..1038977) [2292 bp, 763 aa] ...    32   8.3  
NDAI0F00330 Chr6 (77559..79946) [2388 bp, 795 aa] {ON} Anc_5.696...    32   8.4  
TBLA0B03520 Chr2 (819266..821713) [2448 bp, 815 aa] {ON} Anc_8.7...    32   8.4  
YJL176C Chr10 complement(92053..94530) [2478 bp, 825 aa] {ON}  S...    32   8.4  
YIL038C Chr9 complement(280142..282652) [2511 bp, 836 aa] {ON}  ...    32   8.4  
Skud_2.305 Chr2 complement(553986..556553) [2568 bp, 855 aa] {ON...    32   8.5  
TBLA0I02840 Chr9 complement(668598..671168) [2571 bp, 856 aa] {O...    32   8.5  
KAFR0C02040 Chr3 (404907..407567) [2661 bp, 886 aa] {ON} Anc_3.5...    32   8.5  
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    32   8.6  
KAFR0G00210 Chr7 (72892..75666) [2775 bp, 924 aa] {ON} Anc_1.136...    32   8.6  
ZYRO0B07018g Chr2 complement(551747..554551) [2805 bp, 934 aa] {...    32   8.6  
Kpol_1018.29 s1018 complement(77819..80635) [2817 bp, 938 aa] {O...    32   8.6  
AGL300C Chr7 complement(138683..141502) [2820 bp, 939 aa] {ON} S...    32   8.6  
TBLA0B02380 Chr2 (554809..557688) [2880 bp, 959 aa] {ON} Anc_3.1...    32   8.6  
Kpol_1055.3 s1055 (3810..6956) [3147 bp, 1048 aa] {ON} (3810..69...    32   8.7  
NDAI0B05300 Chr2 (1294623..1298330) [3708 bp, 1235 aa] {ON} Anc_...    32   8.9  
Kpol_1001.19 s1001 (51245..55132) [3888 bp, 1295 aa] {ON} (51245...    32   8.9  
NDAI0J00350 Chr10 (58349..59413) [1065 bp, 354 aa] {ON} Anc_7.53...    32   8.9  
CAGL0G09493g Chr7 complement(902228..906454) [4227 bp, 1408 aa] ...    32   9.0  
Kpol_1056.34 s1056 complement(84006..88406) [4401 bp, 1466 aa] {...    32   9.0  
YHR097C Chr8 complement(297385..298360,298485..298609) [1101 bp,...    32   9.0  
TBLA0A00740 Chr1 complement(159316..164547) [5232 bp, 1743 aa] {...    32   9.1  
NDAI0H00260 Chr8 (39847..45666) [5820 bp, 1939 aa] {ON}                32   9.2  
Kpol_2002.43 s2002 (87607..88866) [1260 bp, 419 aa] {ON} (87607....    32   9.5  
SAKL0G11836g Chr7 complement(1005013..1006287) [1275 bp, 424 aa]...    32   9.5  
Kwal_47.18517 s47 complement(856314..857048) [735 bp, 244 aa] {O...    32   9.5  
KLTH0F08250g Chr6 (716337..717635) [1299 bp, 432 aa] {ON} simila...    32   9.6  
ACR048C Chr3 complement(444778..446100) [1323 bp, 440 aa] {ON} S...    32   9.6  
Suva_3.184 Chr3 complement(279117..280448) [1332 bp, 443 aa] {ON...    32   9.7  
YPR119W Chr16 (771653..773128) [1476 bp, 491 aa] {ON}  CLB2B-typ...    32   10.0 
Kpol_534.19 s534 (44769..46265) [1497 bp, 498 aa] {ON} (44769..4...    32   10.0 
TPHA0A00280 Chr1 (37795..39291) [1497 bp, 498 aa] {ON} Anc_3.6 Y...    32   10.0 

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
            YEL061C (REAL)
          Length = 998

 Score = 1719 bits (4453), Expect = 0.0
 Identities = 897/998 (89%), Positives = 897/998 (89%)
 Frame = +1

Query: 1    MPAESQNTIQERXXXXXXXXXXXXXQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 180
            MPAESQNTIQER             QMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV
Sbjct: 1    MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60

Query: 181  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 360
            VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK
Sbjct: 61   VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120

Query: 361  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 540
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC
Sbjct: 121  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180

Query: 541  SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 720
            SFIELYNEE                   QFMKKLRIFD                      
Sbjct: 181  SFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 240

Query: 721  XXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 900
                LNDLTPKAALLRKRLRTKSLPNTIK                               
Sbjct: 241  SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQQQQQAMNSRNNSSSNSGSAANNSSSNTNG 300

Query: 901  XRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 1080
             RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT
Sbjct: 301  QRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 360

Query: 1081 ITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 1260
            ITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD
Sbjct: 361  ITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 420

Query: 1261 RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 1440
            RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ
Sbjct: 421  RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 480

Query: 1441 LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKR 1620
            LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKR
Sbjct: 481  LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKR 540

Query: 1621 EIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNK 1800
            EIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNK
Sbjct: 541  EIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNK 600

Query: 1801 LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ 1980
            LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ
Sbjct: 601  LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ 660

Query: 1981 PNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKN 2160
            PNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKN
Sbjct: 661  PNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKN 720

Query: 2161 IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND 2340
            IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND
Sbjct: 721  IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND 780

Query: 2341 HLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATL 2520
            HLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATL
Sbjct: 781  HLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATL 840

Query: 2521 SQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE 2700
            SQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE
Sbjct: 841  SQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE 900

Query: 2701 XXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNI 2880
                       NVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNI
Sbjct: 901  SSITSTHSHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNI 960

Query: 2881 NGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 2994
            NGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE
Sbjct: 961  NGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YEL061C
            (REAL)
          Length = 999

 Score = 1573 bits (4074), Expect = 0.0
 Identities = 816/1001 (81%), Positives = 863/1001 (86%), Gaps = 3/1001 (0%)
 Frame = +1

Query: 1    MPAESQNTIQERXXXXXXXXXXXXXQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 180
            MPAE+QNTIQER             Q+GCH VPNEELNITVAVRCRGRNEREIGMKSSVV
Sbjct: 1    MPAENQNTIQERSSNNISNNLNA--QIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVV 58

Query: 181  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 360
            VNVPDITGS+EVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVAGPLFQDFIK
Sbjct: 59   VNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIK 118

Query: 361  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 540
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+DAAGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 119  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKC 178

Query: 541  SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 720
            SFIELYNEE                    FMKKLRIFD                      
Sbjct: 179  SFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNS 238

Query: 721  XXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 900
                LNDLTPKAALLRKRLRTKSLPNTIK                               
Sbjct: 239  SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINT 298

Query: 901  X---RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHT 1071
                RS M  NDQSNGIYIQNLQEFHITNA+EGLNLLQRGLKHRQVASTKMNDFSSRSHT
Sbjct: 299  NNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHT 358

Query: 1072 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 1251
            IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA
Sbjct: 359  IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 418

Query: 1252 LVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
            L D+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN
Sbjct: 419  LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478

Query: 1432 KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE 1611
            KPQLGAF+MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES+KNEVQE
Sbjct: 479  KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 538

Query: 1612 CKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGF 1791
            CKR+IESL+SKNSLL+KDKLKS++TIQSQNSQMESLK TIN LKAQLDKQHK ELEISGF
Sbjct: 539  CKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF 598

Query: 1792 NNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQET 1971
            NNKLQK+TE+MQ+ALQDYK+RELDLNKKFETHISKEIKSLKT LF QL  M+Q NI QET
Sbjct: 599  NNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET 658

Query: 1972 DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF 2151
            +IQPNLD++KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR++FQ F
Sbjct: 659  NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 718

Query: 2152 YKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMT 2331
            Y NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYE+IEKKT++FVENFK T
Sbjct: 719  YNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNT 778

Query: 2332 LNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMA 2511
            LNDHLEENKKLIMQN+TNATSAVI+QEMDLFEP+R KWENSFDLINKCDSMNNEFYNNMA
Sbjct: 779  LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 838

Query: 2512 ATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKD 2691
             TLSQIK TVDTSSNSMN+SISVMKGQVEESENA+SLLKNN KFNDQFKQL++KH ILKD
Sbjct: 839  TTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKD 898

Query: 2692 NIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRI 2871
            NIE           N+DDIY+TIE+IM N+GNKENA K+EMIDNILKEIP+LSKR+PLR+
Sbjct: 899  NIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRL 958

Query: 2872 SNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 2994
            SN NG S Q+I+SPKKH I+DENPS+E  D E SRKI KTE
Sbjct: 959  SNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score = 1560 bits (4040), Expect = 0.0
 Identities = 806/1002 (80%), Positives = 862/1002 (86%), Gaps = 4/1002 (0%)
 Frame = +1

Query: 1    MPAESQNTIQERXXXXXXXXXXXXXQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 180
            MPAE+QNT Q+R             Q+GCH+VPNEELNITVAVRCRGRNEREI MKSSVV
Sbjct: 1    MPAENQNTGQDRSSNSISKNGNS--QVGCHTVPNEELNITVAVRCRGRNEREISMKSSVV 58

Query: 181  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 360
            VNVPDITGSKE+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVAGPLFQDFIK
Sbjct: 59   VNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIK 118

Query: 361  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 540
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+DAAGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 119  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKC 178

Query: 541  SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 720
            SFIELYNEE                   QFMKKLRIFD                      
Sbjct: 179  SFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 238

Query: 721  XXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 900
                LNDLTPKAALLRKRLRTKSLPNTIK                               
Sbjct: 239  SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTN 298

Query: 901  X----RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSH 1068
                 RS M  NDQ+NGIYIQNLQEFHITNA+EGLNLLQ+GLKHRQVASTKMNDFSSRSH
Sbjct: 299  TNNGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSH 358

Query: 1069 TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1248
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 359  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 418

Query: 1249 ALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
            ALVD+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 419  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478

Query: 1429 NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQ 1608
            NKPQLG+F+MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES+KNEVQ
Sbjct: 479  NKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 538

Query: 1609 ECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISG 1788
            ECKREIESL SKN+LLVKDKLKS+ETIQSQN Q+ESLK TI+HL+AQLDKQHK E+EIS 
Sbjct: 539  ECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISD 598

Query: 1789 FNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQE 1968
            FNNKLQK+TEVMQ+AL DYKKRELDLN+KFE HI+KEIK LK+ LFLQL+ MQQ++I QE
Sbjct: 599  FNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQE 658

Query: 1969 TDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQN 2148
            T+IQPNLDM+KNEVLTLM TMQEKAELMYKDCVKKILNESPKFFNV++EKIDIIR++FQ 
Sbjct: 659  TNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQK 718

Query: 2149 FYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKM 2328
            FYKNIAENLSDISEENNN+KQYLKNHFFKNNHQELLN H+DSTYENIEK+TN+FVENFK 
Sbjct: 719  FYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKK 778

Query: 2329 TLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNM 2508
             LNDHL+ENKKLIMQN+T ATSAVIDQEMDLFEP+R KWENSFDLIN CDSMNNEFYN+M
Sbjct: 779  VLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSM 838

Query: 2509 AATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILK 2688
            AATLSQIK TVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQF+QLI+KH +LK
Sbjct: 839  AATLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLK 898

Query: 2689 DNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLR 2868
            DNI+           NVDDIYNTIE+IM N+GNKENATKDEMI+NILKEIPNLSK++PLR
Sbjct: 899  DNIKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLR 958

Query: 2869 ISNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 2994
            +SNIN  SVQ +ISPKKH IEDEN SSEN D+EGSRK+ K E
Sbjct: 959  LSNINSNSVQSVISPKKHAIEDENKSSENVDNEGSRKMLKIE 1000

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score = 1535 bits (3974), Expect = 0.0
 Identities = 795/1004 (79%), Positives = 851/1004 (84%), Gaps = 6/1004 (0%)
 Frame = +1

Query: 1    MPAESQNTIQERXXXXXXXXXXXXXQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 180
            MP E+QN+ QER             Q+GCH+V NEELNITVAVRCRGRNEREI MKSSVV
Sbjct: 1    MPVENQNSSQERTSNNISKNGNS--QIGCHTVHNEELNITVAVRCRGRNEREISMKSSVV 58

Query: 181  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 360
            VNVPDITGSKE+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVA PLFQDFIK
Sbjct: 59   VNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIK 118

Query: 361  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 540
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+D+AGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 119  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKC 178

Query: 541  SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 720
            SFIELYNEE                   QFMKKLRIFD                      
Sbjct: 179  SFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSSSRNS 238

Query: 721  XXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 900
                LNDLTPKAALLR+RLRTKSLPNTIK                               
Sbjct: 239  SPRSLNDLTPKAALLRRRLRTKSLPNTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSD 298

Query: 901  X------RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSR 1062
                   R+ +  NDQSNGIYIQNLQEFHITNA+EGL LLQ+GLKHRQVASTKMNDFSSR
Sbjct: 299  TNNNNGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSR 358

Query: 1063 SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 1242
            SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV
Sbjct: 359  SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 418

Query: 1243 INALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 1422
            INALVD+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN
Sbjct: 419  INALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 478

Query: 1423 IKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNE 1602
            IKNKPQLGAF+MKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLES+KNE
Sbjct: 479  IKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNE 538

Query: 1603 VQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEI 1782
            VQECKREIESL SKNSLLVK+KLKS+ETIQSQNSQ+ESLKATI+HL+ QLDKQHK ELEI
Sbjct: 539  VQECKREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEI 598

Query: 1783 SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF 1962
            SGFN+KLQK+TEVMQ+ALQDYK+RELDLNKKFETHI+ EIK++KT LF QL  +QQ+NI 
Sbjct: 599  SGFNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNIL 658

Query: 1963 QETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEF 2142
            QETDIQPNLD++KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN IVEKIDII ++F
Sbjct: 659  QETDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDF 718

Query: 2143 QNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENF 2322
            + FYKNIAENLSDISEENNNLKQY  NHFF+NNHQELL+HH+DSTYE IEKKTNQFVENF
Sbjct: 719  ERFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENF 778

Query: 2323 KMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYN 2502
            K  LNDHLEENKKLIM+N+T  TSAVIDQEM LFEP+R KWE+SFDLIN+CDSMNNEFYN
Sbjct: 779  KKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYN 838

Query: 2503 NMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHII 2682
            +MA TLSQIK TVDTSSNSMN+SISVMKGQVEESENAISLLKNN KFNDQFKQLI+KH I
Sbjct: 839  SMATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTI 898

Query: 2683 LKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLP 2862
            LKDNIE           N+DDIYNTIE IM N+GNKENATKDEMI+N+L EIPNLSKR+P
Sbjct: 899  LKDNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMP 958

Query: 2863 LRISNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 2994
            LRISN N  S+Q+IISPKKH IEDEN S+ N DSE SRKI KTE
Sbjct: 959  LRISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
            Anc_6.16 YEL061C
          Length = 958

 Score =  910 bits (2351), Expect = 0.0
 Identities = 476/929 (51%), Positives = 637/929 (68%), Gaps = 4/929 (0%)
 Frame = +1

Query: 103  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
            EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS EVSINTTGD GITAQ+N+K YTVD
Sbjct: 13   EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 283  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
            +VFGP A+Q L+F+++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GEL+++
Sbjct: 73   EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 463  AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 642
            AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEE                      +KL
Sbjct: 133  AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS--------RKL 184

Query: 643  RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXX 822
            RIFD                           +   P A  LRKR +T             
Sbjct: 185  RIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAP----------- 233

Query: 823  XXXXXXXXXXXXXXXXXXXXXXXXXXXRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLL 1002
                                       +S     DQ+ GIYIQNLQ+FHITNA EG+ LL
Sbjct: 234  ------------------------SVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLL 269

Query: 1003 QRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGAL 1182
            Q+GLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+RSGA 
Sbjct: 270  QKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQ 329

Query: 1183 NQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1362
            +QRAKEAGSINQSLLTLGRVIN+L D+S H+PFRESKLTRLLQDSLGGNTKTALIATISP
Sbjct: 330  HQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISP 389

Query: 1363 AKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGI 1542
            AK+ SEETCSTL+YA+KAKNIKNKPQLG+ +MKDILVKNIT ELAKIK+DLLSTKSKEGI
Sbjct: 390  AKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGI 449

Query: 1543 YMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLK 1722
            YMSQD+YK L +DLES+K EV+ECKR IE+L S+N+LL+KDK  S E    Q  ++++++
Sbjct: 450  YMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMR 509

Query: 1723 ATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEI 1902
              ++ L ++ +KQ+K E  +    + L+     MQ  ++++++RE D+  K     + E 
Sbjct: 510  DAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEF 569

Query: 1903 KSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILN 2082
              +K  +   + +++Q+  ++   +Q N+D ++ E+  L+E  Q++ + MYKDCV+KIL+
Sbjct: 570  ARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILD 629

Query: 2083 ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH 2262
            E+P  F +  EK+  +       ++++ ENLSD+SEE NNL+QYL +HFFKNNH+E+L  
Sbjct: 630  ETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVS 689

Query: 2263 HIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAK 2442
            HID TY +I+   +   + FK  +++HLE+NK L+++++  AT  VI +EM LFEP++ K
Sbjct: 690  HIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKK 749

Query: 2443 WENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISL 2622
            WE+SF  INKCDS+N  F N + + L  IK T+ +S  ++N++I+ +K Q++E E+  S+
Sbjct: 750  WEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPASM 809

Query: 2623 LKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENAT 2802
            L N+  F++QF  +++K  +L ++++            VD +   I+ +++  G+     
Sbjct: 810  LSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSMEGE 869

Query: 2803 KDEMIDNILKEIPNLS----KRLPLRISN 2877
            + E +D IL+ +   +     R PLR +N
Sbjct: 870  RVEHVDGILRRMDEQNLLYLDRSPLRPAN 898

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
            some similarities with uniprot|P27895 Saccharomyces
            cerevisiae YEL061C CIN8 Kinesin motor protein involved in
            mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  873 bits (2255), Expect = 0.0
 Identities = 464/930 (49%), Positives = 626/930 (67%), Gaps = 8/930 (0%)
 Frame = +1

Query: 103  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
            EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K Y VD
Sbjct: 13   EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 283  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
            KVFGP A+Q LIF+E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN EL+D+
Sbjct: 73   KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 463  AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 642
            AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEE                     M+KL
Sbjct: 133  AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS--------MRKL 184

Query: 643  RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLPNTI-KXXXX 819
            RI+D                             L     + R+R+RT  L +++ K    
Sbjct: 185  RIYDSGSGSNSNSGSRKNSRNNSPK--------LVTDPMINRRRMRTVPLSSSLAKQQHQ 236

Query: 820  XXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPMTQNDQSNGIYIQNLQEFHITNALEGLNL 999
                                        +    Q D  +G+YIQNLQ+FHIT+A +GL L
Sbjct: 237  WQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQL 296

Query: 1000 LQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGA 1179
            LQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSENI+RSGA
Sbjct: 297  LQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGA 356

Query: 1180 LNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATIS 1359
             +QRAKEAGSINQSLLTLGRVIN+L D+S H+PFRESKLTRLLQDSLGGNTKTALIATIS
Sbjct: 357  QHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATIS 416

Query: 1360 PAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEG 1539
            PAK+ SEETCSTL+YASKAKNIKN+PQL +F+MKDILVKNIT ELAK+KSDLLSTK +EG
Sbjct: 417  PAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREG 476

Query: 1540 IYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESL 1719
            +YMSQD+YK + +DLES+K E+QE KR IE L+S+NSLL+KDK  S E  + Q  +++++
Sbjct: 477  VYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNM 536

Query: 1720 KATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKE 1899
            K  ++ L  +L+ QHK E E+      L+    + Q  +++Y +RE  ++++ +  + +E
Sbjct: 537  KDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQE 596

Query: 1900 IKSLKTALFLQLDNMQQKNI-------FQETDIQPNLDMVKNEVLTLMETMQEKAELMYK 2058
                +  L   +++++  +         ++  IQ NL++++ EV+ L+   Q++AE MYK
Sbjct: 597  FLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYK 656

Query: 2059 DCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKN 2238
            D ++KIL E+P  F  I  K+D + +    +++ + ENLSDISE  NNLKQY  +HFFKN
Sbjct: 657  DWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKN 716

Query: 2239 NHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMD 2418
            NH+E+LN HID TY+ ++   +  ++ FK  ++DHL++NK L+M+++ +AT+  ID+EM 
Sbjct: 717  NHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQ 776

Query: 2419 LFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVE 2598
            LFEP+R KWE SFDLIN CDS++N F  +M + LS IK T  +S++ ++ S+S +K +V+
Sbjct: 777  LFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVK 836

Query: 2599 ESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTN 2778
              E+A ++L  N     Q   +I+K   L++ +              D++   I + + +
Sbjct: 837  GYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIAS 896

Query: 2779 HGNKENATKDEMIDNILKEIPNLSKRLPLR 2868
                EN+T  +        +   S+R PL+
Sbjct: 897  ----ENSTLHQNKIATTPPLGQNSERSPLK 922

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  862 bits (2227), Expect = 0.0
 Identities = 474/932 (50%), Positives = 612/932 (65%), Gaps = 28/932 (3%)
 Frame = +1

Query: 103  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
            EELNITVAVRCRGRNEREI +KSSV+V VPDI GS EVSINTT D GITAQMN+K YTVD
Sbjct: 50   EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109

Query: 283  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
            KVFGP A+Q LIF+EVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+++
Sbjct: 110  KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169

Query: 463  AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 642
            AGIIPR+L KLFDTLE+ Q DYVVKCSFIELYNE+                     + KL
Sbjct: 170  AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSN---INKL 226

Query: 643  RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAA-----LLRKRLR--------- 780
            RIFD                          LN  T          LR++L+         
Sbjct: 227  RIFDSSTASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPEN 286

Query: 781  --------TKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPMTQNDQSN 936
                    + S+ N  K                                 +P   ++ + 
Sbjct: 287  SNIFTSNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNN- 345

Query: 937  GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 1116
            GIYIQNLQEFHI+NA EGL LLQ+GLK+RQVASTKMNDFSSRSHTIFTITLYK+HQ  LF
Sbjct: 346  GIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLF 405

Query: 1117 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKL 1296
            R+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L DR+ HIPFRESKL
Sbjct: 406  RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKL 465

Query: 1297 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVK 1476
            TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ + KDIL+K
Sbjct: 466  TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLK 525

Query: 1477 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLL 1656
            NIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L++HK E  E KR IE L+S+N+LL
Sbjct: 526  NITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALL 585

Query: 1657 VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVAL 1836
            +KDK  S E  + Q  ++   + +IN L+ +++ Q+  E  +    +KLQ   +  +  +
Sbjct: 586  LKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMI 645

Query: 1837 QDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLT 2016
            ++Y+ +++D+  K E  +  ++ SL+  L    + ++  N   + DI  NLDM++NEV+ 
Sbjct: 646  ENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEVIK 705

Query: 2017 LMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEEN 2196
            ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I I+ QN +  +A+NLSDISEE 
Sbjct: 706  MLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEY 765

Query: 2197 NNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQN 2376
            NNLKQYL  + F+NNH++L+N HI+ST + +    +     FK  +N HLE N+ L++ +
Sbjct: 766  NNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNS 825

Query: 2377 MTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSN 2556
               AT  VI++EM+LF PR+ KWE S DLIN+CDS+NN F   +   LS  +  +  S N
Sbjct: 826  FKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASIN 885

Query: 2557 SMNESISVMKGQVE------ESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXX 2718
             M ++ + +K ++        S N  +++++N     QF +L  K+ I +DN+E      
Sbjct: 886  QMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKCA 945

Query: 2719 XXXXXNVDDIYNTIEDIMTNHGNKENATKDEM 2814
                 N++ + ++I+  + +   K   T+ E+
Sbjct: 946  VASVNNLNHLEDSIKMAVRDTRIKGGPTEGEV 977

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
            YEL061C
          Length = 963

 Score =  823 bits (2125), Expect = 0.0
 Identities = 454/919 (49%), Positives = 599/919 (65%), Gaps = 7/919 (0%)
 Frame = +1

Query: 103  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
            EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKEV+INT+ D G TAQMN+K YTVD
Sbjct: 15   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 283  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
            KVFGP A+Q LIF+E+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN EL+D+
Sbjct: 75   KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 463  AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 642
            AGIIPR+L KLF+TLE    D++VKCSF+ELYNEE                      KKL
Sbjct: 135  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGN------FKKL 188

Query: 643  RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKR---LRTKSLPNTIKXX 813
            RIFD                          L       ALLR R      +S   TI+  
Sbjct: 189  RIFDSLGRDSRSNSRNNSPKMSNNNTTF--LKKKLRNEALLRSRNIASSKRSSMQTIRNT 246

Query: 814  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPMT-QNDQSNGIYIQNLQEFHITNALEG 990
                                              T Q+DQ+ GIYIQNLQEFHIT A EG
Sbjct: 247  TTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEG 306

Query: 991  LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 1170
            + LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+SKMNLVDLAGSENINR
Sbjct: 307  IKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINR 366

Query: 1171 SGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIA 1350
            SGALNQRAKEAGSINQSLLTLGRVIN+L D++ H+PFRESKLTRLLQDSLGGNTKTALIA
Sbjct: 367  SGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIA 426

Query: 1351 TISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKS 1530
            TISPAKVT EETCSTLEYASKAKNIKNKPQLG+F+MKDIL+KNIT EL KIKSDLLSTKS
Sbjct: 427  TISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKS 486

Query: 1531 KEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQM 1710
            K+GIYM Q HYK L +DL+++K E+QECKR IESL S+N+LL+KDK    E  + Q  ++
Sbjct: 487  KDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI 546

Query: 1711 ESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHI 1890
            +++  ++  L A++++Q   E E+ G      K    +   + + K RE  +N KF+T +
Sbjct: 547  QTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLL 606

Query: 1891 SKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVK 2070
               +  +   L  Q++N + + I Q   +  NL ++K+E+  L+ T ++  E  Y++C+ 
Sbjct: 607  DHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT 666

Query: 2071 KILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFF---KNN 2241
            K L+++P  F+ I + +  ++    N+Y  IAENLSD+SEE NN KQ++ + F+   K +
Sbjct: 667  KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGH 726

Query: 2242 HQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDL 2421
              ELLN +I++T   IE  +N  +   +  LN+HL  NK+LI+ +++N T+ ++  E+D 
Sbjct: 727  QHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDR 786

Query: 2422 FEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEE 2601
             +P+ +KWE S +LIN+ D++NNEF +N+ ++++ +   +  +++S+N +I  +    + 
Sbjct: 787  LKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKINEHFKT 846

Query: 2602 SENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNH 2781
            ++ A S   NN   +D        + I+K+N +            V + Y     ++TN 
Sbjct: 847  NDIAHS---NNLMIDD--------NNIIKNNFKSIEEKNSRLHEFVKEGY-----LVTNE 890

Query: 2782 GNKENATKDEMIDNILKEI 2838
              K+    D  I  +LK+I
Sbjct: 891  SMKKLNELDTSIRTVLKDI 909

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
            Anc_6.16
          Length = 1004

 Score =  645 bits (1663), Expect = 0.0
 Identities = 329/624 (52%), Positives = 456/624 (73%), Gaps = 5/624 (0%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            ++ +NGIYIQNLQEFHITNA EGL+LLQ+GLKHRQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 295  DENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEH 354

Query: 1102 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 1281
            +D LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L D+S H+PF
Sbjct: 355  KDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPF 414

Query: 1282 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 1461
            RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ ++K
Sbjct: 415  RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILK 474

Query: 1462 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 1641
            DIL+KNIT ELAK+KSDL+STKSK+GIYMS +HY+ L  +LES K EVQE KR IE L+S
Sbjct: 475  DILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSS 534

Query: 1642 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 1821
            +NS+L+KDK  + E  + Q  ++ +LK ++++L  +L+ Q+  E ++     +L+K  E 
Sbjct: 535  QNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREK 594

Query: 1822 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 2001
            +   +++Y+ ++  L  +    +++ +  LK  L    D ++Q       D++ NL ++K
Sbjct: 595  LNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQSE--GNFDVEMNLKVIK 652

Query: 2002 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 2181
            +E+ +++E  Q K E+MYK+ +++ L ++P     I E +  +      +Y  I ENLSD
Sbjct: 653  DEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSD 712

Query: 2182 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 2361
            ISEE NNLKQYL N FF+NNH++LLN HI++T + + + + +    FK+ ++ HL ENKK
Sbjct: 713  ISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKK 772

Query: 2362 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 2541
            L++ N   AT+ VI +EM+LF+P+R KWE S +LIN+CDS+NN F++NM   +S+IK  +
Sbjct: 773  LMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNL 832

Query: 2542 DTSSNSMNESISVMKGQV-----EESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXX 2706
             +SS+S++ +I+ +K QV      +  +  + L+N+  FN  F ++I K++IL+ N +  
Sbjct: 833  ASSSSSIHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRKNA 892

Query: 2707 XXXXXXXXXNVDDIYNTIEDIMTN 2778
                     N+D++  T++  + N
Sbjct: 893  INYTDKSLLNIDELSETVKIALNN 916

 Score =  247 bits (631), Expect = 1e-67
 Identities = 126/164 (76%), Positives = 142/164 (86%), Gaps = 10/164 (6%)
 Frame = +1

Query: 106 ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDK 285
           ELNITVAVRCRGRNEREI  KS VVV VPDITG++E+SINTTG+TGITAQMN+K YTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 286 VFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-NGE-LND 459
           VFGP A QDLIF+EVA PLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY NG  L+D
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 460 AAGIIPRVLLKLFDTLELQQ--------SDYVVKCSFIELYNEE 567
           AAGIIPR+L KLFDTL+  +        +D+VVKCSF+ELYNE+
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNED 191

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..12123)
            [3015 nt, 1005 aa]
          Length = 1004

 Score =  616 bits (1588), Expect = 0.0
 Identities = 309/639 (48%), Positives = 457/639 (71%), Gaps = 2/639 (0%)
 Frame = +1

Query: 925  DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1104
            D+  GIYIQNL+EFHIT+A EG+ LLQRGL++RQVASTKMNDFSSRSHTIFTI LYK+H 
Sbjct: 298  DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 1105 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 1284
             ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPFR
Sbjct: 358  GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ + KD
Sbjct: 418  ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 1465 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 1644
            ILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLES+K EVQECKR I+ L ++
Sbjct: 478  ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 1645 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 1824
            N LL+KDK  S E    Q  +++S+K +I+HL   ++KQH+ E  +     KL+  +  M
Sbjct: 538  NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 1825 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 2004
            Q  ++ + +RE     K +   ++E+  LK+ L   L+ + +K +   TD+  N++ +K+
Sbjct: 598  QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 2005 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIE-FQNFY-KNIAENLS 2178
            EV ++++T Q +A  +YKDC+++++ ESP     + +  DII+++   + Y + ++ ++S
Sbjct: 658  EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLND--DIIKMQKISDLYNEQLSISIS 715

Query: 2179 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK 2358
            +++ E+N+LKQYL   FFK++H+E+LN HI+ TY+NI + +   VE  K  L  +LEE++
Sbjct: 716  ELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESR 775

Query: 2359 KLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKT 2538
             +I+ ++ N TS ++  EM+LF P++ KWE+SF++INKCDS+NN+++ +++A LS +K +
Sbjct: 776  NIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTS 835

Query: 2539 VDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXX 2718
            V ++S+ +++ +S M+   + +  +  L +N+ +   QF +++ K+  L+ ++       
Sbjct: 836  VTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMN 895

Query: 2719 XXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKE 2835
                   D +  +I      +      ++ +   N++K+
Sbjct: 896  ESSINAFDKLSESIHSAFEKYNTANTISRLDESTNLMKQ 934

 Score =  256 bits (653), Expect = 1e-70
 Identities = 129/184 (70%), Positives = 143/184 (77%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS E++INTT D GI  QMN+K YTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 283 KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
           KVFGP A+Q LIFEEVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGEL+D+
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 463 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 642
           AGIIPRVL KLFD +E Q  DY++KCSFIELYNEE                      KKL
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEE-------LKDLLDECQAINSTAKKL 183

Query: 643 RIFD 654
           RIFD
Sbjct: 184 RIFD 187

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar to
            uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
            Kinesin-like protein
          Length = 988

 Score =  611 bits (1576), Expect = 0.0
 Identities = 321/653 (49%), Positives = 453/653 (69%), Gaps = 2/653 (0%)
 Frame = +1

Query: 925  DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1104
            DQS  IYIQNL+EFHIT+A+EGL LLQ+GLK RQVASTKMNDFSSRSH+IFTITLYK+  
Sbjct: 304  DQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQN 363

Query: 1105 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 1284
             ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 364  GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            ESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAF+MKD
Sbjct: 424  ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483

Query: 1465 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 1644
            ILV++IT ELAKIKSDLLSTKSKEG+YMS +HYK+L+ D+E +K E++E KR IESL ++
Sbjct: 484  ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543

Query: 1645 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 1824
            N++L +++L  ++      + + SLK  +  L++ L +Q   E  I      +Q   E M
Sbjct: 544  NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603

Query: 1825 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 2004
            +  +  ++ ++ +L +   T IS EI +++  L   ++ +Q     ++T+I  NL  ++ 
Sbjct: 604  KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEK 663

Query: 2005 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 2184
            EV+ +++  +E+A   Y +CVK +L E+P+ F  +  ++D I    +  +  IAE LSD+
Sbjct: 664  EVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723

Query: 2185 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 2364
            SEE NNLKQYL N+FFKNNH+ELL+HH+ +TY  +E+ + Q ++NF M L+ H++ENK+ 
Sbjct: 724  SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783

Query: 2365 IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 2544
            +++N+   T  VI+ E+ +F  +RAKWE S  LIN+CDS+N+ F+  + + L +I+  V 
Sbjct: 784  MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843

Query: 2545 TSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXX 2724
            +S +++  +IS ++ +    ++   +++ N     Q  ++  K+  L    E        
Sbjct: 844  SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903

Query: 2725 XXXNVDDIYNTIEDIMTNHGNKENAT--KDEMIDNILKEIPNLSKRLPLRISN 2877
               +V+ +   ++ IM    N    +  K E+ D  L  +    +++PL I+N
Sbjct: 904  SIGSVNKVEGNLKVIMDKVLNDPQLSRGKAEVPDEELHRL----EKIPLGITN 952

 Score =  252 bits (643), Expect = 3e-69
 Identities = 130/184 (70%), Positives = 143/184 (77%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
           EELNI VAVRCRGRNEREI  KSSVVV+VPD   + EVSINTT D GI A+MN+K YTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 283 KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
           KVFGP ASQ L++EE+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL DA
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 463 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 642
           AGIIPRVL +LFDTLE  + DY+VKCSF+ELYNEE                      KKL
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------KKL 203

Query: 643 RIFD 654
           RIFD
Sbjct: 204 RIFD 207

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 948

 Score =  606 bits (1563), Expect = 0.0
 Identities = 328/691 (47%), Positives = 452/691 (65%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            ++QS+ IYIQNLQEFHITNA +G+NLLQRGLKHRQVASTKMNDFSSRSHTIFTI LYK H
Sbjct: 255  SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH 314

Query: 1102 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 1281
              E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 315  NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374

Query: 1282 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 1461
            RESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MK
Sbjct: 375  RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434

Query: 1462 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 1641
            DILVKNIT ELAKIKSD LSTKSK+GIYM+QDHYK L SDLE++K EVQECKREIE + S
Sbjct: 435  DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS 494

Query: 1642 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 1821
            +N LL+KDK  S E  + Q  +++ L   I HL  ++DKQHK E ++    + L+     
Sbjct: 495  QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT 554

Query: 1822 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 2001
            +Q +L++ +  +L    + E  +   + S K ++  QL  M+  +  +   I  N+D+++
Sbjct: 555  VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614

Query: 2002 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 2181
             E+  ++E++   +  + + CV+KIL  +PK F  I   +  I     ++   + +NL D
Sbjct: 615  EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674

Query: 2182 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 2361
            ISEE NN ++YL  H FKNNH+E L+ H+D TY  ++K   +    FK  ++ HLEENK 
Sbjct: 675  ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734

Query: 2362 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 2541
            L+++++  A+  V+ +E+ LF P + KWE+S + INKCDS+NN F + +   L +++  +
Sbjct: 735  LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794

Query: 2542 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXX 2721
            + S      +   +K  +++ +    +LKNNTK  +   ++  KH  L+D +E       
Sbjct: 795  EGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSYIE 854

Query: 2722 XXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQD 2901
                  + I   I  I+            E+++ +L++   L K     I + +      
Sbjct: 855  AANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQ---LGKTHLKPIGSASRTPSSR 911

Query: 2902 IISPKKHTIEDENPSSENADSEGSRKIPKTE 2994
             +SP K T+++   +  N  S   RK+ +TE
Sbjct: 912  SVSPMK-TLDN---NIFNGISPSKRKVDETE 938

 Score =  262 bits (669), Expect = 6e-73
 Identities = 133/184 (72%), Positives = 147/184 (79%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GITAQMN+K YTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 283 KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
           KVFGP A Q LIF+++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL+DA
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 463 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 642
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEE                     +KKL
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESG--------VIKKL 186

Query: 643 RIFD 654
           RIFD
Sbjct: 187 RIFD 190

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
            uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
            protein CIN8 and some similarites with YEL061C
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 965

 Score =  595 bits (1535), Expect = 0.0
 Identities = 312/643 (48%), Positives = 440/643 (68%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            N+QS+ IYIQ+LQEFHIT+A EGL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 263  NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322

Query: 1102 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 1281
              E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 323  NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382

Query: 1282 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 1461
            RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+FMMK
Sbjct: 383  RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442

Query: 1462 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 1641
            DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E++K E+QE +REIE L+S
Sbjct: 443  DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502

Query: 1642 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 1821
            +N LL KDK  S++TI+SQ  Q+ +L++++++L  ++D +HK E+E++    KL+     
Sbjct: 503  QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562

Query: 1822 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 2001
            MQ AL+ ++  E  L    +  +   I   +  +  +LDN++Q+ + Q   I  +++ VK
Sbjct: 563  MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622

Query: 2002 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 2181
            + + TL+ET+++ A +M ++  +K++ + PKFFN ++ +++ +  +       + E LS 
Sbjct: 623  DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682

Query: 2182 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 2361
            I+ ENNNLK YL  HFF+NNHQE+LN H D TY  +   +   +      ++DH+E+N+ 
Sbjct: 683  ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742

Query: 2362 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 2541
            L+M  +  AT+ VI QEM  FEP R  WE SF+ IN CDS++N+F ++   +L+ +K  +
Sbjct: 743  LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802

Query: 2542 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXX 2721
            +++    +     +K  +   ++   +    T  N     + +KH +L+D +E       
Sbjct: 803  ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIH 862

Query: 2722 XXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLS 2850
                    I ++++ IM N    E  T + + D+++K I + S
Sbjct: 863  ASSEGFKAIDSSLKRIM-NFRMPEGKT-ETLADDLIKHIDSSS 903

 Score =  261 bits (667), Expect = 1e-72
 Identities = 125/159 (78%), Positives = 143/159 (89%)
 Frame = +1

Query: 91  SVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 270
           S   +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ EVSINT+GD GITA+MN+K 
Sbjct: 7   SPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKT 66

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           YTVDKVFGP A Q L+F+E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GE
Sbjct: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
           L++AAGIIPRVL KLFDTLE+Q+SDY+VKCSFIELYNEE
Sbjct: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEE 165

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
            (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  581 bits (1497), Expect = 0.0
 Identities = 309/677 (45%), Positives = 441/677 (65%), Gaps = 7/677 (1%)
 Frame = +1

Query: 910  PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1089
            P++  + S+ I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI L
Sbjct: 228  PVSPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 287

Query: 1090 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG 1269
            YKK   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S 
Sbjct: 288  YKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL 347

Query: 1270 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 1449
            HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+
Sbjct: 348  HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 407

Query: 1450 FMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIE 1629
            F+MKD+L+K++T EL KIKSDLLSTKSK+GIYMSQ++YK L ++LE++K EV+ECKR +E
Sbjct: 408  FIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAME 467

Query: 1630 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 1809
             ++++NSLL+K+K  S E  +SQ  ++  L   I  L  ++D+QHK E E+S    +L +
Sbjct: 468  KVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMR 527

Query: 1810 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNL 1989
                MQ +L+ Y+ +    + + E  +   I S K +L  +++ ++        D++ N+
Sbjct: 528  ALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNV 587

Query: 1990 DMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAE 2169
            D V  E+  + + M      ++++ +KK+ +++P +F  I  +++ I     ++  N+  
Sbjct: 588  DAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMI 647

Query: 2170 NLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLE 2349
            +LS ISEE NNLK YL  HFFKNN QE L+ H+D TY  ++   N      +  LN+ L+
Sbjct: 648  HLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELD 707

Query: 2350 ENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQI 2529
             NK+ +MQ++ +A S V+ +EM L +P +  WENS + IN+CD +NN F N +  T+++I
Sbjct: 708  TNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEI 767

Query: 2530 KKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXX 2709
             KT+D    +   +    K ++     A S L+NN         +  KH +LK  ++   
Sbjct: 768  FKTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSA 827

Query: 2710 XXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNL-------SKRLPLR 2868
                       +I N+I+D++ N         +  ID +L+++ +        S + P+R
Sbjct: 828  NYMQAATQKFGEIDNSIQDLL-NAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMR 886

Query: 2869 ISNINGCSVQDIISPKK 2919
                +  +   ++ P+K
Sbjct: 887  TVQRSVTNTDQLLPPQK 903

 Score =  256 bits (653), Expect = 8e-71
 Identities = 130/185 (70%), Positives = 146/185 (78%)
 Frame = +1

Query: 100 NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 279
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTV
Sbjct: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
           DKVFGP A Q LIF+ +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL++
Sbjct: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 460 AAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKK 639
            AGIIPRVL KLFD L  Q  DY++KCSFIELYNEE                      KK
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEE--------LKDLLDETPDSSMPKK 175

Query: 640 LRIFD 654
           LRIFD
Sbjct: 176 LRIFD 180

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
            YEL061C
          Length = 950

 Score =  549 bits (1414), Expect = e-180
 Identities = 302/694 (43%), Positives = 446/694 (64%), Gaps = 10/694 (1%)
 Frame = +1

Query: 937  GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 1116
            GIYIQNL++FHI+ A EGL LLQRGL+ RQVA+TK+ND SSRSHTIFTITLYKK +D+L+
Sbjct: 269  GIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDLY 328

Query: 1117 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKL 1296
            R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+L D+S HIPFRESKL
Sbjct: 329  RLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKL 388

Query: 1297 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVK 1476
            TRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLG+F++KDIL+K
Sbjct: 389  TRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLK 448

Query: 1477 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLL 1656
            +++ EL K+++DL  TKSKEGIY+SQ +YK +  DL++ K E+ E KR  +SL  +N LL
Sbjct: 449  DVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELL 508

Query: 1657 VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVAL 1836
             K+K    E   S  S++++L++ +  +  +L + +    ++S     + ++   ++  +
Sbjct: 509  GKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLI 568

Query: 1837 QDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLT 2016
            + Y+++      KF+  +  E+ +L   +  Q D ++  N      I  ++D ++ EV+ 
Sbjct: 569  EVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN-SGNYQIHTHIDSIRGEVMN 627

Query: 2017 LMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEEN 2196
            L+ET +E AE +YK C+  +L E+PK F +I + +  IR   +  Y  +A N SD+SEE 
Sbjct: 628  LLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEF 687

Query: 2197 NNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQN 2376
            N  KQYL   FF+NNH E++  H D    N++K ++  +++ + ++ ++L  N +++  +
Sbjct: 688  NTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNS 747

Query: 2377 MTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSN 2556
            + +    VI++EMDLF P+++KWE S DLIN+ DS++N+F NNM  ++  I   +  S+ 
Sbjct: 748  INDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSNE 807

Query: 2557 SMNESISVMKGQVEESE-NAISLLKNNTKFNDQFKQLISK-----HIILKDNIEXXXXXX 2718
            SM+ SIS +K  + E++ N+   + +N    + FK +  K     H++  D         
Sbjct: 808  SMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVTGD-------LT 860

Query: 2719 XXXXXNVDDIYNTIEDIMT-NHGNKE-NATKDEMIDNILKEIPNLSKRLPLR--ISNING 2886
                 ++D I N    I T  HG++  ++TK   I    +     S  +PL+   SN+N 
Sbjct: 861  VTAQESMDGIQNLDRSIRTLIHGDQYIHSTKGVHIPPQNRGPELHSTLIPLKPSSSNLNR 920

Query: 2887 CSVQDIISPKKHTIEDENPSSENADSEGSRKIPK 2988
             S     SP+K        S  + D   + KIPK
Sbjct: 921  LSDSTKSSPRKR-------SQGSEDETHASKIPK 947

 Score =  212 bits (540), Expect = 4e-56
 Identities = 103/160 (64%), Positives = 131/160 (81%), Gaps = 1/160 (0%)
 Frame = +1

Query: 91  SVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 270
           ++  +++NITVAVRCRGRN+REI  KS +VV VPD+T + EVSINT+G +GI AQ+ AK 
Sbjct: 19  AMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKT 78

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL-YNG 447
           YTVDKV+GP +SQ L+FE+ A PLF DF++GYNCT+LVYGMTSTGKTYTMTGD ++   G
Sbjct: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138

Query: 448 ELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
           ++N  AGI PR+L+KLF+ L   Q DYVVKCSF+ELYNE+
Sbjct: 139 DVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNED 175

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
            Ashbya gossypii ACR010C
          Length = 944

 Score =  548 bits (1411), Expect = e-179
 Identities = 279/599 (46%), Positives = 420/599 (70%), Gaps = 7/599 (1%)
 Frame = +1

Query: 925  DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1104
            +QS+ IYIQNLQEFHITNA EG+++LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 242  EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 1105 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 1284
             ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 302  GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+FMMKD
Sbjct: 362  ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 1465 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 1644
            ILVK+I+ EL+K+KSD LSTK+KEGIYMS +HY+ + +DLE+++ E+QE KR++ES +S+
Sbjct: 422  ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 1645 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 1824
            NSLL+KDK  S++  + Q+ ++  L+ TI +L  ++++QH+ E+++    +KL++    M
Sbjct: 482  NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 1825 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 2004
            + +LQ+Y+  EL L    +  + + I S + ++   L+ ++ + + +   I  N+D ++ 
Sbjct: 542  KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 2005 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 2184
                 +++++     M  + VK + ++    +    E +  +  + Q +   +   L+++
Sbjct: 602  IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEM 661

Query: 2185 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 2364
            +EENNN+K+YL  HF KNN+QE+L+  ++  Y   +  ++  + +    +  H+EE++ L
Sbjct: 662  TEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNL 721

Query: 2365 IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 2544
            ++ +M +A S +ID+E+++F+P + +W  SF+ IN+CD+ + +F N     L+ +K+  D
Sbjct: 722  MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELAD 781

Query: 2545 TS-------SNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE 2700
             S       +  + E+++  +G V ++    S++K     ND       KH +L+D+ E
Sbjct: 782  NSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDIND-------KHKMLEDHFE 833

 Score =  257 bits (656), Expect = 3e-71
 Identities = 129/185 (69%), Positives = 147/185 (79%)
 Frame = +1

Query: 100 NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 279
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS EVSINTTGD GI  +MN++ YTV
Sbjct: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
           D+VFGP A Q LIF+ +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GEL+D
Sbjct: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137

Query: 460 AAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKK 639
           +AGIIPRVL +LFDTLE  +SD++VKCS+IELYNEE                    + K+
Sbjct: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEE----------LKDLLDDTPDYSKR 187

Query: 640 LRIFD 654
           LRIFD
Sbjct: 188 LRIFD 192

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 118/604 (19%), Positives = 241/604 (39%), Gaps = 29/604 (4%)
 Frame = +1

Query: 1165 NRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTAL 1344
            +R+G+ N   KE    + S+            R  HIP +  K   L +  L   +    
Sbjct: 199  SRAGSQNNSPKEQDGTSSSMAKR---------RYTHIPTKP-KRPSLNKQLLYEQSSAIY 248

Query: 1345 IATISPAKVTS-EETCSTLEYASKAKNIKNKPQLGAFMMKD------ILVKNITMELAKI 1503
            I  +    +T+  E  S L+   K + + +  ++  F  +       +L K+   EL +I
Sbjct: 249  IQNLQEFHITNAREGISVLQKGLKHRQVAST-KMNDFSSRSHTIFTIMLYKSYEGELFRI 307

Query: 1504 -KSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSR 1680
             K +L+     E I  S    +    +  S    +    R I SLA K+  +   + K  
Sbjct: 308  SKMNLVDLAGSENISRSGAQNQRAK-EAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 366

Query: 1681 ETIQSQ--NSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKR 1854
              +Q     +   +L ATI+  K   D+   + LE +     ++   ++    ++D   +
Sbjct: 367  RLLQDSLGGNTKTALIATISPAKINADET-SSTLEYATKAKNIKNRPQLGSFMMKDILVK 425

Query: 1855 EL--DLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMET 2028
             +  +L+K     +S + K     +++  ++ Q+  +    + Q  +   K +V    E+
Sbjct: 426  SISSELSKLKSDFLSTKAKE---GIYMSHEHYQEM-VNDLENYQTEIQESKRQV----ES 477

Query: 2029 MQEKAELMYKDC-VKKILNESPKF-FNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNN 2202
               +  L+ KD    + LNE        +   I+ +  + +  ++N  + +S I    + 
Sbjct: 478  FSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTI----HK 533

Query: 2203 LKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK-KLIMQNM 2379
            LK+ L  H  K + Q    H +     +I++   Q + +++ +++ HLE  K +++ +N+
Sbjct: 534  LKEAL--HTMKGSLQNYETHEL-RLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNL 590

Query: 2380 TNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQI-KKTVDTSSN 2556
            +      I+  MD     R  +  + D +    S       +M   + +I K    TS  
Sbjct: 591  S------INHNMDEI---RTIFHETLDSVRSAGS-------DMCTNIVKIVKDQPSTSYQ 634

Query: 2557 SMNESISVMKGQVEE-SENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXX 2733
               E++  +  +V+  S    + L   T+ N+  K+ + +H +  +N E           
Sbjct: 635  QFKEALGDLDTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYH 694

Query: 2734 NV----DDIYNTIEDIMTNHGNKE-----NATKD---EMIDNILKEIPNLSKRLPLRISN 2877
                  D + +++  +M +H  +      ++ KD   EMID  L+    + +R  L   N
Sbjct: 695  KSKTASDALISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFEN 754

Query: 2878 INGC 2889
            IN C
Sbjct: 755  INEC 758

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_6.16
            YEL061C
          Length = 1097

 Score =  552 bits (1423), Expect = e-179
 Identities = 288/609 (47%), Positives = 408/609 (66%), Gaps = 17/609 (2%)
 Frame = +1

Query: 925  DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1104
            D +N IYIQNLQEF+I NA +G+ LLQ+GL+HR+VASTKMND SSRSHTIFTITLYK+H 
Sbjct: 329  DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 1105 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 1284
              L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 389  GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            ESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG+F+MKD
Sbjct: 449  ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 1465 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 1644
            +L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLES+K EVQE KR  E L S+
Sbjct: 509  VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 1645 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 1824
            N  L+KDK  S E  + Q  Q+E     I  L   LD+ +K E  +     +L+ +   M
Sbjct: 569  NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 1825 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNI--------------- 1959
            Q  +++Y++R+L++ +  +  +  E K LK  L   L N+    I               
Sbjct: 629  QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIE 688

Query: 1960 -FQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRI 2136
                ++ Q N+D+++N  L +++ +QEK++ +Y  C+++IL++ P   N    +I+ I  
Sbjct: 689  AIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDF 748

Query: 2137 EFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVE 2316
            ++ + +  I ENLSD+SEE NN K+YL N F +NN++ +L +H++S    IE  +N  + 
Sbjct: 749  QYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNLLL 808

Query: 2317 NFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEF 2496
            N    +N+    N KL  + + N  + ++ +E +  +P + KW  S ++IN  D +NN F
Sbjct: 809  NINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTF 868

Query: 2497 YNNMAATLSQIKKTVDTSSNSMNESISVMK-GQVEESENAISLLKNNTKFNDQFKQLISK 2673
            +N+M   + QI   +  S N +N SI+ +K  ++ E+E    +L +NT++ +   +L  K
Sbjct: 869  HNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNINELKIK 928

Query: 2674 HIILKDNIE 2700
            ++  ++ ++
Sbjct: 929  NMDYQEKLK 937

 Score =  253 bits (645), Expect = 4e-69
 Identities = 126/184 (68%), Positives = 146/184 (79%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS EVSINT+ + GI A MN+K YTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 283 KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
           KVFGP ASQDL+F+E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GEL+D+
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 463 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 642
           AGIIPRVL KLF++ E+   DY++KCSF+ELYNE+                      KKL
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNED---------LKDLLDDSVDNTYKKL 179

Query: 643 RIFD 654
           RIFD
Sbjct: 180 RIFD 183

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 59/250 (23%), Positives = 104/250 (41%), Gaps = 13/250 (5%)
 Frame = +1

Query: 2173 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEE 2352
            L +I+ E N +K  L +   K+       H+         K+ N  +E++K  + +    
Sbjct: 511  LKNITTELNKIKSDLMSTRLKDGVYMSQQHY---------KELNNDLESYKTEVQESKRA 561

Query: 2353 NKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIK 2532
            N++LI QN +         E++  E +R + E   + I +   + +E Y      +  I+
Sbjct: 562  NERLISQNGSLLKDKKASNELN--ELQRIQIEKKNEKIKELYEILDEHYKREDILVELIR 619

Query: 2533 --KTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKF-NDQFKQLIS----------K 2673
              K V TS  S  E+      ++EES   I  L+N  KF  ++  Q++S          K
Sbjct: 620  QLKNVGTSMQSTIENYRERDLEIEESTKKI--LENEFKFLKNELSQILSNINGNIIDNLK 677

Query: 2674 HIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSK 2853
              I+ +N             N+D I NT   I+     K        I+ IL +IPN+  
Sbjct: 678  SSIISNNSSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILN 737

Query: 2854 RLPLRISNIN 2883
            +  + I++I+
Sbjct: 738  KFKIEINSID 747

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL061C
            (CIN8)
          Length = 945

 Score =  544 bits (1401), Expect = e-178
 Identities = 283/617 (45%), Positives = 414/617 (67%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            ++  +GIY+QN+QEFHI NA EG+N+LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK  
Sbjct: 242  SESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNC 301

Query: 1102 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 1281
              ELFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S HIPF
Sbjct: 302  DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361

Query: 1282 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 1461
            RESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA MMK
Sbjct: 362  RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK 421

Query: 1462 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 1641
            DILVKNI+ ELAKIKSD LSTKSK+GIYMS +HY+ + +DLE+ + E+QE KR+IESL S
Sbjct: 422  DILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS 481

Query: 1642 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 1821
            +N+LL+KDK  S+E  + QNS+++ L++TI +L  ++++QH  E E++   +KL++    
Sbjct: 482  QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT 541

Query: 1822 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 2001
            MQ +L+ Y+  EL L    +  + + I S + ++   L+ ++   + +   I+ N++ + 
Sbjct: 542  MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNIT 601

Query: 2002 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 2181
                  +++++     M    VK I      +     E +  ++ E  ++   +   L++
Sbjct: 602  TIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTE 661

Query: 2182 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 2361
            ISEENN+L++YL  H FKN+ QE+L+  ++S Y+ ++  ++Q +      +  H+EE++ 
Sbjct: 662  ISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRT 721

Query: 2362 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 2541
            L++ +M +  + +ID E  LF+P R +W  S D IN+CD+ +  F     + L ++K+  
Sbjct: 722  LMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELS 781

Query: 2542 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXX 2721
            D S  S  ++++  K + +   + +  L  +     Q   +  KH +L+D+ +       
Sbjct: 782  DASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFK 841

Query: 2722 XXXXNVDDIYNTIEDIM 2772
                  +D+  +I+ I+
Sbjct: 842  ESSKGFEDMDCSIKKII 858

 Score =  251 bits (641), Expect = 3e-69
 Identities = 120/155 (77%), Positives = 137/155 (88%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GI A+MN++ YTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 283 KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
           KVFGP A Q LIF+E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+L+D+
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 463 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
           AGIIPR++ KLFD LE   SD++VKCS+IELYNEE
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEE 173

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
            YEL061C
          Length = 939

 Score =  540 bits (1392), Expect = e-176
 Identities = 282/681 (41%), Positives = 443/681 (65%)
 Frame = +1

Query: 940  IYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR 1119
            IYIQNL+EFHI NA EG+ LLQ+GLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F+
Sbjct: 238  IYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFK 297

Query: 1120 ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLT 1299
            ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ D++ HIPFRESKLT
Sbjct: 298  ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLT 357

Query: 1300 RLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKN 1479
            RLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ +MKD+ +K+
Sbjct: 358  RLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKD 417

Query: 1480 ITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLV 1659
            +  ELAKIK DL STK K+G+YM+Q+HYK+L +DLES+K E+QEC R ++SL  +N+LL+
Sbjct: 418  LNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLL 477

Query: 1660 KDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQ 1839
            KDK  S E  + Q   +  +  T+++++  L+ QHK E  +       ++ +  M+  ++
Sbjct: 478  KDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIK 537

Query: 1840 DYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTL 2019
            +Y ++E  +    ++  + E+  LK  L   L+ + ++N+  +T+++ N+ ++K++V+++
Sbjct: 538  EYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVISI 597

Query: 2020 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENN 2199
            +   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I ++ +
Sbjct: 598  VTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQYS 657

Query: 2200 NLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNM 2379
             L +Y  N FFK+NH  ++N H+++T   IEK  +   + F+  +    E+N+KLI++N+
Sbjct: 658  KLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILENL 717

Query: 2380 TNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNS 2559
               +S +I  EM+ F+  +++W+ SF  IN CD +NN +++ M   L  +K  + +S   
Sbjct: 718  KTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDEI 777

Query: 2560 MNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNV 2739
            + + ++ +K  V+   +   LL  +    D + Q+ISK   L D+++             
Sbjct: 778  IKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLLVF 837

Query: 2740 DDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQDIISPKK 2919
            D+I  +I+    N+ +K N  +  ++   L      +   PL  +N+N    Q+ ++  K
Sbjct: 838  DEICKSIQFAFANY-SKTNLQESALLKGRL-----FADIDPLNDTNLN---KQESLTFDK 888

Query: 2920 HTIEDENPSSENADSEGSRKI 2982
               +    ++E+  S+   K+
Sbjct: 889  GDAKLTKENNEDMSSKDENKL 909

 Score =  246 bits (628), Expect = 1e-67
 Identities = 123/186 (66%), Positives = 147/186 (79%), Gaps = 2/186 (1%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGD--TGITAQMNAKRYT 276
           +E+NI VAVRCRGRN+REI  KSSV+V+VPD+ GS E+SINT+ D  +G+TAQ+N+K YT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 277 VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN 456
           VDKVFGP A+Q LIFEE+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+L+
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 457 DAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMK 636
           D+AGIIPRVL KLF+T+E Q  +YV+KCSFIELYNEE                     +K
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK---------LK 183

Query: 637 KLRIFD 654
           KLRIFD
Sbjct: 184 KLRIFD 189

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
            similar to uniprot|P27895 Saccharomyces cerevisiae
            YEL061C CIN8 Kinesin motor protein involved in mitotic
            spindle assembly and chromosome segregation
          Length = 941

 Score =  538 bits (1385), Expect = e-175
 Identities = 295/704 (41%), Positives = 445/704 (63%), Gaps = 13/704 (1%)
 Frame = +1

Query: 910  PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1089
            P   ++ ++ I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI L
Sbjct: 227  PTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 286

Query: 1090 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG 1269
            Y+K   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ 
Sbjct: 287  YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 346

Query: 1270 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 1449
            HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+
Sbjct: 347  HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 406

Query: 1450 FMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIE 1629
            F+MKD+LVKN+T EL KI+SDLL+TKSK+GIYMSQ++YK L ++LE++K EVQECKR IE
Sbjct: 407  FIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIE 466

Query: 1630 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 1809
             L+++N LL K+K  + E  +SQ  +++ L   I+ L  ++D+QHK E E+S    +L +
Sbjct: 467  RLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMR 526

Query: 1810 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQ--QKNIFQETDIQP 1983
                MQ +L+ Y+ +      + E  + + I S K +L  +++ ++  +++ F   D+  
Sbjct: 527  ALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGF---DVDA 583

Query: 1984 NLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNI 2163
            N+D +  E+  + + +      + +  + KI  ++P +   I  +++ I     ++  ++
Sbjct: 584  NIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDL 643

Query: 2164 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDH 2343
              +LS ISEE N+LK YL  HFFKNN Q+ L+ H+D TY  ++   N      +  +N+ 
Sbjct: 644  MMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEE 703

Query: 2344 LEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLS 2523
            LE NK+++MQ++ NA S V+ +EM L +P +  WE+S + IN+CD +N+ F  ++ + + 
Sbjct: 704  LETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVR 763

Query: 2524 QIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEX 2703
             + + ++        ++      +   ++A   L+ +       +++  KH +LK  ++ 
Sbjct: 764  DVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQD 823

Query: 2704 XXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNL-------SKRLP 2862
                         +I ++I+ ++ +    +  +++  I+ +L+++          S + P
Sbjct: 824  SASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTP 882

Query: 2863 LRISNINGCSVQDIISPKKHTIE----DENPSSENADSEGSRKI 2982
            +RI+     S   +  P+K +       E   +  A S   RKI
Sbjct: 883  MRITQGCIASSDQLSLPRKRSYSISPIREIDGNRKASSPFKRKI 926

 Score =  254 bits (648), Expect = 3e-70
 Identities = 122/155 (78%), Positives = 138/155 (89%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 282
           EELNITVAVRCRGRNE+E+  KSSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 283 KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
           +VFGP A Q LIF+ +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL++ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 463 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
           AGIIPRVL KLFD L+    DY++KCSFIELYNEE
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEE 159

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] {ON}
            complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  464 bits (1195), Expect = e-147
 Identities = 238/645 (36%), Positives = 394/645 (61%), Gaps = 1/645 (0%)
 Frame = +1

Query: 907  SPMTQNDQSNGI-YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTI 1083
            SP     +  G  YIQNL+EFHITNA EG+ LL RGLK+RQ+AS+K   +SSR+ TIFTI
Sbjct: 245  SPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTI 304

Query: 1084 TLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDR 1263
             LYK+ + E+FR+SK N VDLAG+E+ ++    NQR K+   INQ +  L +++N+L ++
Sbjct: 305  VLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEK 364

Query: 1264 SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 1443
               IPF++SKLT L++D+L GN+K+  I T+   K + +E   TLE+ +K +++K  P L
Sbjct: 365  ESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLL 424

Query: 1444 GAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKRE 1623
            G  + K+ L+K+I+ ELAK+KSDLLSTKSKEG+YMS +HY  L  DL+ HK E+ + K+ 
Sbjct: 425  GPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKV 484

Query: 1624 IESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKL 1803
            I+ L  +++ L KDK    E  + Q  +++S++ +++ +   ++KQ + E ++    +KL
Sbjct: 485  IDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKL 544

Query: 1804 QKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQP 1983
            ++    M V +  Y  RE  +  + +T  ++E+  LK+ L   L   ++  +    +I+ 
Sbjct: 545  KETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIEN 604

Query: 1984 NLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNI 2163
            NL+    E+  +++  + + + ++ DC+KK+  ESPK F+  ++ +  +       Y N+
Sbjct: 605  NLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNL 664

Query: 2164 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDH 2343
            AE LSD+SEE NNLKQY+   FFKNNH+ELL  +++ TY  ++K ++ F+  F   L  +
Sbjct: 665  AELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESY 724

Query: 2344 LEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLS 2523
            LE NK +++QN+ +ATS VI+ EM+ F P++ KWE S +LI K    +NEF       + 
Sbjct: 725  LEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVG 784

Query: 2524 QIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEX 2703
            +++ T+  +S S+ +++S MK ++ E + A ++++NN    ++F  ++ K+ ILKD +  
Sbjct: 785  KLQDTLKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNI 844

Query: 2704 XXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEI 2838
                        D + ++I ++  N    E  T      +ILKEI
Sbjct: 845  NMTSTEESIVAFDKLDDSIRNVFKN----EIDTNITGYQSILKEI 885

 Score =  106 bits (265), Expect = 1e-22
 Identities = 58/158 (36%), Positives = 91/158 (57%), Gaps = 4/158 (2%)
 Frame = +1

Query: 106 ELNITVAVRCRGRNEREIG--MKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 279
           E NI V  R +G+ + E G  ++  +++  P +   K        D  +      + + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGK------DDAVK-----REFGM 60

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEK--LYNGEL 453
           D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E   L++   
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 454 NDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
             + G+IPRVL +LFD L     D+VVKCS++E+YNEE
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEE 158

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
            YEL061C
          Length = 982

 Score =  439 bits (1128), Expect = e-137
 Identities = 286/926 (30%), Positives = 479/926 (51%), Gaps = 17/926 (1%)
 Frame = +1

Query: 112  NITVAVRCRGRNEREIGMKSSVVVNVPDIT-GSKEVSINTTGDTGITAQMNAKRYTVDKV 288
            NITVAVRCR   + E    S  ++++ D   G+    I     TG       K YT+D V
Sbjct: 9    NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 289  FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNGELN 456
            +G    Q  +F+E   P ++ F  GYN +++ YG   +GK YT+ G+    +   N E +
Sbjct: 64   YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122

Query: 457  DAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXX---Q 627
            +  G++PRVL +LF  LE   +D+++KCSF+E+YN+E                       
Sbjct: 123  ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 628  FMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLP--NT 801
              KKLRI D                           N      A++RKR+  +SLP  N+
Sbjct: 183  TGKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPPNNS 238

Query: 802  IKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPMTQNDQSNGIYIQNLQEFHITNA 981
            I                                  S  + +++ N IYIQNLQE  IT  
Sbjct: 239  ISNNTANNNRLSLSRTNSFSDY-------------SLQSSHERLNSIYIQNLQEITITEI 285

Query: 982  LEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMNLVDL 1146
             EG+ ++++GLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++ V+ 
Sbjct: 286  EEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNF 345

Query: 1147 AGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGG 1326
            AGSE  + + + N      G+ N +L +  ++IN +V+ S +  F +SKLT+LLQ++  G
Sbjct: 346  AGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDG 399

Query: 1327 NTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIK 1506
             T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ + K+ L+K ++ EL K K
Sbjct: 400  ITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTK 459

Query: 1507 SDLLSTKSKE-GIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRE 1683
            SDLLS KS + GIYM + HY  L   LES+K ++Q  K  I  L  K + +  +K    E
Sbjct: 460  SDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEE 519

Query: 1684 TIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELD 1863
              + Q  ++++L+ TI++L   L+KQ K E E+     KL  +   MQ +++ Y  +E+ 
Sbjct: 520  INERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIH 579

Query: 1864 LNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKA 2043
            L  K +    KE+  LK +L     +++ +      ++  N+D +K E+L +    Q K 
Sbjct: 580  LQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKV 639

Query: 2044 ELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKN 2223
            + +  +   ++L+ SPK+F  +   +  +    +  +   +E LSDISEE NNL  Y+ +
Sbjct: 640  KELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYIND 699

Query: 2224 HFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVI 2403
            +F K++H+EL++ +I+ TY  ++  + +F ENFK  L+ ++E+N K + +++T+ TS ++
Sbjct: 700  NFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIV 759

Query: 2404 DQEMDLFEPRRAKWE-NSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISV 2580
            + E+  F P + KWE  S ++I   +    +  N  +  L+++     ++S     ++S 
Sbjct: 760  ENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEILAKLLSESTSTSELFINNMSS 819

Query: 2581 MKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTI 2760
            +K  VE  E    +  +N     +F ++I+K+  LKD I            + D++   +
Sbjct: 820  IKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAM 879

Query: 2761 EDIMTNHGNKENATKDEMIDNILKEI 2838
            +++  N   KE+ + D +    LKEI
Sbjct: 880  QNVFKNE-MKESYSNDTL---NLKEI 901

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (REAL)
          Length = 1110

 Score =  287 bits (735), Expect = 5e-81
 Identities = 207/638 (32%), Positives = 335/638 (52%), Gaps = 56/638 (8%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235  NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 1102 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 1257
            QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295  QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 1258 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1437
            D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355  DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 1438 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESHKNEVQ 1608
            Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD    Y++ +  ++    ++ 
Sbjct: 415  QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIH 474

Query: 1609 ECKREIESLASK--NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEI 1782
              + +I+    K  N L + + L+S +  +   + + +     ++   ++ K H++ LE+
Sbjct: 475  NLREQIKKFKEKYLNQLDINNFLQSEK--EKLINIIRNFHVDFSNFNLEIQKIHRSNLEV 532

Query: 1783 SGFNNKLQKMTEVMQV--ALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQK- 1953
                     MTE+ Q     Q   +R+   N+  +  IS ++      L   L N   K 
Sbjct: 533  ---------MTEITQQRDLSQVNSRRQYTTNQNLQLEISNQVLQTLDTLQNSLMNYNSKF 583

Query: 1954 -----NIFQETDIQPNLDMVKNE--VLTLMETMQEKAELMYKDCVKKI-----------L 2079
                  + +E  +  N   VK++  + +L  T      +   + V  I           L
Sbjct: 584  SQVINGVTEELSLNVNSHKVKHDSTLESLFNTTANLLTIKMNELVSSISQSLANIRNDSL 643

Query: 2080 NESPKFFNVIVEKIDIIRIEFQNFYKNIAENL-SDISEENNNLKQYLKNHF-----FKNN 2241
            +   K  N I +       + QN  K+  +++ S I    N + Q    +        ++
Sbjct: 644  SHYNKDLNEIYQSHQRFLSKLQNDIKSCLDSIGSSILNSINEISQTCTTNLNSMNDLTSH 703

Query: 2242 HQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK-KLIMQNMTNATSAVIDQEMD 2418
            HQ +    I+  +  IEK  N+ +   K++   H +  + K   QN  + T   +D E +
Sbjct: 704  HQSVATEMIEKQHLQIEKLKNELLNERKVSNQFHKQSTRLKEYFQNHVSRTRTELDDEFN 763

Query: 2419 LF----EPRRAK-----WENSFDLINKCDSMNNEFYNNMAATLSQ----IKKTVDTSSNS 2559
             F    + +++K     W+ +  + N+     N  +++  +TL++    I +TV  +S  
Sbjct: 764  EFISKLKEKQSKLDQEIWQETESIFNETGKEVNAIHSSSISTLTENAETILQTVSHNSTV 823

Query: 2560 MNESISVMKGQVEESENAISLLKNNT--KFNDQFKQLI 2667
              + ++ +    E + N  S LK+    KF ++  Q I
Sbjct: 824  FTKDLTCLSD--EMNINISSKLKSLPIGKFLNKISQTI 859

 Score =  122 bits (306), Expect = 2e-27
 Identities = 71/166 (42%), Positives = 95/166 (57%), Gaps = 7/166 (4%)
 Frame = +1

Query: 88  HSVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAK 267
           +S    E NI V VRCR RN REI  KSSVV++     G KE+ ++       ++  + K
Sbjct: 44  NSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKK 100

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD------ 429
            Y  D+VFG  + Q+++F   A    ++ + GYNCT+  YG T TGKTYTM+GD      
Sbjct: 101 TYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGD 160

Query: 430 -EKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
            +   N  L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 161 VQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNE 206

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 100/520 (19%), Positives = 193/520 (37%), Gaps = 62/520 (11%)
 Frame = +1

Query: 1048 DFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLL 1227
            DFS+     F + + K H+  L  ++++         N  R    NQ  +   S NQ L 
Sbjct: 514  DFSN-----FNLEIQKIHRSNLEVMTEITQQRDLSQVNSRRQYTTNQNLQLEIS-NQVLQ 567

Query: 1228 TLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 1407
            TL  + N+L++ +       SK ++++           L   ++  KV  + T  +L   
Sbjct: 568  TLDTLQNSLMNYN-------SKFSQVIN-----GVTEELSLNVNSHKVKHDSTLESL--- 612

Query: 1408 SKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY-KNLNSDL 1584
                       L    M + LV +I+  LA I++D LS            HY K+LN   
Sbjct: 613  -----FNTTANLLTIKMNE-LVSSISQSLANIRNDSLS------------HYNKDLNEIY 654

Query: 1585 ESHKNEVQECKREIES-LASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQ 1761
            +SH+  + + + +I+S L S  S ++    +  +T  +  + M  L  T +H     +  
Sbjct: 655  QSHQRFLSKLQNDIKSCLDSIGSSILNSINEISQTCTTNLNSMNDL--TSHHQSVATEMI 712

Query: 1762 HKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDN 1941
             K  L+I    N+L    +V       + K+   L + F+ H+S+    L       +  
Sbjct: 713  EKQHLQIEKLKNELLNERKVSN----QFHKQSTRLKEYFQNHVSRTRTELDDEFNEFISK 768

Query: 1942 MQQK-------------NIFQETDIQPN------LDMVKNEVLTLMETMQEKAELMYKDC 2064
            +++K             +IF ET  + N      +  +     T+++T+   + +  KD 
Sbjct: 769  LKEKQSKLDQEIWQETESIFNETGKEVNAIHSSSISTLTENAETILQTVSHNSTVFTKDL 828

Query: 2065 -------------------VKKILNESPK----------------------FFNVIVEKI 2121
                               + K LN+  +                      F NVI+  I
Sbjct: 829  TCLSDEMNINISSKLKSLPIGKFLNKISQTICESCGNNSSTADPILVSIKNFQNVIISDI 888

Query: 2122 DIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKT 2301
            ++   +  +    I      +S++NN     +      +N   L +  ++   EN+    
Sbjct: 889  ELTNEKTVSLINEIVSQTKIVSDKNN-----IDLTIVNDNFNSLCSFILNDYKENV---- 939

Query: 2302 NQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDL 2421
             Q  +     L+ H E  + L  Q +   T+  I++ +++
Sbjct: 940  MQISKTQDDVLSVHCENLRSLHRQGVKTITTHNIEKPVNI 979

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
            KIP1Kinesin-related motor protein required for mitotic
            spindle assembly, chromosome segregation, and 2 micron
            plasmid partitioning; functionally redundant with Cin8p
            for chromosomal but not plasmid functions
          Length = 1111

 Score =  281 bits (718), Expect = 1e-78
 Identities = 203/622 (32%), Positives = 332/622 (53%), Gaps = 47/622 (7%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235  NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 1102 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 1257
            QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295  QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 1258 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1437
            D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 355  DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 414

Query: 1438 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH----------YKNLNSDLE 1587
            Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD               N  + 
Sbjct: 415  QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIH 474

Query: 1588 SHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQN-------SQMESLKATINHLKA 1746
            + + ++++ K    +    N+LL  +K K    IQ+ N       S+++ +  T   L  
Sbjct: 475  NLREQIKKFKENYLNQLDINNLLQSEKEKLIAIIQNFNVDFSNFYSEIQKIHHTNLELMN 534

Query: 1747 QLDKQHKAELEIS--GFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTA 1920
            ++ +Q    LE S   +N       ++ Q  LQ     +  LN  + +  S+ IK +   
Sbjct: 535  EVIQQRDFSLENSQKQYNTNQNMQLKISQQVLQTLNTLQGSLN-NYNSKCSEVIKGVTEE 593

Query: 1921 LFLQLDNMQQKN---IFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESP 2091
            L   ++  + K+   +    +I  NL M  N++  L+ ++    E+   D       +  
Sbjct: 594  LTRNVNTHKAKHDSTLKSLLNITTNLLM--NQMNELVRSISTSLEIFQSDSTSHYRKDLN 651

Query: 2092 KFFNVIVEKIDIIRIEFQNFYKNIAEN-LSDISEENNNLKQYLKN-HFFKNNHQELLNHH 2265
            + +    + +  ++ + ++   +I  + L+ I+E + N    L + +    N Q   +  
Sbjct: 652  EIYQSHQQFLKNLQNDIKSCLDSIGSSILTSINEISQNCTTNLNSMNVLIENQQSGSSKL 711

Query: 2266 IDSTYENIEKKTNQFVENFKMT--LNDHLEENKKLIMQNMTNATSAVIDQE---MDLFEP 2430
            I      I+K  N  +   +++   N  L E K+    +++   S   D+    +D  + 
Sbjct: 712  IKEQDLEIKKLKNDLINERRISNQFNQQLAEMKRYFQDHVSRTRSEFHDELNKCIDNLKD 771

Query: 2431 RRAK-----WENSFDLINKCDSMNNEFYNNMAATLS----QIKKTVDTSSNSM-NESISV 2580
            +++K     W+ +  + N+ D + N+ +++  A+L+       KTV  ++ S  N+ IS+
Sbjct: 772  KQSKLDQDIWQKTASIFNETDIVVNKIHSDSIASLAHNAENTLKTVSQNNESFTNDLISL 831

Query: 2581 MKGQVEESENAISLLKNNTKFN 2646
             +G   +  + +  L  N   N
Sbjct: 832  SRGMNMDISSKLRSLPINEFLN 853

 Score =  119 bits (299), Expect = 1e-26
 Identities = 69/158 (43%), Positives = 92/158 (58%), Gaps = 7/158 (4%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI V VRCR RN+REI  KSSVV++     G KE+ ++       ++  + K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-------EKLYNGE 450
           G  + Q+ +F   A    ++ + GYNCT+  YG T TGKTYTM+GD       +   N  
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 168

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
           L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 169 LGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNE 206

 Score = 39.7 bits (91), Expect = 0.051
 Identities = 83/434 (19%), Positives = 155/434 (35%), Gaps = 64/434 (14%)
 Frame = +1

Query: 1306 LQDSLGG-NTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNI 1482
            LQ SL   N+K + +      ++T        ++ S  K++ N          + LV++I
Sbjct: 572  LQGSLNNYNSKCSEVIKGVTEELTRNVNTHKAKHDSTLKSLLNITTNLLMNQMNELVRSI 631

Query: 1483 TMELAKIKSDLLSTKSKEGIYMSQDHY-KNLNSDLESHKNEVQECKREIESLASKNSLLV 1659
            +  L   +SD            S  HY K+LN   +SH+  ++  + +I+S        +
Sbjct: 632  STSLEIFQSD------------STSHYRKDLNEIYQSHQQFLKNLQNDIKSCLDSIGSSI 679

Query: 1660 KDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAE-LEISGFNNKLQKMTEVMQVAL 1836
               +   E  Q+  + + S+   I + ++   K  K + LEI    N L     +     
Sbjct: 680  LTSIN--EISQNCTTNLNSMNVLIENQQSGSSKLIKEQDLEIKKLKNDLINERRISN--- 734

Query: 1837 QDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQK-------------NIFQETDI 1977
              + ++  ++ + F+ H+S+        L   +DN++ K             +IF ETDI
Sbjct: 735  -QFNQQLAEMKRYFQDHVSRTRSEFHDELNKCIDNLKDKQSKLDQDIWQKTASIFNETDI 793

Query: 1978 ------------------------QPNLDMVKNEVLTL-----METMQEKAELMYKDCVK 2070
                                      N +   N++++L     M+   +   L   + + 
Sbjct: 794  VVNKIHSDSIASLAHNAENTLKTVSQNNESFTNDLISLSRGMNMDISSKLRSLPINEFLN 853

Query: 2071 KI-------------------LNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEE 2193
            KI                   L    KF N+I   I +   +  +    I   +  IS E
Sbjct: 854  KISQTICETCGDDNTIASNPVLTSIKKFQNIICSDIALTNEKIMSLIDEIQSQIETISNE 913

Query: 2194 NNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQ 2373
            NN     +       N   L N  +    ENI     Q  +     L++H E+ + L + 
Sbjct: 914  NN-----INLIAINENFNSLCNFILTDYDENI----MQISKTQDEVLSEHCEKLQSLKIL 964

Query: 2374 NMTNATSAVIDQEM 2415
             M   T+  I++ +
Sbjct: 965  GMDIFTAHSIEKPL 978

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (REAL)
          Length = 1113

 Score =  279 bits (713), Expect = 5e-78
 Identities = 202/623 (32%), Positives = 323/623 (51%), Gaps = 57/623 (9%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235  NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 1102 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 1257
            QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295  QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 1258 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1437
            D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355  DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 1438 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESHKNEVQ 1608
            Q+   + KD  +K+   E+ K+K+DL ++++K+GI+++QD    Y++ +  ++    ++ 
Sbjct: 415  QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIH 474

Query: 1609 ECKREIESLASK-------NSLLVKDKLKSRETIQSQN-------SQMESLKAT----IN 1734
              + +I+    K       N+LL  +K K    I+  +       S+++ +  T    IN
Sbjct: 475  NLREQIKKFKEKYLTQLDINNLLQSEKEKLVTVIRDFDIDYSHFYSKIQQIHYTNLELIN 534

Query: 1735 HLKAQLDKQHK-AELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSL 1911
             +  Q D  H+  + + +   N   K+++ +   L   +    + N KF   I+   + L
Sbjct: 535  QVTQQRDSSHENCQKQYTANQNMQLKISQQVLQTLNSLQNSLRNYNSKFSQVINGVTEEL 594

Query: 1912 KTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESP 2091
                    +++    +  ++  +  ++   N ++  M  +       +KD      +   
Sbjct: 595  -------TNSVNSHKVNHDSTFKSLMNTTANLLMIKMNELVLSISNSFKDFQSDFASHCN 647

Query: 2092 KFFNVIVEKIDIIRIEFQNFYKNIAEN-----LSDISEENNNLKQYLKNHFFKNNHQELL 2256
            K  N I +   ++    Q+  K   ++     L+ I+E +++    L      N+   L+
Sbjct: 648  KDLNDIYQSHKLLLRNLQSDIKKCLDSIGRSVLASINEISDSCSTNL------NSMNVLI 701

Query: 2257 NHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK------------KLIMQNMTNATSAV 2400
            N H     + IEKK ++     K   ND + E K            K   QN  + T   
Sbjct: 702  NKHESEVLKVIEKKDSE----IKKLKNDLVNERKISNEFSEQLTQLKWYFQNHVSRTRNE 757

Query: 2401 IDQEMDLF----EPRRAK-----WENSFDLINKCDSMNNEFYNNMAATLSQ-IKKTVDTS 2550
            +  E+D F    + ++ K     W  +  + N+ D   N+ Y+    +L+Q ++  ++T 
Sbjct: 758  LHDELDGFINKLKDKQLKLDQDIWHKTTSVFNQTDIAVNKIYSESILSLTQDVEGALETV 817

Query: 2551 SNSMNESISVMKGQVEESENAIS 2619
            S++       M G   E +  IS
Sbjct: 818  SHNNAAFTKNMTGLSHEMDVNIS 840

 Score =  119 bits (298), Expect = 2e-26
 Identities = 68/158 (43%), Positives = 91/158 (57%), Gaps = 7/158 (4%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI V VRCR RN+REI  KSSVV++     G KE+ ++       ++  + K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 450
           G  + Q+ +F   A    ++ + GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
           L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 169 LGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNE 206

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (REAL)
          Length = 1110

 Score =  278 bits (710), Expect = 1e-77
 Identities = 228/708 (32%), Positives = 352/708 (49%), Gaps = 30/708 (4%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 234  NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 1102 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 1257
            QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 294  QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 353

Query: 1258 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1437
            D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 354  DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 413

Query: 1438 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECK 1617
            Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD                    
Sbjct: 414  QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQL------------------ 455

Query: 1618 REIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGF-N 1794
                 L   NS+L          I  QN ++ +L+  I   K      +  +L+++ F  
Sbjct: 456  ----DLYESNSIL----------IDEQNLKIHNLRGQIKKFKG----NYLNQLDVNNFLQ 497

Query: 1795 NKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETD 1974
            ++ +K+  V++    D+     ++ K   T++      L   + LQ D  Q+ +  Q T 
Sbjct: 498  SEKEKLINVIRNFNVDFSNFNSEIQKIHHTNL-----ELMNEITLQRDLSQETSQEQYTT 552

Query: 1975 IQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFY 2154
             Q     +  +VL  + T+Q             ++N + KF  VI    + +     NF+
Sbjct: 553  SQELQTKITQQVLQTLSTLQ-----------SSLMNYNSKFSQVINGVTEELSRNV-NFH 600

Query: 2155 K----NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENF 2322
            K    +  E+L D S   N L   +K +   N     L H  D +  +  K  N+   + 
Sbjct: 601  KLKHDSALESLFDTSA--NQLT--IKLNELVNGISHSLKHFRDDSVSHYNKDLNEVYLSH 656

Query: 2323 KMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMN----N 2490
            K  L D LE + K  + ++ +   A I++              S D +N   S +     
Sbjct: 657  KQFLKD-LENDIKNCLDSIGSLIVASINEISQ-------TCTTSLDSVNSLTSNHQFVVT 708

Query: 2491 EFYNNMAATLSQIKKTVDTS---SNSMNESISVMKGQVEE--SENAISLLKNNTKFNDQF 2655
            E        + ++KK + T    SN  ++ ++ +K   +E  S+  + L     +F +  
Sbjct: 709  ELVEKQDLEIKKLKKDLITERRISNQFSQQLTRLKKYFQEHVSKTRVELYDEFNEFINNL 768

Query: 2656 KQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDN---I 2826
            K+  SK  + +D               V++IY    D +T+      AT   +  N   +
Sbjct: 769  KEKQSK--LDQDIWHKTAAIFNETDNEVNEIYT---DSITSLTQSAKATLQVVSQNSATL 823

Query: 2827 LKEIPNLSKRLPLRISN-INGCSVQDIISPKKHTI----EDENPSSEN 2955
             K++  LS+++ L IS+ +    ++  +S    TI     D N S+ N
Sbjct: 824  HKDLTCLSQKMSLNISSKLKSLPIETFLSKISQTICQSCGDNNMSTAN 871

 Score =  120 bits (301), Expect = 7e-27
 Identities = 69/166 (41%), Positives = 95/166 (57%), Gaps = 7/166 (4%)
 Frame = +1

Query: 88  HSVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAK 267
           +S    + NI V VRCR RN+REI  KSSVV++     G KE+ ++       ++  + K
Sbjct: 43  NSAATSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKK 99

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD------ 429
            Y  D+VFG  + Q+ +F   A    ++ + GYNCT+  YG T TGKTYTM+GD      
Sbjct: 100 TYQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGD 159

Query: 430 -EKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
            +   N  L + AGIIPRVL+ LF  L     +Y VK +F+ELYNE
Sbjct: 160 VQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNE 205

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YBL063W
            (KIP1)
          Length = 1129

 Score =  276 bits (707), Expect = 3e-77
 Identities = 201/612 (32%), Positives = 325/612 (53%), Gaps = 40/612 (6%)
 Frame = +1

Query: 916  TQNDQSNG--IYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT- 1086
            T     NG  I+++ ++E +I +A EGL LL  G   R+VA+TK ND SSRSHTIFTIT 
Sbjct: 241  TDRTSPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITT 300

Query: 1087 ----LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 1254
                ++    ++  ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL
Sbjct: 301  NVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL 360

Query: 1255 VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
            VD S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN 
Sbjct: 361  VDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNT 420

Query: 1435 PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQEC 1614
            PQ+   M K+  +     E+ +++ +L ++ SKEGIY++Q+ ++      ES+   V+E 
Sbjct: 421  PQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFET----YESNSILVEEQ 476

Query: 1615 KREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFN 1794
            + +I++L  +   L +  L+  + I+ ++ Q++ L       +  L++     + I+G +
Sbjct: 477  QAKIDNLQEQLRRLKEKFLEQTKLIKEKDGQIKELDVA---NRKYLEQSKDLTIYINGIH 533

Query: 1795 NKLQKMTEVMQVALQDYKKRELDL---NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQ 1965
            +K           L+DY+   + +   N K    I+    ++   L  ++D+++  N+  
Sbjct: 534  SK-----------LEDYEHTMIGIHNNNMKLLEDINDNRGNIHEDLLAKVDHIETCNLII 582

Query: 1966 ETDI----------QPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVE 2115
              +I          Q   D  K  +  + E +QEK   + +   +  L+    F +   E
Sbjct: 583  SREITSLISIRNVLQAYSDRFKTVLGGVFEELQEKLTQVGRTTEESQLDVDLSFVDEKFE 642

Query: 2116 KI-DIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIE 2292
            ++ DII+   +N  + + E++S++  E  +L          ++   LL     + +  ++
Sbjct: 643  EVTDIIKATCENLVRTMDEHVSNMKLETTDL---------TSSCASLLEKECQALHGKLQ 693

Query: 2293 KKTNQFVENFKMTLNDHLEE------NKKLIMQNMTNAT-SAVIDQEMDLFEPRRAKWEN 2451
            K    +VE+ K  LN  L+E       K   M N+   T   +I  + +L     ++   
Sbjct: 694  K----YVESMKQELNSTLQEMVRDLDMKASSMLNVVQCTKDGLISHKKELEADLESQKRE 749

Query: 2452 SFDLINKCDSMNNEFYNNMAATLSQ---------IKKTVDTSSNSMN--ESI-SVMKGQV 2595
             FD+    +    +        + +         +K+ V+T     N  ESI S +KG +
Sbjct: 750  HFDIAQTMEEQLQKIVGKERQNIQESMKASYDFLMKQMVETELRQKNFEESIVSKVKGLL 809

Query: 2596 EESENAISLLKN 2631
              S N +S + +
Sbjct: 810  SHSNNGMSKMSS 821

 Score =  131 bits (329), Expect = 3e-30
 Identities = 78/162 (48%), Positives = 98/162 (60%), Gaps = 8/162 (4%)
 Frame = +1

Query: 106 ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDK 285
           E NI V VRCR RNEREI  KSSVV++     G +EV +   G TG     + K YT D+
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNG-REVILTNPG-TG-----SNKTYTFDR 104

Query: 286 VFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE----- 450
           VFG  + Q+ +F +VA     + I+GYNCTV  YG T TGKTYTM+GD  +         
Sbjct: 105 VFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPN 164

Query: 451 ---LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
              L++ AGIIPRVL++LF  L     DY VK SF+ELYNE+
Sbjct: 165 FVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEK 206

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
            YBL063W
          Length = 1232

 Score =  272 bits (696), Expect = 2e-75
 Identities = 232/789 (29%), Positives = 390/789 (49%), Gaps = 98/789 (12%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            N   + I ++ ++E +I +A EGL LL  G   R+VASTK+ND SSRSHTIFTI      
Sbjct: 334  NCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTK 393

Query: 1102 QDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
             D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVDRS
Sbjct: 394  VDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRS 453

Query: 1267 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1446
             HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+ 
Sbjct: 454  HHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQIN 513

Query: 1447 AFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESHKNEVQECK 1617
              + KD  +     E+ +++++L   ++KEGIY++QD    Y++ +  +   K ++   +
Sbjct: 514  QSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQLDLYESNSILITEQKAKIDNME 573

Query: 1618 REIESLASK------NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELE 1779
             +I+   +K      ++ ++ +KL+  E    + S  E  K  I+     L K+++   +
Sbjct: 574  DQIKRFKAKYVEETESNRILLNKLEQSEDANQKLS--EKTKVIIS-----LFKRYQENFK 626

Query: 1780 ISGFN-NKLQKMTEVMQVALQDYKKRELDLNKK-----------FETHISKEIKSLKTAL 1923
            I   N N++      +  +LQ++K + LDL  K            E   ++++ +LK +L
Sbjct: 627  IFNSNINQIHSSNLEVFDSLQNHKDK-LDLCSKKNIKTLKEIYIAEEKYTEQLNTLKASL 685

Query: 1924 ------FLQL-----DNMQQKNIFQETDIQP-----NLDMVKNEVLTLMETMQ------- 2034
                  F+ +     D M+  +I  E +++      +L MV  E+  + ET++       
Sbjct: 686  SSYSDRFMLVFSSVFDEMENNSIEFERNVKSKLSSLDLTMVVEEIKNMKETVEMICNNIL 745

Query: 2035 ---EKAELMYKDCVKKILNESPKFFNVIVEK-------IDIIRIEFQNFYKNIAENLSDI 2184
               +  +  YK+     L      FN++  K       +D    +FQN  K+   N  ++
Sbjct: 746  IASDTWDSSYKEVYNSHLMTLKNCFNMVEHKCANINQLMDENFSKFQNDIKSGVHNYKNV 805

Query: 2185 SEENNN---------------LKQYL-----KNHFFKNNHQELLNHHIDSTYENIEKKTN 2304
            S ++ N               LK+ +      +   ++   +++++  D   ++  K T 
Sbjct: 806  SSDHTNDMKHTIYEQSLEIEKLKEKIIIEQQNSKSVESRLNKVIDYFEDEILKSRRKITT 865

Query: 2305 QFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSM 2484
              ++  K +  DHLE +K+++ + ++   +   +++ DL +            IN   S 
Sbjct: 866  DLIDTLKQSEKDHLELDKQILNRTLSGLRNFENEKQSDLQKS-----------INALTSK 914

Query: 2485 NNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQL 2664
             ++ + N++    Q+  T+D +S ++  +I         S   I L+     + +Q K  
Sbjct: 915  FSDVFKNVSLVAEQLPLTIDLTSENLLTTIDEFLKTSPISTELIELVDLVRSYTEQSK-- 972

Query: 2665 ISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTN--HGNKENATK---------DE 2811
             SK I+  D +E           +V          +TN     KE  T+         D+
Sbjct: 973  -SKPIL--DLLEQLNETRKLMLGDVSMHLKDQISSLTNFTREKKEKFTESNVMASNFIDQ 1029

Query: 2812 MIDNILKEIPNLSKRLPLRISNI---NGCSVQDIIS-----PKKHTIEDENPSSENADSE 2967
             I  IL +  +   ++P   +N+   N  +++ II+      K+  I + +  S++  S 
Sbjct: 1030 FIKYILTDYKDNMTQIPKSQNNVIVDNTNTIETIINSMNELKKESNINEYSDKSKDLVST 1089

Query: 2968 GSRKIPKTE 2994
              R +P  E
Sbjct: 1090 FKRNLPVLE 1098

 Score =  110 bits (276), Expect = 7e-24
 Identities = 74/215 (34%), Positives = 100/215 (46%), Gaps = 63/215 (29%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEV----------------SINTTGDTG 243
           NI V VRCR R +REI  KSSVV++     G+K +                S  T  +T 
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 244 ITAQM-----------NAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYG 390
           +   +           N + YT DKVFG  + Q+ +FE VA     + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 391 MTSTGKTYTMTGDEKLYNG-------ELNDAAGIIPRVLLKLF----------------- 498
            T TGKTYTM+GD  +           L + AGIIPRVL+ LF                 
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTKVNNN 230

Query: 499 ------------DTLELQQSDYVVKCSFIELYNEE 567
                       + + L+ ++Y VK SF+ELYNE+
Sbjct: 231 KNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEK 265

 Score = 33.1 bits (74), Expect = 5.1
 Identities = 41/173 (23%), Positives = 70/173 (40%), Gaps = 7/173 (4%)
 Frame = +1

Query: 2152 YKNIAENLSDISEENNNLKQYLKNHFFKNNHQ-ELLNHHID---STYENIEKKTNQFVEN 2319
            +K +++N +  + + NN K    N   KN  Q  L N       S  E   +K    + N
Sbjct: 213  FKELSKNDTITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSN 272

Query: 2320 FKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINK---CDSMNN 2490
            +K    D L  N KLI Q   N+T   I   +++ +  + K  N  D   K     S  N
Sbjct: 273  YK---TDALNSNDKLINQTSGNSTPYSITNGLNVNDKFKIKNNNLHDFDGKNVRIMSNQN 329

Query: 2491 EFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFND 2649
            +  +N   +   +K   +    S +E + ++      +E ++     +TK ND
Sbjct: 330  KSASNCNGSSITVKGMEEIYIKSAHEGLQLL------TEGSLKRKVASTKLND 376

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar to
            Ashbya gossypii ACR228C
          Length = 1134

 Score =  269 bits (688), Expect = 1e-74
 Identities = 192/593 (32%), Positives = 318/593 (53%), Gaps = 22/593 (3%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT----- 1086
            N   + I ++ ++E +I +A EGL LL  G   R+VA+T+ ND SSRSHTIFTIT     
Sbjct: 249  NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 1087 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
            ++    ++  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 309  IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 1267 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1446
             HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+ 
Sbjct: 369  QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 1447 AFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREI 1626
              M K+  +     E+ K++ +L +  +KEGIY++++ Y+      ES+   V+E + +I
Sbjct: 429  QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYET----YESNCILVEEQQAKI 484

Query: 1627 ESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQ 1806
            ++L  +     +  L+  + ++ +++Q++ +K +IN               I+ +N KL 
Sbjct: 485  DNLQEQIKRFKEKYLEQTKLVKEKDTQVKMIK-SINE-------------RITMYNKKLT 530

Query: 1807 KMTEVMQVALQDYKKRELDL---NKKFETHISKEIKSLKTALFLQLDNMQQKN--IFQET 1971
               + ++  ++DY+ +  D+   N K   +++   +S+  +L  +  +++  N  + +E 
Sbjct: 531  DYLDKLRFRVEDYEIKVNDIHNNNMKLLLNLNNNRESIYDSLISKTKHIEMSNELLLKEV 590

Query: 1972 D----IQPNLDMVKNEVLT--------LMETMQEKAELMYKDCVKKILNESPKFFNVIVE 2115
            +    I+  L        T        L E MQ    L +++ +   L      F  I++
Sbjct: 591  NGLILIRDTLKSYNERFKTVITGVFHELQEKMQHVLHLSHQNNLNLDLGYVDAKFGEIIK 650

Query: 2116 KIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEK 2295
             ++      Q+   N+ ++L+ +  E       ++N  +       L    D+ YE ++ 
Sbjct: 651  VVEECS---QSLLLNLDQSLAGMKSET------IQNAAYSTVE---LQRESDTLYERLK- 697

Query: 2296 KTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKC 2475
               +F+E  K  ++  L+   K I     +    V   + +L      K +   DL  + 
Sbjct: 698  ---EFIEKIKCEVDFSLQNVVKGIHTRGVDVIDLVRSTKDELVS---GKLKLQSDLEEQK 751

Query: 2476 DSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNN 2634
               + E  +  +     I++    +S++M  S   +K Q+EE+E   +L +NN
Sbjct: 752  QKHSEEAMDIQSCINQLIEQERRRTSDTMKASYEFLKKQMEETELRQALFENN 804

 Score =  132 bits (332), Expect = 2e-30
 Identities = 76/160 (47%), Positives = 97/160 (60%), Gaps = 8/160 (5%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI V VRCR RN REI  KSSVVV+     G + +  N +  TG     N K YT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQS--TG-----NNKTYTFDQVF 108

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA--- 462
           G  + Q+ +F++VA     + ++GYNCTV  YG T TGKTYTM+GD  +    L D    
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 463 -----AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
                AGIIPRVL++LF  L+ +  DY VK SF+ELYNE+
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEK 208

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  265 bits (677), Expect = 3e-73
 Identities = 196/629 (31%), Positives = 329/629 (52%), Gaps = 40/629 (6%)
 Frame = +1

Query: 931  SNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT-----LYK 1095
            S+ I ++ ++E +I +A +GL LL  G   R+VA+TK ND SSRSHT+FTIT     L  
Sbjct: 239  SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 1096 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHI 1275
               ++  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD + HI
Sbjct: 299  VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 1276 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFM 1455
            P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   M
Sbjct: 359  PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 1456 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESHKNEVQECKREI 1626
             KD  +     E+ +++ +L +++ K+GI ++QD +    S+   ++  K ++Q  + +I
Sbjct: 419  SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQI 478

Query: 1627 ESLASK--------NSLLVKDKLKSRETIQ--SQNSQ----MESLKATINHLKAQLDKQH 1764
            +    K         +L  + K    +TIQ  SQ +Q    +E+ ++  NH   ++ K H
Sbjct: 479  QRFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNHYIERVTKIH 538

Query: 1765 KAELEI------------SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKS 1908
             +   +            +G    ++ +TE M   + D +K   +L    +++  K  K 
Sbjct: 539  DSNTHLIQQLAQQRSELHNGSITYVKSVTEAMS-GISDQQKELSELRNVLQSYNDK-FKH 596

Query: 1909 LKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNES 2088
            + T +F +L++  +    +++ ++P   M    +L ++  +++     ++   K    ++
Sbjct: 597  VITGIFTELEDKVKDT--RKSTLEPLTSMNLRLILDMIGELRDDISTRFEMLKKPRTEDT 654

Query: 2089 PKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLK---NHFFKNNHQELLN 2259
             K F       DII   F           S I+E  +++++ L    N F  ++     +
Sbjct: 655  TKIFKA---HQDIIETCF-----------SHINEYCDSMEKVLTTSINQFQAHSLPSSFD 700

Query: 2260 HHIDSTYENIEKKTN--QFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPR 2433
               D T + +++  N  +  + + M L   + E KK   +   +        E  +   R
Sbjct: 701  IFQDKTKKELDELMNIIKTQKQYAMNLEQQIIEEKKRSKRLNIHIKELQSYFEEFVTPQR 760

Query: 2434 RAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENA 2613
            +  ++   D+I       +E    +      I   +D  SN+ NE  ++ K Q++ S + 
Sbjct: 761  QTMFQTIIDMIENSRQKQHEVDMTILNKSQAILSNMDMESNATNEK-NLQKLQIQSSNSL 819

Query: 2614 ISLLKNNTKFNDQFKQLISKH-IILKDNI 2697
              + KN  +   +F+ + SK  + L+D +
Sbjct: 820  NIIDKNLHELPQKFELMYSKEKLSLQDKL 848

 Score =  122 bits (306), Expect = 2e-27
 Identities = 72/160 (45%), Positives = 97/160 (60%), Gaps = 9/160 (5%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR-YTVDKV 288
           NI V VRCR RNEREI  KSSVV++      S ++ ++      +     AKR YT D+V
Sbjct: 60  NIKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNP----LLPLAYAKRTYTFDRV 115

Query: 289 FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN---- 456
           FG  + Q+ +F + A     + ++GYNCTV  YG T TGKTYTM+GD  +  G+L+    
Sbjct: 116 FGAESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTM 175

Query: 457 ----DAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
               + AGIIPRVL++LF  L+  +  Y VK SF+ELYNE
Sbjct: 176 VLLGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNE 214

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] {ON}
            similar to uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation
            functionally redundant with Cin8p
          Length = 1112

 Score =  264 bits (674), Expect = 7e-73
 Identities = 209/614 (34%), Positives = 323/614 (52%), Gaps = 25/614 (4%)
 Frame = +1

Query: 910  PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1089
            P      S+ I ++ ++E +I +A EGL LL  G   RQVASTK ND SSRSHT+FTIT 
Sbjct: 242  PEKNTQGSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITT 301

Query: 1090 YKKHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 1254
                 D     E  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL
Sbjct: 302  NVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL 361

Query: 1255 VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
            VD S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN 
Sbjct: 362  VDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNT 421

Query: 1435 PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESHKNEV 1605
            PQ+   M KD  +     E+ +++ +L +T++K+GIY++Q+ Y    S+   +   K  +
Sbjct: 422  PQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKYDLYESNCILVGEQKARI 481

Query: 1606 QECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLD----KQHKAE 1773
               + +I+    K    V    ++ + +Q  +   + +      L++ LD    K +  E
Sbjct: 482  DNLEEQIKRFKEKYVQQVNITKETEQKLQKIDLSYQQVWEKKQLLESSLDYLQQKCNSFE 541

Query: 1774 LEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETH----ISKEIKSLKTALFLQLDN 1941
             EI+  ++K  K+ + + V  +D    +L    ++ T     I+KE+ +LK  +   L+N
Sbjct: 542  HEITEIHHKNLKILDSI-VDERDTISEDLVQKYRYITETDHCITKELTTLKN-VKKTLNN 599

Query: 1942 MQQ------KNIFQE-TDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNES-PKF 2097
              +      K++FQE  D   NL  V  E + +++T  E     ++D     LN S  K 
Sbjct: 600  YNKSFKGVLKSVFQELQDKVINLSAVTEEQVRVVDT--EGIINSFED-----LNTSITKC 652

Query: 2098 FNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDST 2277
               +  KID   +      + +   +SD+++++  L+  L     +      L   I + 
Sbjct: 653  IGKLKVKIDFKDLLLDETSEAVQSWISDLTKQHEALQDNLVRSIGE------LQREISAR 706

Query: 2278 YENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSF 2457
            +E  E  + +  E     LN  + E +K+ ++N+ N             +  R   ENS 
Sbjct: 707  FEFTETTSKKSAE-----LNLEVLEAEKIKVKNLENN-----------LQRARIDKENSD 750

Query: 2458 DLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNT 2637
            +L+    ++   F + +  T  +I K +  + N          G+    E  +++L+N+T
Sbjct: 751  NLL---QTLQTYFQDEVTRTRREIFKDITNAVNF---------GEDRLKELELNILQNST 798

Query: 2638 KF-NDQFKQLISKH 2676
            K  +D  K    KH
Sbjct: 799  KLVSDSQKDSNLKH 812

 Score =  135 bits (339), Expect = 2e-31
 Identities = 72/161 (44%), Positives = 96/161 (59%), Gaps = 10/161 (6%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI V VRCR RN+REIG KSSVV++     G   +  N +  +  +     K YT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 450
           G  + Q+++F  VA     + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 451 ---LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
              L++ AGIIPRVL+ LF  L+ + +DY VK SF+ELYNE
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNE 214

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] {ON}
            similar to uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation
            functionally redundant with Cin8p
          Length = 1138

 Score =  258 bits (659), Expect = 7e-71
 Identities = 201/709 (28%), Positives = 351/709 (49%), Gaps = 34/709 (4%)
 Frame = +1

Query: 907  SPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 1086
            S  + +  S+ I ++ ++E +I +A EGL LL +G   R+VA+TK ND SSRSHTIFTI 
Sbjct: 257  SSTSSSSSSSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIV 316

Query: 1087 LYKKHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 1251
             +    D     +  +I K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVINA
Sbjct: 317  THVARTDPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINA 376

Query: 1252 LVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
            LV+ S HIP+R SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN
Sbjct: 377  LVEHSSHIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKN 436

Query: 1432 KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESHKNE 1602
             PQ+   + KD  +     E+ +++ +L +++ +EG+Y++Q+ Y    S+   +E  K  
Sbjct: 437  TPQVNQSLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQYDLYESNSLLVEEQKVV 496

Query: 1603 VQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQH----KA 1770
            +Q    +I+    K     K   ++    Q      ++L+     +    +K H    + 
Sbjct: 497  IQNMGEQIKRFKEKYVEQTKLSKEAHRQFQESQKVCDTLRIQKKFMLETFEKYHTTCKEH 556

Query: 1771 ELEISGFNNKLQKMTEVMQVALQDYKKRELD---LNKKFETHI---SKEIKSLKTALFLQ 1932
              +I   ++    + E ++V   +     LD   L  K  T I   S+++ SLK  L ++
Sbjct: 557  AAQIDQIHSDNISLIESLRVERNEMSTSALDNAGLISKILTTIAERSEQLTSLKADLEVR 616

Query: 1933 LDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIV 2112
            + +      F+       LD  +N +  +  +  +   L   D +++I        NV +
Sbjct: 617  ISD------FERFSSSMLLDFERNALSRINHSRDDLLSLEITDSLEQI-QAMHNSLNVTL 669

Query: 2113 EKI--------DIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQEL--LNH 2262
            + I        + I    +N  +N    L +  E+  N  + + N   K +  E+  L  
Sbjct: 670  QNIRKPWKKETEAIYYTHKNIIENCGNQLYEYVEKLENSLETIWNQLKKTSISEMGELRR 729

Query: 2263 HIDSTYENI------EKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLF 2424
            + D   ++       E++  QF+EN  +  +  L+E+ + +    +     +I +  ++ 
Sbjct: 730  YGDQYTDDALALVHKERERLQFLENELLKKSQALKESNEQLESLQSYFKHHLIKERDEIL 789

Query: 2425 EPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEES 2604
            +       NS     +  S++++ +   +  L++ K+ + T      E +S + G   +S
Sbjct: 790  QETFKALRNS---ERRHKSLDDQMFEKSSVVLARTKEQMHT------EYLSGVGGINRQS 840

Query: 2605 ENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHG 2784
             ++++ +       D+  Q   K   L    +           +V   +    D ++ + 
Sbjct: 841  SDSLTSI-------DKSLQSFKKEYALLGQQKTEKLDQLVKYRSVKHSFQEFLDKLSKYC 893

Query: 2785 NKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIE 2931
            N+ ++       N+L+ + NL+ ++     ++ G  V+ I+S  +  I+
Sbjct: 894  NERSSR------NLLQLLKNLNSQISWGAESL-GNEVKSIVSETRQKIQ 935

 Score =  126 bits (317), Expect = 9e-29
 Identities = 72/158 (45%), Positives = 92/158 (58%), Gaps = 7/158 (4%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI V VRCR RN+REI  KSSVVV+     G   +  N +           K Y  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPK----KTYMFDEVF 99

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG-------E 450
           G  + Q+ IF EVA    Q+ ++GYNCTV  YG T TGKTYTM+GD  ++          
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
           L + AGIIPRVL+ LF  L  + +++ VK SF+ELYNE
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNE 197

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
            Anc_7.387
          Length = 1186

 Score =  257 bits (657), Expect = 2e-70
 Identities = 214/732 (29%), Positives = 343/732 (46%), Gaps = 93/732 (12%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            N+ S+ I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHT+FTI      
Sbjct: 283  NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 1102 QDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
             D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 343  IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 1267 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1446
             HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403  QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 1447 AFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD----------------------- 1557
              M KD  +     E+ +++ +L +++ K+GI ++QD                       
Sbjct: 463  QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQLDLYESNGILVDEQKTKIHNME 522

Query: 1558 -----------HYKNLNSDLESHKNEVQECKREIES------------------------ 1632
                           LN +LES+  E ++  +++ S                        
Sbjct: 523  EQIQKFKEKYVRQTELNKNLESNLKENEQVTKQLRSEKYQLMDLLENYQINSNSFVQRVL 582

Query: 1633 -LASKNSLLVKDKLKSRETIQSQNSQ-MESLKATINHLKAQLDKQHKAELEIS----GFN 1794
             +   N  L+++  K R  I   ++Q M +++ T N L  Q D+  + +  +      FN
Sbjct: 583  QIHESNIALIQNLDKERNRIHHNSTQYMNNMEETFNQLSIQRDELLRLKNSLQSYNINFN 642

Query: 1795 NKLQKMTEVMQVALQDYKK------------RELDLNKKFETHISKEIKSLKTALFLQLD 1938
            + +Q +   ++  +   +K            +  +L +  E  ++K++  L        +
Sbjct: 643  DVMQSVFNELETNVVANQKETSNKLGSISLMKTFELLQNLELTLAKDLNLLNEPYLRDTN 702

Query: 1939 N--MQQKNIFQE--TDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNV 2106
            +  +  K I +E   ++      ++  + T +  +       +KD   + + E+     V
Sbjct: 703  HFLISHKTILEECYNNVHSCTKSMEGLISTQLTDLNGYLSSSFKDLEDQTIEETEDLKQV 762

Query: 2107 IVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFK---NNHQELLN--HHID 2271
            I+ +   I+     F K   E+ + ++E   +LK Y ++H  K   N  +++ N  +  +
Sbjct: 763  IISQQKKIQTLEHQFMKE-KESTNSLNENLQSLKSYFQDHVSKERSNIFKDIKNIINQAE 821

Query: 2272 STYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWEN 2451
                +++    Q  EN     N  L+E +   M ++   T A +    +  E      + 
Sbjct: 822  KKQTDLDVDILQRSENVLTQFNKGLQERQDKQMSSLLMETIASLLSINEHTEKLPFTLKE 881

Query: 2452 SFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQ--VEESENAISLL 2625
            SFD              N  +  +++K+       S NE I+ +K +  +E S N   L+
Sbjct: 882  SFD-------------RNKTSLETRVKEI--PIQKSFNEIITTVKDRTNIEVSNNLEKLI 926

Query: 2626 KNNTKFNDQFKQ-LISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENAT 2802
               TKFN +    L SK I                  ++ + + T+ D +T   N+ N  
Sbjct: 927  ---TKFNTELTSGLTSKQI------------------SIQNAFKTLHDTITEE-NQFNEN 964

Query: 2803 KDEMIDNILKEI 2838
              E I + L E+
Sbjct: 965  NLESIKSKLSEL 976

 Score =  122 bits (306), Expect = 2e-27
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 7/158 (4%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI V VRCR R+EREI  KSSVV++     G++ +  N +           K Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG-------E 450
           G  + Q+ +F + A     + + GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
           L + AGIIPRVL+ LF  L L ++DY VK SF+ELYNE
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNE 260

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
            YBL063W
          Length = 1105

 Score =  256 bits (653), Expect = 4e-70
 Identities = 210/715 (29%), Positives = 358/715 (50%), Gaps = 28/715 (3%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            +  S+ I ++ ++EF+I +A EGL LL  G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 242  SSSSSSIMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVAR 301

Query: 1102 QD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
             D     +  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 302  TDPVSNEQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNS 361

Query: 1267 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1446
             HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+ 
Sbjct: 362  QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVN 421

Query: 1447 AFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREI 1626
              M K+  +     E+ +++ +L +++ KEG+Y+++D ++      ES+   V+E K  I
Sbjct: 422  QSMSKNSCLGEYIHEIERLRQELKASRQKEGMYITEDQFQL----YESNSILVEEQKVRI 477

Query: 1627 ESLASKNSLLVKDKLK-SRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKL 1803
            +++  +   ++K K K   +T  S++++    ++ +   K  ++K   +E     F +  
Sbjct: 478  QNMEDQ---ILKFKAKYVEQTNLSKDAEKRLKQSQLLCKKLSIEKAEMSE----NFQSFR 530

Query: 1804 QKMTEVMQVALQDYKKRELDLNKKFETH----ISKEIKSLKTALFLQLDNMQQKNIFQET 1971
            Q  TE +  +++D  +  L+L +  +        K ++S      L  DN++Q       
Sbjct: 531  QTCTEYVD-SVEDIHRSNLELIRSLKDERDDLFGKSVESGNMISSLIADNIRQGK----- 584

Query: 1972 DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF 2151
                NL  + + +        + +  ++++    ++       N IV ++  I ++   F
Sbjct: 585  ----NLSKLNSSLQAYSSKYDQVSAGVFEEMESNVIFHK----NAIVGQLSSISLD--TF 634

Query: 2152 YKNIAENLSDISEENNNLKQYL--KNHFFKNNHQELLN---HHIDSTYENIEKKTNQFVE 2316
              NI    S + +  + L+ Y   +     + H+ +LN     +      ++   +  V 
Sbjct: 635  MTNIRSMHSALIKVFSELQTYRFDEKGIIFSAHRSILNQCYRRVCHFMTMLDSSFSGLVH 694

Query: 2317 NFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCD----SM 2484
              +      L+E  KL   + +     VI+ +    E    K       + K +    S+
Sbjct: 695  GLRQASELSLDEVDKL-GDSYSGRACEVIEAQKRHIEDMENKLCRKSQALEKSNAHILSL 753

Query: 2485 NNEFYNNMAATLSQI----KKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQ 2652
               F  N+    S+I    KK V+T+       +S+ +  +++S + + ++KN       
Sbjct: 754  QEYFAENIMKQRSKIFDDLKKAVETAE---GHQLSLEEDVLKKSIDTLQIVKN------- 803

Query: 2653 FKQLISKHII-LKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNIL 2829
              ++ ++H+  L +  E            V    N +  +  +HG+ +  +     ++I 
Sbjct: 804  --EMCTEHVTSLHEMAELGTSSLNSFSELVKSFRNKLSQL--SHGSTDRLSHLLATNSIT 859

Query: 2830 KEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDENPS----SENADSEGSRKI 2982
            KE+ +  K + +  S+    S+ + I      I     +    S +A SE S K+
Sbjct: 860  KELHDFKKAIVIECSDHKSQSLVEKIDELNTRISSHVEAVILESSDAISESSNKV 914

 Score =  128 bits (322), Expect = 2e-29
 Identities = 69/159 (43%), Positives = 96/159 (60%), Gaps = 7/159 (4%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           N+ V VRCR RNE+EI  KSSVV++     G + +  N  G    +   + + YT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAG----SLSHSKRTYTFDQVF 96

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG-------E 450
           G  + Q+ +F+EVA     + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
           L + +GIIPRVL+ LF  L  + ++Y VK SF+ELYNE+
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEK 195

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] {ON}
            Anc_7.387 YBL063W
          Length = 1151

 Score =  253 bits (646), Expect = 4e-69
 Identities = 204/674 (30%), Positives = 323/674 (47%), Gaps = 19/674 (2%)
 Frame = +1

Query: 916  TQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK 1095
            ++N+  + I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHTIFTIT   
Sbjct: 246  SRNNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNI 305

Query: 1096 KHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 1260
               D     +  +I K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLTLGRVINALVD
Sbjct: 306  TKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVD 365

Query: 1261 RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 1440
             S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 366  HSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQ 425

Query: 1441 LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKR 1620
            +   M KD+ +     E+ +++ +L +++ K+G+Y++Q+ +                   
Sbjct: 426  INQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF------------------- 466

Query: 1621 EIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNK 1800
                L   N +LV ++                 KA I +++ Q+ K          F  K
Sbjct: 467  ---DLYESNGILVDEQ-----------------KAKIVNMEEQIKK----------FKEK 496

Query: 1801 LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ 1980
                T +          +EL+ + K    +S ++   + +L          +IF E   Q
Sbjct: 497  YVNQTAI---------NKELETSLKNSQELSNDLLDKQASLI---------SIFGE--YQ 536

Query: 1981 PNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKN 2160
             N  + + E+ T+ E      +L+  +    +   S K+++ +VE    I    +N  K 
Sbjct: 537  SNFKLFETEINTIHENNLNLIDLISTE-RNDLQLSSQKYYDFLVETFRTI----ENQMKF 591

Query: 2161 IAENLSDISEENNNLKQYLKN----------HFFKNNHQELLNHHIDSTYENIEKKTNQF 2310
            I ++ + +S  N   K+ +            +F K    E       ST  +IE+  N  
Sbjct: 592  ILQSQTTLSSYNIKFKEVIGGVFEELEDNTINFRKKILTETQELDFSSTILSIEELDNCL 651

Query: 2311 VENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSF-DLINKCDSMN 2487
             EN ++      E+ +K I  + T+    +    +   +  R   E    DL  K +   
Sbjct: 652  QENIRVLTTPQKEQMEK-IYSSHTDIIKGLYKSTIGSSDDIRHSMEQFLQDLNLKTNDAL 710

Query: 2488 NEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQV-EESENAISLLKNNTKFNDQFKQL 2664
                      + ++K  VDT      E I  ++G++ EE E +I   +   +    FK  
Sbjct: 711  VLAKTQYLKKIEELKTLVDT----QKEQILSLEGKLTEEREKSIKTDEKIFELEQYFKNY 766

Query: 2665 ISKH-IILKDNIEXXXXXXXXXXXNVDD-IYNTIEDIMTNHGNKENATKDEMIDNILKEI 2838
            + K    + D+I             +D  + +    I+++   + N   D  + ++ ++ 
Sbjct: 767  VEKEKESVFDSISIAILSAKKKHDQIDSGVLSKCSSIISDTLTQINNVNDMSLKSLAQQS 826

Query: 2839 PNLSKRLPLRISNI 2880
             N SK L  +  ++
Sbjct: 827  VNSSKALITQFQDV 840

 Score =  124 bits (310), Expect = 6e-28
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 7/158 (4%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI V VRCR RN+REI  KSSVV++     G KEV ++   D         K Y  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLS---DPSSVLSHTKKTYIFDQVF 114

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG-------E 450
           G  + Q+++F   A     + ++GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 564
           L + AGIIPRVL+ LF  L  + ++Y VK SF+ELYNE
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNE 212

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
            YBL063W
          Length = 1142

 Score =  224 bits (571), Expect = 1e-59
 Identities = 194/714 (27%), Positives = 328/714 (45%), Gaps = 71/714 (9%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT---- 1086
            ++   + I ++ +QE  I NA+EGLNLL +G   R+V STK+ND SSRSHTIFTIT    
Sbjct: 201  KDSSDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNII 260

Query: 1087 -LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDR 1263
             L  +   E  +I K+NLVDLAGSENI +SG   +R++E G IN+SLLTLGRVINAL D+
Sbjct: 261  KLDNQTNKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALSDK 318

Query: 1264 SG------------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1371
            +                         HIP+RESKLTRLLQDSLGG TKT +IATISPAK 
Sbjct: 319  TNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKT 378

Query: 1372 TSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDL-LSTKSKEGIYM 1548
              +ET STLEYA++A +IKN P++         + +   ++ ++K +L  ST    GI++
Sbjct: 379  CLDETISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGIFI 438

Query: 1549 SQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKAT 1728
              +      S                      N +L++++                  A 
Sbjct: 439  PLEKLNYYKS----------------------NEILIEEQ-----------------NAK 459

Query: 1729 INHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKS 1908
            IN++  Q+ K          F  K  +  ++ +    D KK + + N         ++ +
Sbjct: 460  INNMTNQIAK----------FKKKFVEQIQINKQLNTDMKKSQWEKN---------QLLT 500

Query: 1909 LKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNES 2088
            +K  L + + N +Q NIFQ  +   N D  KN ++   + + ++   ++ + + +I N+ 
Sbjct: 501  IKLKLIILIVNFKQ-NIFQYLNNIENFDQNKNNII---KNLNDEKNSLFDNSI-EIFNQF 555

Query: 2089 PKFFNVIVE------KIDIIRIEFQNFYKNIAENLSD-----------------ISEENN 2199
                + ++       +ID   I+F N +K+++++L D                 ++ + +
Sbjct: 556  ISIHSNLISNKENLLQIDNSLIKFNNNFKSVSKSLFDELIKMLITFSSTTKDSILNIQIS 615

Query: 2200 NLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNM 2379
            N    + N  F+ N+  + + H D+   N +   +   ++ K  L D   +  K+I  N+
Sbjct: 616  NFNDIIDN--FQKNYYSISHDHFDNVKSNFQINLSNLDQSLKKYLIDQSSKLNKIISMNI 673

Query: 2380 TNATSAVIDQEMDLFEPRRAKWENSFDLINKC----DSMNNEFYNNMAATLSQIKKTVDT 2547
            TN  S        +F        +S ++INK     +S  N    N    +  +K+ + +
Sbjct: 674  TNLKS----YNEKIFNKIVM---DSNEIINKSLNNFNSEKNSIIENQLIEIKNLKEIILS 726

Query: 2548 SSNSMNESISVMKGQVEESENAISLLKNN--TKFNDQFKQLISKHIILKDNI-------- 2697
             ++ +  S  ++       +N IS  +N       D       ++ +L D+I        
Sbjct: 727  KNDELINSKIIINNLTSFIKNEISSKRNQLINHLKDSLDDFQRQNELLDDSILENSIQSI 786

Query: 2698 -EXXXXXXXXXXXNVDDIYNT---IEDIMTNHGNKENATKDEMIDNILKEIPNL 2847
             +           ++D++YN+     D + NH + +N    + I N +  + +L
Sbjct: 787  TKSQTIYQDHLMDSIDNLYNSNINSIDRLDNHFDDQNIQLRKKILNHIDSMESL 840

 Score =  123 bits (308), Expect = 1e-27
 Identities = 76/167 (45%), Positives = 97/167 (58%), Gaps = 16/167 (9%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI V VRCR RN++EI  KSSVVV+     G++ +  N+T         N  +Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN----- 456
           G  + Q+ IF  VA    Q+ I GYNCT+  YG T TGKTYTM+GD  +  G+LN     
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNSTKNI 118

Query: 457 ---DAAGIIPRVLLKLFDTLELQQSD--------YVVKCSFIELYNE 564
              + AGIIPRVL++LF +LE   S+        Y VK SF+ELYNE
Sbjct: 119 LLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNE 165

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa] {ON}
            weakly similar to uniprot|P32364 Saccharomyces cerevisiae
            YKL079W SMY1 not believed to act as a kinesin,
            colocalizes with Myo2p; kinesin heavy chain homolog
          Length = 649

 Score =  160 bits (405), Expect = 3e-40
 Identities = 128/369 (34%), Positives = 196/369 (53%), Gaps = 12/369 (3%)
 Frame = +1

Query: 928  QSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ- 1104
            + +GIY++ L   ++T+  E L+ +++G   R V+ST MN  SSRSH+I  I L K++  
Sbjct: 193  KDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNAL 252

Query: 1105 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD-------R 1263
            +E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VINAL          
Sbjct: 253  EENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRT 312

Query: 1264 SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 1443
            S HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+AK IKN    
Sbjct: 313  SAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKNFA-- 370

Query: 1444 GAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKRE 1623
                   IL KN       ++  L   KS+E  Y+ +       S LE    E  + + +
Sbjct: 371  -------ILNKNNLSSRNLLEQQLEELKSRETGYLLR------ISTLEKELLE-SKAQND 416

Query: 1624 IESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLK--AQLDKQHKAELEISGFNN 1797
            IE  + K      D L+  + ++   SQ+ESL   I+H    A  D     +  I    N
Sbjct: 417  IEDPSQKPLPPTPDLLEENKKLK---SQVESLAGLISHSNSGATDDPSISYDDLIQNLMN 473

Query: 1798 KLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF--QET 1971
            + + + E+ Q +L +    +++LNKKF+  ++   + + T     L++  Q+ ++  QET
Sbjct: 474  RCENVVEI-QASLDE----QVELNKKFQQSLASTTERMYT-----LEDRSQRLLYQLQET 523

Query: 1972 DIQPNLDMV 1998
             I+ N D++
Sbjct: 524  QIE-NQDLM 531

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 38/110 (34%), Positives = 66/110 (60%), Gaps = 3/110 (2%)
 Frame = +1

Query: 247 TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 426
           + Q N + +T D+VF  G++Q+ ++E VAG + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 427 DEKLYNGELNDAAGIIPRV---LLKLFDTLELQQSDYVVKCSFIELYNEE 567
            +        +  G+IPR+   + K  +T + +   + V  SF+E+Y E+
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEK 168

>Kwal_56.22407 s56 complement(113066..113392) [327 bp, 108 aa] {OFF}
            [contig 185] FULL
          Length = 108

 Score =  134 bits (336), Expect = 4e-36
 Identities = 70/108 (64%), Positives = 83/108 (76%)
 Frame = -2

Query: 1541 IPSLDFVESRSDLILANSMVIFLTRISFIMKAPSCGLFLMFLAFEAYSNVLQVSSEVTFA 1362
            +PS DFVESRSD IL +S V  L++ SFI+K P+CGLFL+FLAF AYS+VL+VSSE   A
Sbjct: 1    MPSFDFVESRSDFILTSSAVTLLSKTSFIIKLPTCGLFLIFLAFVAYSSVLEVSSEFILA 60

Query: 1361 GDIVAINAVFVLPPRES*SKRVNFDSRKGM*PLLSTSALMTLPSVSRL 1218
            G+IVAINAV V PP+ES S  VNFDSR G+  LLS S  +TLP V RL
Sbjct: 61   GEIVAINAVLVFPPKESCSNLVNFDSRNGICKLLSASEFITLPKVKRL 108

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
            YGL216W (KIP3) - kinesin-related protein involved in
            mitosis [contig 192] FULL
          Length = 479

 Score =  140 bits (352), Expect = 2e-34
 Identities = 106/340 (31%), Positives = 176/340 (51%), Gaps = 8/340 (2%)
 Frame = +1

Query: 943  YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 1122
            +++ L+EF +++  + LN +++G + R + ST +N++SSRSHTIFTI++ +K +  L  +
Sbjct: 169  FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 1123 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGH--IPFR 1284
                S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ L  R     IP+R
Sbjct: 229  IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL A    D
Sbjct: 289  DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQLNAQESLD 346

Query: 1465 ILVKNITM--ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLA 1638
               + + M  +L ++++ L     +  +    +  K  N  LE+        +RE +  A
Sbjct: 347  GKEQMVAMREQLDELQNALSQAGDQRLVREQMEKIKLTNQFLEA------RIERERKMAA 400

Query: 1639 SKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTE 1818
               +   K            +++ ++L+ T+  + + +     AE+  S           
Sbjct: 401  DYYAQWTK-----------ASNERDNLRHTLGGIVSSIQNPQAAEIRSS----------- 438

Query: 1819 VMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLD 1938
                 LQ  K+R  D+ K  ET  S+   +L++ L L  D
Sbjct: 439  -----LQALKERSTDIGKLLETDRSEFNCTLQSYLPLPND 473

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 50/192 (26%), Positives = 84/192 (43%), Gaps = 11/192 (5%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI VAVR R   ERE+    S++  V D    +    N   +T        + +  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVEDGNVIQVKDRNQKNET--------RSFHFDQCF 53

Query: 292 GPG----ASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
                  A Q  ++E+++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGSP--------E 105

Query: 460 AAGIIPRVLLKLFDTLELQQS-------DYVVKCSFIELYNEEXXXXXXXXXXXXXXXXX 618
           + GI+ R+  +LF+  E+ +S        + ++CS++E+YNE                  
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGRCRIRERAD 165

Query: 619 XXQFMKKLRIFD 654
              F++ LR FD
Sbjct: 166 KTTFVEGLREFD 177

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W
          Length = 473

 Score =  139 bits (350), Expect = 4e-34
 Identities = 101/302 (33%), Positives = 159/302 (52%), Gaps = 20/302 (6%)
 Frame = +1

Query: 943  YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 1122
            +++ LQEF + +  E L+ L++G + + V +T +N+ SSRSHTIFTI + +K    L  +
Sbjct: 169  FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 1123 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGH--IPFR 1284
                S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  L  +     IP+R
Sbjct: 229  LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL      D
Sbjct: 289  DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQLNTQETVD 346

Query: 1465 ILVKNITME---------LAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECK 1617
              V+ + M          L+++    L  +  E I ++      L + +E  +    +  
Sbjct: 347  GKVQMLAMRQQLDELQGALSRVGDQRLVREQMEKIKLTNQF---LEARIERERRAAVDYY 403

Query: 1618 REIESLASKNSLLVKDKLKSRETIQSQN-----SQMESLKATINHLKAQLDKQHKAELEI 1782
             +    +S+   LV+       ++QS +       + +LK     +  QL+  H   LEI
Sbjct: 404  SQYAQASSERDNLVQVLSSIVSSLQSFDGGKIRESLVALKQRSEEIGKQLEADH---LEI 460

Query: 1783 SG 1788
             G
Sbjct: 461  RG 462

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 44/167 (26%), Positives = 75/167 (44%), Gaps = 16/167 (9%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR------- 270
           NI V+VR R   ERE                ++ V      +  I  +  AKR       
Sbjct: 4   NIKVSVRLRKPLERE---------------SAERVIAQVVSENLIKVEQRAKREETRNFE 48

Query: 271 YTVDKVFGPGASQDL--IFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 444
           + +   +     +D   ++E++A       + GYN  +  YG T +GK++TMTG  +L  
Sbjct: 49  FDLCCTYSESLEEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL-- 106

Query: 445 GELNDAAGIIPRVLLKLFDTLELQQS-------DYVVKCSFIELYNE 564
                  GI+PR+  +LF+  E+ +S        + ++CS++E+YNE
Sbjct: 107 ------PGIVPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNE 147

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation;
            functionally redundant with Cin8p
          Length = 456

 Score =  138 bits (347), Expect = 7e-34
 Identities = 100/272 (36%), Positives = 147/272 (54%), Gaps = 23/272 (8%)
 Frame = +1

Query: 907  SPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 1086
            SP  +       ++Q++  F +    E L  L  G   R VAST+MN  SSRSH IFT++
Sbjct: 137  SPRVRETNDKKTFVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLS 196

Query: 1087 LYKKHQDELFRISKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINALVD 1260
            + ++  D   R S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ L  
Sbjct: 197  IKQQEPDGSIRESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAK 256

Query: 1261 RSGH-IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK- 1434
             S H IP+R+S LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK + 
Sbjct: 257  NSKHLIPYRDSLLTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRA 314

Query: 1435 ------PQLGAFMMKDI-LVKNITMELAKIKSDLLSTKSKEGIYMSQ-----------DH 1560
                  P +   M   +    +   EL  +KS++ S +S+  I   Q           +H
Sbjct: 315  TMNEIVPNINEDMKAAVEAAASSRKELEMLKSEMSSLQSEYNIKSEQWKTHEKLLVRFNH 374

Query: 1561 YKNLNSDLESH-KNEVQECKREIESLASKNSL 1653
               LN  LE+   NE+ +     +SL ++N L
Sbjct: 375  ITKLNDYLENQLTNEITKS----QSLQNENKL 402

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 1/108 (0%)
 Frame = +1

Query: 247 TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 426
           T +   + +  D +F   +SQ  I  E+        ++GYN  +  YG T +GKTYTM G
Sbjct: 29  TVEPPLRSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRG 88

Query: 427 DEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDY-VVKCSFIELYNEE 567
                    N   GIIP +   LFD LEL ++    V  ++ E+YNE+
Sbjct: 89  --------TNSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEK 128

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
            Ashbya gossypii ADR145C
          Length = 662

 Score =  139 bits (349), Expect = 4e-33
 Identities = 122/415 (29%), Positives = 205/415 (49%), Gaps = 19/415 (4%)
 Frame = +1

Query: 904  RSPMTQNDQSN-GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 1080
            R+ +T ++ S  G+Y+Q+     +++  E L+ +  G   R  +ST MN  SSRSH I  
Sbjct: 203  RTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVK 262

Query: 1081 ITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 1257
            I L K+   E   + S + LVDLAGSE ++++ A+    +EA  IN SL +LG VINAL 
Sbjct: 263  INLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALT 322

Query: 1258 DRSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
             +     HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+
Sbjct: 323  QKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIE 382

Query: 1429 NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQ 1608
            NK  +      D+ +K       K++  +   + +E                + ++N + 
Sbjct: 383  NKAIVN---RSDLFLKK------KLERQIALLEKRE----------------QEYQNRIT 417

Query: 1609 ECKREIESLASKNSLLVKDKLKSRETIQSQN----SQMESLKATINHLKAQLDKQHKAEL 1776
              + E+ +L + N   ++      E I+++N    +QM+SLK+ ++   +   +QH   +
Sbjct: 418  LLEHEVLALRANN---IRAPSPDTEDIETENTKLKAQMDSLKSILSSGGSLEGEQH---I 471

Query: 1777 EISGFNNKLQKMTEV---MQVALQDY------KKRELDLNKKFETHISKEIKSLKTAL-F 1926
                  +KL +  E+   +Q  L D        KR +D  +  E  + ++   L   L  
Sbjct: 472  STDDLLSKLMEKCELVVDLQARLDDQLDKETALKRMMDDLRLLEAQVIEKNHDLAEQLAI 531

Query: 1927 LQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESP 2091
            LQLDN+   N  +   +  ++  V   + T  E +Q     + +    ++ NESP
Sbjct: 532  LQLDNLNLTN--ENVTLSKDIATVHRILKTRAERIQVLESTVRELSDIRLGNESP 584

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 4/113 (3%)
 Frame = +1

Query: 241 GITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM 420
           G+  +  ++ +  D VFG  ++QD +++ VA  +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 421 TGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQS----DYVVKCSFIELYNEE 567
            G          D  G+IPR+  ++F+ + L +S    +YVV  SF+E+Y E+
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEK 181

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YKL079W
            (SMY1)
          Length = 635

 Score =  138 bits (348), Expect = 4e-33
 Identities = 116/365 (31%), Positives = 181/365 (49%), Gaps = 14/365 (3%)
 Frame = +1

Query: 904  RSPMTQNDQSN-GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 1080
            R+ +T ++ +  G+Y++      +++  E LN +  G   R   ST MN  SSRSH I  
Sbjct: 176  RASLTVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVK 235

Query: 1081 ITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 1257
            I L K+   E   + S + LVDLAGSE + ++ A+    +EA  IN SL +LG VINAL 
Sbjct: 236  INLLKRDNLEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALT 295

Query: 1258 --DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
              ++  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IKN
Sbjct: 296  QKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKN 355

Query: 1432 KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE 1611
            K  +      D+ +K       K++  +   + KE  Y ++         +E  ++EV  
Sbjct: 356  KAIVN---KSDLFLKK------KLERKIAQLEKKEQDYKTR---------IELLEHEV-- 395

Query: 1612 CKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGF 1791
              +E+++ AS   L  +  L +  T     +Q++SLK  +N     LD +    + +   
Sbjct: 396  --KELQATASHRPLPEEVDLLAENT--KLRAQVDSLKVLLNPRTDSLDTEQ--HISVDDL 449

Query: 1792 NNKLQKMTEV---MQVALQD-------YKKRELDLNKKFETHISKEIKSLKTALFLQLDN 1941
              KL +  E+   +Q  L D        KK   DL       + K  +  +     QLDN
Sbjct: 450  LTKLMEKCELVVELQSRLDDQADKEKALKKLMTDLKHTEAQLVEKNHQLAEQLAIAQLDN 509

Query: 1942 MQQKN 1956
            +   N
Sbjct: 510  LNLTN 514

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = +1

Query: 262 AKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 441
           A+ +  D VFG  A Q+ +F+ VA  +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPP--- 113

Query: 442 NGELNDAAGIIPRVLLKLFDTLELQQS----DYVVKCSFIELYNEE 567
                   G+IPR+  ++F+ + L ++    +YVV  SF+E+Y E+
Sbjct: 114 -----GHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEK 154

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
            similar to uniprot|P53086 Saccharomyces cerevisiae
            YGL216W KIP3 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 504

 Score =  135 bits (340), Expect = 1e-32
 Identities = 99/290 (34%), Positives = 155/290 (53%), Gaps = 11/290 (3%)
 Frame = +1

Query: 943  YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ----DE 1110
            +++ L EF +    E L  +++G + R V  T MN+ SSRSH IFTI++ +       D 
Sbjct: 198  FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 1111 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DRSGHIPFR 1284
              R S + LVDLAGSE ++ +GA   R KE  +IN+SL TLGRV++ L   +R   IP+R
Sbjct: 258  TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            +S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN           
Sbjct: 318  DSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKN----------- 364

Query: 1465 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKRE--IESLA 1638
                      A++ S   S K+KE               L + +N+++E ++E  ++S+ 
Sbjct: 365  ---------TARVNSS-ESLKNKE--------------QLVTMRNQLEELQKELSLQSVK 400

Query: 1639 SKNSLLVKD---KLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELE 1779
             +N  L+++   K+K       +  + E+  AT  H +     + KA+LE
Sbjct: 401  LQNQELLREQINKIKCTNAYLEKRIEQEAAFATKYHERWDKITREKAQLE 450

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 51/173 (29%), Positives = 77/173 (44%), Gaps = 21/173 (12%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI VAVR R    RE G      V  P     ++  I+T+           K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 292 ----GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE---KLYNGE 450
                    Q++I++ +        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 451 L-------NDAAGIIPRVLLKLFDTLELQQSD-------YVVKCSFIELYNEE 567
                   + A GIIPRV   LFD   +  S+       + + CS++E+YNE+
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQ 175

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
            Anc_3.528 YGL216W
          Length = 847

 Score =  136 bits (342), Expect = 6e-32
 Identities = 140/577 (24%), Positives = 249/577 (43%), Gaps = 26/577 (4%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D    I + NL         E ++ + RG  +R  + T  N+ SSRSH +  I + + 
Sbjct: 237  REDSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQT 296

Query: 1099 HQDELF----RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
             +          + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 297  DRTPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISD 356

Query: 1267 G-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
            G     H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK+IK 
Sbjct: 357  GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKT 416

Query: 1432 KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE 1611
            K       +   +   + M + + K ++   + +E   M   H K      E  +  +++
Sbjct: 417  KIIRNQQSLNRHVGSYLKM-ITEQKKEIQELRHREN-NMIDLHLKKYKLGREKVELAIED 474

Query: 1612 CKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGF 1791
            C ++I     KNSLL   K ++   I+S       L   +N             LEIS  
Sbjct: 475  CIQKI-----KNSLLQTPKFQNTRIIKSLILCKRRLLQLVN-------------LEISEV 516

Query: 1792 NNKLQKMTEV-----MQVALQDYKKRELDLNKKFETHISKEI-----KSLKTALFLQLDN 1941
               ++  T+V      ++  +   K+  +L ++F+T    EI     K+++     +++ 
Sbjct: 517  LEAVEDWTDVAIVENCRIIQEQLNKKTKELEEQFDTPAELEIIIENAKTIEKQRLSEMEF 576

Query: 1942 MQQKNIFQETDIQPN--LDMVKNEVLT----LMETMQEKAELMYK-DCVKKILNESPKFF 2100
                N     DI+ N   ++++N++L       E++ E  +L+ K   + K L+      
Sbjct: 577  WDPANDAYNFDIKLNYIAELIRNDILVKASMFTESLFENRKLISKFKFLSKCLSSKQDIH 636

Query: 2101 NVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTY 2280
              + + +DI + EF  F K +      +S EN+N+  +                   S +
Sbjct: 637  ECLKDLLDIDK-EFDIFGKEL------MSYENSNITGF-------------------SDF 670

Query: 2281 ENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFD 2460
            EN   K N + +   ++  +++       ++N     + ++        P  +K+ N   
Sbjct: 671  ENRISKANDYTKTSIVSEANNVPPVNITNLKNSPTVANKIVTHNNSETPPSISKFPNKLK 730

Query: 2461 LINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNES 2571
                        YN  ++ LS+ KK       S NE+
Sbjct: 731  ------------YNKYSSPLSEKKKITAAKRISKNEN 755

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F   A+Q  ++      L    + G+N TV  YG T  GKT+T++G       
Sbjct: 127 KFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGTP----- 181

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
              +  GII   + +LF  +E      +  +  S++E+YNE
Sbjct: 182 ---EQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNE 219

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
            Anc_3.528
          Length = 868

 Score =  135 bits (339), Expect = 2e-31
 Identities = 134/492 (27%), Positives = 236/492 (47%), Gaps = 30/492 (6%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D+ + I + NL   +  +  + ++L+ RG  +R  +ST+ N+ SSRSH +  I + + 
Sbjct: 300  REDKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQT 359

Query: 1099 HQD----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
            +           + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   +
Sbjct: 360  NTKIDLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPT 419

Query: 1267 G---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 1419
                      HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 420  NNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 479

Query: 1420 NIKNK---PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLE- 1587
             IK K    Q          +K IT +  +I++  L T+  + I ++ + YK     ++ 
Sbjct: 480  EIKTKIIRNQQSLNRHVGSYLKMITEQKREIEN--LRTREAQMIELNLNRYKLSRKKIQI 537

Query: 1588 SHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHK 1767
            S  + +    R I  L ++    VK+ LKS    + +  QM SL+  +N+    + +   
Sbjct: 538  SMDDVINNLNRNI--LENEKYKQVKN-LKSLILCKRRFLQMVSLE--LNNCLNVISEDGG 592

Query: 1768 AELEISGFNN----KLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQL 1935
              + ++ +NN      Q   +V ++ L+   K ELD+       I    KS+      ++
Sbjct: 593  DTINLNCYNNCSTLIKQIGNKVQELELKFDTKDELDM-------IIDHCKSMDLNRLKEM 645

Query: 1936 DNMQQKN--IFQETDIQPNLDMVKNEVLTLMETMQEKA---ELMYKDC--VKKILNESPK 2094
            +N       I  ET ++   + +KNE+L     M EK    + + + C  V   L     
Sbjct: 646  ENWDDSRDLINFETRLEYISESIKNEILISASMMIEKLFQNDTLMRRCKFVSGCLTTEQP 705

Query: 2095 FFNVIVEKIDIIRI--EFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHI 2268
              ++ +E  D+++I  +F+ F + +   L+DI +   N+       +   N ++ +  H 
Sbjct: 706  ERSMEIEINDLVKIDEDFEEFSRLL---LNDIEDGTANIHLSQNPLYSNENKEKNMETHY 762

Query: 2269 DSTYENIEKKTN 2304
            D  Y N   +T+
Sbjct: 763  DLEYSNGTNETD 774

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 2/107 (1%)
 Frame = +1

Query: 250 AQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 429
           A+ N  ++  DK+F   +SQD ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 430 EKLYNGELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
           +        +  GII RV+ +LF+ +E    +  + +  S++E+YNE
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNE 282

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
            KIP3Kinesin-related motor protein involved in mitotic
            spindle positioning
          Length = 805

 Score =  132 bits (333), Expect = 7e-31
 Identities = 130/460 (28%), Positives = 213/460 (46%), Gaps = 31/460 (6%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  N I + NL   H     + ++L+ +G  +R  + T+ N+ SSRSH +  I + + 
Sbjct: 262  REDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQT 321

Query: 1099 HQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 1257
            ++          + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 322  NKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 1258 -DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
              RS HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382  GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

Query: 1435 ---PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEV 1605
                Q          +K IT +  +I+   L  + ++ I +    YK LN   E  +  +
Sbjct: 442  IIRNQQSLSRHVGSYLKMITEQKRQIEE--LREREEKMISLKLTKYK-LNK--EKIQLAI 496

Query: 1606 QECKREI-ESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELE- 1779
             EC   + ++ A   +  V   LKS    + +  QM  L+     L  + ++   AE++ 
Sbjct: 497  NECVNRVQQTYAGVETYQVAKTLKSLILCKRRFLQMVKLEVDNLILLFEREESTAAEMQP 556

Query: 1780 -------ISG-FNNKL----QKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTAL 1923
                   ISG   NK+     K  E   ++   ++   +DLNK  E     E   L    
Sbjct: 557  VISNCRMISGQLYNKIHELEMKFDETDTLSSVIHQVHSIDLNKLREMEDWDETYDL---- 612

Query: 1924 FLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEK------AELMYKDCVKKILNE 2085
                       ++ E+ +    ++ +NE+L     M EK          +K   K ++N 
Sbjct: 613  -----------VYLESCLNQISELQRNEILVNSSIMTEKLMSDPGLNSRFKFLSKWLMNR 661

Query: 2086 SPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNL 2205
            +P   ++I + + I   EF++F +    N  D +  N N+
Sbjct: 662  TPNIESIIQDLVHIDE-EFESFARTFIAN-PDSNFTNTNI 699

 Score = 61.6 bits (148), Expect = 9e-09
 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F   +SQ  +++E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP----- 206

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
                 GII   + +LF+ +     + D+ +  S++E+YNE
Sbjct: 207 ---SQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNE 244

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  130 bits (327), Expect = 4e-30
 Identities = 113/438 (25%), Positives = 211/438 (48%), Gaps = 20/438 (4%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  + I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH +  I + + 
Sbjct: 262  REDTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQT 321

Query: 1099 HQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 1257
            ++          + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 322  NKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 1258 -DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
              RS HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382  GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

Query: 1435 ---PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEV 1605
                Q          +K IT +  +I+   L  + ++ I +    YK LN   E  +  +
Sbjct: 442  IIRNQQSLSRHVGSYLKMITEQKRQIEE--LREREEKMISLKLTKYK-LNK--EKIQLAI 496

Query: 1606 QECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEIS 1785
             EC   ++   S        K+  +  I  +   ++ ++  +++L    +++ +   E+ 
Sbjct: 497  NECINRVQQTYSAVETYQISKI-LKSLILCKRRFLQMVRLEVDNLILLFEQEERVAAEMQ 555

Query: 1786 GFNNKLQKMTEVMQVALQDYKKRELDLNKKFETH-ISKEIKSLKTALFLQLDNMQQKN-- 1956
               N  + ++E +        + E+  ++    H + +++ S+      ++++  +    
Sbjct: 556  LVINNCRMISEQL---FNKIHELEVKFDESDALHSVIQQVHSIDLNKLREMEDWDETYDL 612

Query: 1957 IFQETDIQPNLDMVKNEVLTLMETMQEK------AELMYKDCVKKILNESPKFFNVIVEK 2118
            ++ E+ +    ++ +NE+L     M EK          +K   K +++ +P   ++I + 
Sbjct: 613  VYLESCLNQISELQRNEILVNSSIMTEKLMSDPGLNSRFKFLSKWLMDRTPDIESIIQDL 672

Query: 2119 IDIIRIEFQNFYKNIAEN 2172
            + I   EF+ F KN   N
Sbjct: 673  VHIDE-EFELFAKNFLAN 689

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F   +SQ  +++E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP----- 206

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
                 GII   + +LF+ +     + ++ +  S++E+YNE
Sbjct: 207 ---SQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNE 244

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  130 bits (326), Expect = 5e-30
 Identities = 118/441 (26%), Positives = 214/441 (48%), Gaps = 23/441 (5%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  N I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH++  I + + 
Sbjct: 262  REDTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQT 321

Query: 1099 HQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 1257
            ++          + ++++DLAGSE  + +     R  E  +IN+SLL LG  INAL    
Sbjct: 322  NKLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 1258 -DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
              R+ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382  GSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

Query: 1435 ---PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEV 1605
                Q          +K IT +  +I+   L  + ++ I +    YK LN   E  +  +
Sbjct: 442  IIRNQQSLSRHVGSYLKMITEQKRQIEE--LREREEKMISLKLTKYK-LNK--EKIQLAI 496

Query: 1606 QECKREI-ESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEI 1782
             EC   + ++ ++  +  V   LKS   I  +   ++ +K  +++L     ++ +   E+
Sbjct: 497  NECINHVQQTYSTVETYQVAKILKS--LILCKRRFLQMVKLEVDNLTLLFQQEERIGTEM 554

Query: 1783 SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKN-- 1956
                +  + ++E +       K  EL++       ++  I+ + +    +L  M+  +  
Sbjct: 555  QPVISNCRLISEQL-----FNKIHELEVKFDETDALNSVIQQVHSIDLNKLREMEDWDET 609

Query: 1957 ---IFQETDIQPNLDMVKNEVLTLMETMQEK------AELMYKDCVKKILNESPKFFNVI 2109
               ++ E  +    ++ +NE+L     M EK          +K   K +++ +P     I
Sbjct: 610  YDLVYLEACLNQISELQRNEILVNSSIMTEKLISDVRLNSRFKFLSKWLMDRTPD-IEFI 668

Query: 2110 VEKIDIIRIEFQNFYKNIAEN 2172
            ++ +  I  EF++F KN   N
Sbjct: 669  IQDLVHIDEEFESFAKNFIAN 689

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F   +SQ  +++E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP----- 206

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
                 GII   + +LF+ +     + ++ +  S++E+YNE
Sbjct: 207 ---SQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNE 244

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
            Anc_3.528
          Length = 784

 Score =  129 bits (325), Expect = 6e-30
 Identities = 128/471 (27%), Positives = 220/471 (46%), Gaps = 46/471 (9%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D +N I + NL   +     E ++L+ +G  +R  + T+ N+ SSRSH +  I + + 
Sbjct: 260  REDGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQT 319

Query: 1099 HQD----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL---- 1254
            ++          + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 320  NRTADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTD 379

Query: 1255 --VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
               +RS HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 380  GGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 1429 NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQ 1608
             K           +++N                            ++LN  + S+   + 
Sbjct: 440  TK-----------IIRN---------------------------QQSLNRHVGSYLKMIT 461

Query: 1609 ECKREIESLASKNSLLVKDKLK----SRETIQ-SQNSQMESLKATINHL-KAQLDKQHKA 1770
            E KREIE L  + + +++ +L+    SRE IQ +Q+  ++++  + + L K ++ K  K+
Sbjct: 462  EQKREIEELRERETKMIELQLRKYKISRERIQMAQDDCIQNIIKSYSTLPKYKMAKNMKS 521

Query: 1771 ------------ELEISGFNNKLQKMTEVMQV-----ALQDY---KKRELDLNKKFETHI 1890
                        +LEI    + +Q  T+   V      L +    K REL+     +  +
Sbjct: 522  LMLCKRRFLQMVKLEIENCISLIQNWTDHYMVFETCGQLNNQIMNKIRELEREFDSKDEL 581

Query: 1891 SKEIKSLKTALFLQLDNMQQKN-----IFQETDIQPNLDMVKNEVLTLMETMQEKA---E 2046
               I  ++    ++L  M+  +     I  E+ +    + ++NE+L     M EK    E
Sbjct: 582  ELVIDHVRVTDLVRLREMENWDDSTDLIIFESRLDYISESIRNEILVNASIMTEKLFQNE 641

Query: 2047 LMYKDC--VKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEE 2193
            ++ + C  +   L       NVI + I +   EF+ F K +      + EE
Sbjct: 642  ILMQRCKFLSTCLANEQNLANVIQDLIKLDE-EFEEFGKLLINEDYGVREE 691

 Score = 62.4 bits (150), Expect = 5e-09
 Identities = 33/101 (32%), Positives = 54/101 (53%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F   ASQ+ +++     L    + G+N TV  YG T  GKTYT++G       
Sbjct: 150 KFVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP----- 204

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
              +  GII RV+ +LF+ +E       + +  S++E+YNE
Sbjct: 205 ---EQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNE 242

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 809

 Score =  129 bits (324), Expect = 8e-30
 Identities = 113/430 (26%), Positives = 207/430 (48%), Gaps = 46/430 (10%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D   GI + NL         + ++L+ RG  +R  + T  N+ SSRSH +  I + +K
Sbjct: 245  REDSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQK 304

Query: 1099 HQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 1257
            ++     E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 305  NRTAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSG 364

Query: 1258 -DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
               + H+P+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK IK K
Sbjct: 365  RRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

Query: 1435 ---------PQLGAFM------------MKDILVKNITMELAKIKSDLLSTKSKEGIYMS 1551
                       +G+++            ++    K + +EL K K  L   K +  I+ S
Sbjct: 425  VIRNQHSLDRHVGSYLKMITEQRQEIEELRCRESKMVALELNKYK--LSREKLQIAIWDS 482

Query: 1552 QDHYKNLNSDLE-----SHKNEVQECKRE-IESLASKNSLLVKDKLKSRETIQSQNSQME 1713
             +  KN  S++E       K  +  CKR  ++ ++ + S L+K   +  +  ++  +  +
Sbjct: 483  INGVKNNYSNMEKLQLLKTKKSLMLCKRRFLQMVSIELSNLMKLLAQDTKIYENCMALYD 542

Query: 1714 SLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHIS 1893
             L   I  L+ + D   + ++ I     +  K  +++++   +     +DL   FE+H++
Sbjct: 543  QLINKIRDLEEKFDTSDELDMAI-----EHTKSVDLVKLQEMETWDDSVDL-PWFESHLN 596

Query: 1894 KEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVL-----------TLMETMQEK 2040
               +SL+  + +    M ++ +F++  +      V   VL             M+ + E+
Sbjct: 597  FLAESLRNEILVTASIMMER-LFEDEKLISRYKFVSRTVLEAFASKENGGADTMDMILER 655

Query: 2041 AELMYKDCVK 2070
             +   KD V+
Sbjct: 656  LDFAIKDLVQ 665

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = +1

Query: 265 KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 444
           +++  DK+F   A+Q  ++E    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 134 QKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGTP---- 189

Query: 445 GELNDAAGIIPRVLLKLFDTLE-LQQSDYV-VKCSFIELYNE 564
               +  G+I   + +LF  +E L+ S +  +  S++E+YNE
Sbjct: 190 ----EQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNE 227

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  129 bits (323), Expect = 1e-29
 Identities = 123/452 (27%), Positives = 220/452 (48%), Gaps = 25/452 (5%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  N I + NL   H T   + +NL+ +G  +R  + T+ N+ SSRSH +  I + + 
Sbjct: 262  REDTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQT 321

Query: 1099 HQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 1257
            ++          + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 322  NKLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLND 381

Query: 1258 -DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
              R+ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382  GSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

Query: 1435 ---PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEV 1605
                Q          +K IT +  +I+   L  + ++ I M    YK LN   E  +  +
Sbjct: 442  IIRNQQSLSRHVGSYLKMITEQKRQIEE--LREREEKMISMKLTKYK-LNK--EKIQLAI 496

Query: 1606 QEC-KREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEI 1782
             EC  R  +S ++  +  V   LKS   I  +   ++ +K  +++L  QL +Q   ++ +
Sbjct: 497  NECINRVQQSYSTVETYQVAKILKS--LILCKRRFLQMVKLEVDNL-VQLFQQ--GDIMV 551

Query: 1783 SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFE-----THISKEIKSLKTALFLQLDNMQ 1947
            +    ++Q +    Q+  +    +  +L  KF+       + +++ S+      ++++  
Sbjct: 552  A----EMQPVISNCQMISEQLFNKIHELEVKFDETNALDSVIQQVHSIDLNKLREMEDWD 607

Query: 1948 QKN--IFQETDIQPNLDMVKNEVLTLMETMQEK------AELMYKDCVKKILNESPKFFN 2103
            +    ++ E+ +    ++ +NE+L     M EK          +K   K +++ +P    
Sbjct: 608  ETYDLVYLESCLSQISELQRNEILINSSIMTEKLISDAGLNRRFKFLSKWLMDRTPD-IE 666

Query: 2104 VIVEKIDIIRIEFQNFYKNIAENLSDISEENN 2199
             I++ +  I  +F+ F K+   N S+     N
Sbjct: 667  FIIQDLVHIDEDFELFAKSFIANPSNTFSNTN 698

 Score = 65.5 bits (158), Expect = 6e-10
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 6/122 (4%)
 Frame = +1

Query: 217 SINTTGDTGITAQMNAK----RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLV 384
           SIN+ G     +Q        ++  DK+F   +SQ  +++E   PL    + GYN TV  
Sbjct: 131 SINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFA 190

Query: 385 YGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELY 558
           YG T  GKTYT++G             G+I   + +LF+ ++    + ++ +  S++E+Y
Sbjct: 191 YGATGCGKTYTVSGTP--------SQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIY 242

Query: 559 NE 564
           NE
Sbjct: 243 NE 244

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 769

 Score =  127 bits (319), Expect = 3e-29
 Identities = 122/468 (26%), Positives = 211/468 (45%), Gaps = 27/468 (5%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  N  ++ NL +    N  E ++L+ +G  +R  + T  N+ SSRSH +  I + + 
Sbjct: 233  REDSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQM 292

Query: 1099 H------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV- 1257
            +      QD+ F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL  
Sbjct: 293  NRTADIKQDQTF--ATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCV 350

Query: 1258 --DRSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 1422
               R+G   H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK 
Sbjct: 351  SSTRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKE 410

Query: 1423 IKNKPQLGAFMMKDILVKNITMELAKI---KSDLLSTKSKEGIYMSQDHYKNLNSDLESH 1593
            IK K        K  L +++   L  I   KS++   +S+E         K +   L   
Sbjct: 411  IKTK----VIRNKQSLDRHVGSYLKLITEQKSEIEELRSRE--------QKMIEIQLSQF 458

Query: 1594 KNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAE 1773
            +N              K ++L+K+ ++      S + +++  K   + +  +        
Sbjct: 459  RNG-----------REKVNMLIKESVREMRIHLSDSEKIQDAKLIKSLMLVKRHYLKLVH 507

Query: 1774 LEISGFNNKLQKMTEVMQVALQD----------YKKRELDLNKKFETHISKEIKSLKTAL 1923
             E+S     L  + +   V L D           K  EL++       I + ++ +KT  
Sbjct: 508  FELSNVLQYLNNLNDERAVFLTDNIHIIQEQILLKMNELEVQFDDPNDIDRTLEYMKT-- 565

Query: 1924 FLQLDNMQQKNIFQETDIQPNLDMVKNEVLT--LMETMQEKAELMYKDCVKKILNESPKF 2097
             +QL  M+    +QE      +D  + E+L   L E+++            +IL    + 
Sbjct: 566  -IQLKKMRDCEYWQEA-----IDFEQYEILISGLSESVR-----------NEILVNGTRL 608

Query: 2098 FNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNN 2241
               ++E   I+R  FQ   K+I +   +    N  +   ++    K N
Sbjct: 609  MEKVIED-PILRSHFQIISKSIVDENENTDGSNTTMVGTIERELNKLN 655

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = +1

Query: 265 KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 444
           +++  D++F    +Q  ++E    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 122 QKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG------ 175

Query: 445 GELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNEE 567
              ++  GII   + +LF  +E       + ++ SF+E+YNE+
Sbjct: 176 --TSEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQ 216

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGL216W
            (KIP3)
          Length = 818

 Score =  127 bits (319), Expect = 3e-29
 Identities = 107/393 (27%), Positives = 195/393 (49%), Gaps = 19/393 (4%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEG-LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK 1095
            + D  +   + NL  +H    +E  ++L+ RG  +R  + T  N+ SSRSH +  + + +
Sbjct: 237  REDSDSTTTVANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQ 295

Query: 1096 KHQDELFRISKM----NLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDR 1263
              +    +  KM    +++DLAGSE  + +    +R  E  +IN+SLL LG  INAL   
Sbjct: 296  SSRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMT 355

Query: 1264 SG----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
                  H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK 
Sbjct: 356  GRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKT 415

Query: 1432 KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES---HKNE 1602
            K       +   +   + M  A+ K ++   +S+E         K ++  L+     +N+
Sbjct: 416  KVIRNQHSLDRHVGSYLKMITAQ-KQEIEELRSREA--------KVIDLRLQQFRLSRNK 466

Query: 1603 VQECKRE-IESLASKNSLLVKDKLKSRETIQS----QNSQMESLKATINHLKAQLDKQHK 1767
            +Q    E +  L  K++  V D+ +  +T++S    +   ++ ++  +NHL  QL +  K
Sbjct: 467  LQMAMWEGVNQL--KSNYQVLDRFQRTKTMKSLMLCKRHFLQLVQTEVNHL-LQLTESTK 523

Query: 1768 AELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQ 1947
             +  +SGF   + +        L+D      D   +F+  + +  K    A F Q++   
Sbjct: 524  VDHPLSGFCQTINEQLLTKICELED----SFDAEDEFQLTL-EHAKEADMARFQQMETWD 578

Query: 1948 QKN--IFQETDIQPNLDMVKNEVLTLMETMQEK 2040
            +    ++ E  ++   + +KNE++     M +K
Sbjct: 579  EATDALWYEQQLEHLAESIKNEIMVNASAMMDK 611

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 32/102 (31%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 265 KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 444
           +++  DK+F   ASQ  +F+    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 126 QKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISGTP---- 181

Query: 445 GELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
               D+ GII   + +LF  +        + +  S++E+YNE
Sbjct: 182 ----DSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNE 219

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] {ON}
            Anc_3.528 YGL216W
          Length = 733

 Score =  126 bits (316), Expect = 6e-29
 Identities = 107/416 (25%), Positives = 189/416 (45%), Gaps = 42/416 (10%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  N I + NL         + ++L+  G  +R  ++T  N+ SSRSH +  I + + 
Sbjct: 238  REDSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQS 297

Query: 1099 HQ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 1260
             +      D  F  +K++++DLAGSE    +    +R +E  +IN+SLL LG  INAL  
Sbjct: 298  SRTAEITSDHTF--AKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCI 355

Query: 1261 RSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 1425
              G     H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK I
Sbjct: 356  SDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEI 415

Query: 1426 KNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEV 1605
            K K           +V+N                            ++L+  + S+   +
Sbjct: 416  KTK-----------VVRN---------------------------QQSLDRHISSYLKMI 437

Query: 1606 QECKREIESLASKNSLLVKDKLK----SRETIQ-----SQNSQMESLKATINHLKAQLDK 1758
            +E ++EI+ L  + + ++  +LK    ++E +Q       NS  ++     N+  A++ K
Sbjct: 438  EEQRQEIDELRKRETTMIDLRLKRYKLTQEKVQMAIDDCMNSLQDTYDRIPNYQNAKVVK 497

Query: 1759 Q---------HKAELEISGFNNKLQKMTEV-----MQVALQDYKKRELDLNKKFETHISK 1896
                         +LE++      Q  T +       +       +  +L  KF++   +
Sbjct: 498  SLILCKRRFLQMVQLEVNNVIAIAQNWTNIEIVNSCSLVADQLTNKIRELEIKFDSTHDE 557

Query: 1897 EIKSLKTALFLQLDNMQQKNIFQETDIQPNL--------DMVKNEVLTLMETMQEK 2040
              +++  A  + L  +++   + ET   P          D ++NE+L    TM EK
Sbjct: 558  LEQAIDHARTITLPRLREMENWNETRDHPYFEARLTQIADSLRNEILVNGSTMVEK 613

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F   A+Q+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 128 KFVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGTP----- 182

Query: 448 ELNDAAGIIPRVLLKLFDTLELQQS--DYVVKCSFIELYNE 564
              +  G+I   + +LF  +E  +    + +  S++E+YNE
Sbjct: 183 ---ERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNE 220

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
            kinesin-related protein required for nuclear migration
          Length = 705

 Score =  125 bits (315), Expect = 7e-29
 Identities = 98/348 (28%), Positives = 166/348 (47%), Gaps = 16/348 (4%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  N I + NL +   T   E ++L+ RG  +R  + T+ N+ SSRSH +  I + +K
Sbjct: 265  REDTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQK 324

Query: 1099 HQD----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
            ++     E      ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 325  NRTPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCING 384

Query: 1267 G------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
                   H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 385  NDERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 444

Query: 1429 NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQ 1608
             K           +++N                            ++LN  + S+   + 
Sbjct: 445  TK-----------IIRN---------------------------QQSLNRHVGSYLKMIT 466

Query: 1609 ECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISG 1788
            E K+EIE L S+ + +++ +L   +  + Q +   ++   +N+++ Q  +  K +  I  
Sbjct: 467  EQKKEIEELRSRENKMIQFQLDKYKLSRQQIA--VAITDCVNNVRFQYTQVPKFQ-RIKL 523

Query: 1789 FNNKLQKMTEVMQVALQDYKKRELDLN------KKFETHISKEIKSLK 1914
              + +      +Q+ L + KK  +            E  I ++IK L+
Sbjct: 524  IKSLILCKRRFLQLVLLEMKKSPIQREDSSGAMASLEEQIKRKIKQLE 571

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 30/101 (29%), Positives = 51/101 (50%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F   A+Q  +++     L    + G+N TV  YG T  GKTYT++G       
Sbjct: 155 KFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP----- 209

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
              +  GI+ + + +LF  +E       + +  SF+E+YNE
Sbjct: 210 ---ENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNE 247

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13554)
            [2421 nt, 807 aa]
          Length = 806

 Score =  125 bits (315), Expect = 1e-28
 Identities = 125/434 (28%), Positives = 204/434 (47%), Gaps = 23/434 (5%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  + I + NL         + ++L+ +G  +R  ++T  N+ SSRSH +  I + + 
Sbjct: 255  REDNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQT 314

Query: 1099 HQDELFRISK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL---- 1254
            ++      S     ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 315  NRTVDLTSSHVFATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLND 374

Query: 1255 -VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
               RS H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 375  GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 434

Query: 1432 K---PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNE 1602
            K    Q          +K IT +  +I  D L  + +  I +    YK      E  +  
Sbjct: 435  KVIRNQQSLNRHVGSYLKMITEQKKEI--DELRQREQNMIEIQLKKYK---LGREKIQLS 489

Query: 1603 VQECKREIESLASKNSLLVKDK------LKSRETIQSQNSQMESLKATINHLKAQLDKQH 1764
            + +C R I++  ++ S     K      L  R  +Q  N +++S+   +N        Q 
Sbjct: 490  MDDCLRNIQNTYAQTSKFQNAKNIKSLILCKRRFLQMINLELDSVLYVVN------STQD 543

Query: 1765 KAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNM 1944
               +E      K Q + ++ ++  Q     ELDL        SK+  ++K +     D++
Sbjct: 544  MGVMETCNI-LKEQILNKIRELEEQFDTPDELDL----VIEHSKKNDAMKLSEMEYWDDI 598

Query: 1945 QQKNIFQETDIQPNLDMVKNEVLT----LMETMQEKAELMYK-DCVKKILNESPKFFNVI 2109
              +  F E+ +    ++V+NEVL     L E + E   LMYK     K L         +
Sbjct: 599  IDRANF-ESRLDNINEVVRNEVLVNGSMLTEKLFENENLMYKCKFFSKCLYHQGDINESL 657

Query: 2110 VEKIDIIRIEFQNF 2151
             E +DI + EF+ F
Sbjct: 658  QELLDIDK-EFEQF 670

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F  G+SQ  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 145 KFIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGTP----- 199

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
              +  GII   + +LF  +E      ++ +  S++E+YNE
Sbjct: 200 ---EQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNE 237

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] {ON}
            Anc_3.528 YGL216W
          Length = 801

 Score =  125 bits (314), Expect = 1e-28
 Identities = 133/480 (27%), Positives = 217/480 (45%), Gaps = 52/480 (10%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D +N I + NL  +      E ++L+ +G  +R  +ST  N+ SSRSH +  I L ++
Sbjct: 219  REDANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQ 278

Query: 1099 HQ--------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 1254
            ++        ++LF  S ++++DLAGSE    +    +   E  +IN+SLL LG  INAL
Sbjct: 279  NKLNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINAL 336

Query: 1255 VDRSG-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 1413
               +        HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++
Sbjct: 337  CINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANR 396

Query: 1414 AKNIKNK---PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDL 1584
            AK IK K    QL         +K IT +  +I++       K  + +  +H   +  DL
Sbjct: 397  AKEIKTKIIRNQLSLNRHISSYLKMITQQKQEIEN-----LRKNQLTIINNHLSKIEIDL 451

Query: 1585 ESHKNEVQE--------------------------CKREIESLASKNSLLVKDKLKSRET 1686
            +  + E+ +                          CKR   SL      ++++K    E 
Sbjct: 452  KKIEFEIDQIISNLKRKILVNHRFKIIKFEKSLILCKRRFFSLILIELRILQEKQFEYEM 511

Query: 1687 IQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDL 1866
            I   N  +E  +  IN L+ Q D     +L    FNN          +   D KK +L L
Sbjct: 512  I---NQIIEHFQYKINQLELQFDSNDYIDLV---FNN----------IKTIDIKKLKL-L 554

Query: 1867 NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNL---DMVKNEVLTLMETMQE 2037
            N   E    K        LF++LD +   +I  E  +  +L    ++ N+ +  +  +  
Sbjct: 555  NGWDEYKHEK-------MLFIRLDQLYD-SIKNEIIMNSSLLIDKLIMNKSINNLTHILT 606

Query: 2038 KAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYK-----NIAENLSDISEENNN 2202
             ++LM ++ +  I  ES      I   I+     F+ F K     N  E+  D +EE+ +
Sbjct: 607  HSKLMNEESLLGI--ESEGIETRITNLINEAEHSFEEFSKPFYPLNTLEDEDDENEEDED 664

 Score = 59.3 bits (142), Expect = 4e-08
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           R+  DK+    ++Q  +F+    PL    + GYN TV  YG T  GKTYT++G       
Sbjct: 109 RFIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGTP----- 163

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
              +  GII   L  LF+ +E      +  +  S++E+YNE
Sbjct: 164 ---ENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNE 201

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
            YGL216W
          Length = 723

 Score =  124 bits (310), Expect = 3e-28
 Identities = 105/382 (27%), Positives = 180/382 (47%), Gaps = 37/382 (9%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D +  I + NL      +  + L+L+ RG  +R  + T+ N  SSRSH +  I + ++
Sbjct: 252  REDSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQR 311

Query: 1099 HQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
            ++     E      ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 312  NKLVDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSND 371

Query: 1267 G-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
            G     H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 372  GSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKT 431

Query: 1432 KPQLGAFMMKDILVKNITMELAKIKS-----DLLSTKSKEGIYMSQDHYKNLNSDLESHK 1596
            K           L +++   L  I       D L  +  + + +   +YK     +E   
Sbjct: 432  K----VIRNHQTLNRHVASYLKMITEQKRTIDELEARQAQMVQVGITNYKLAIEKIERSI 487

Query: 1597 NEV--QECKREIESLASKNSLLVKD-KLKSRETIQSQNSQMESLKATINHLKAQLDKQ-- 1761
             EV    CK ++ S + +N  L+K   L  R  +Q    ++E++ A ++    Q   +  
Sbjct: 488  EEVVGNVCK-QLSSKSFQNIKLLKALTLTKRTLLQLIVIEVENVLAIVSEWTDQRIIETC 546

Query: 1762 ----HKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLN--------------KKFETH 1887
                 + + ++    ++    TE+  V       RE+DL               + FE  
Sbjct: 547  ERVIRQMQEQVKLLEDRFDTATELNLVV---EHSREIDLKRLREMEHWDDTVHLRSFEAR 603

Query: 1888 ISKEIKSLKTALFLQLDNMQQK 1953
            +    +SL+ ++ ++  NM ++
Sbjct: 604  LDLVYESLQKSILIESSNMTEE 625

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 33/108 (30%), Positives = 53/108 (49%), Gaps = 2/108 (1%)
 Frame = +1

Query: 247 TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 426
           T   +  ++  DK+F    SQ+ ++      L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 427 DEKLYNGELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
                     +  GII R + +LF  ++      D+ +  SF+E+YNE
Sbjct: 195 --------TRENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNE 234

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
            Anc_3.528 YGL216W
          Length = 672

 Score =  123 bits (308), Expect = 5e-28
 Identities = 117/449 (26%), Positives = 216/449 (48%), Gaps = 17/449 (3%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK- 1095
            + DQ++ I + NL      N  + ++L+ RG  +R  + T+ N+ SSRSH++  I + + 
Sbjct: 204  REDQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQV 263

Query: 1096 -KHQDELFRI----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV- 1257
             K+ D++       S ++++DLAGSE    +     R  E  +IN+SLL LG  INAL  
Sbjct: 264  LKNFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCI 323

Query: 1258 -DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
              +S HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK IK K
Sbjct: 324  NKKSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

Query: 1435 PQLGAFMMKDILVKNITMELAKIKSDL-LSTKSKEGI-YMSQDHYKNLNSDLESHKNEVQ 1608
                       +++N T     + S L L T+ K+ I  +     K +N ++  +   V+
Sbjct: 384  -----------VIRNQTSLNRHVGSYLKLITEQKQEIDKLKAREDKIVNMEISKYNLTVK 432

Query: 1609 ECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISG 1788
            + +  I  + +     +   L +    ++  S M   +  +  ++ ++D     +   S 
Sbjct: 433  KIEMSISDIGNN----LNKVLANSGNFKTMKSLMLVKRRFLQLIEIEIDDIINWDYTTSE 488

Query: 1789 FNNKLQKMTEVMQVALQDYKKREL--DLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF 1962
            +        E+ Q    D K+ E+  D N + +T I +  +S+      + +N  +    
Sbjct: 489  Y------FQEIKQKIQNDIKQLEIKFDSNDEIDT-IFQNSESIDLPRLRESENWDEAMHL 541

Query: 1963 QETDIQPNL--DMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIV---EKIDI 2127
                 + N   ++ +NE+L     + EK  L+  D + +      KF   ++   + +D 
Sbjct: 542  PRFQDKLNYLNELTRNEILINSSMIMEK--LLTNDTMTRFF----KFHASLITQEKNVDT 595

Query: 2128 IRIEFQNFYKNIAENLSDISEENNNLKQY 2214
            I  E  +  +   E  +    ++NN +++
Sbjct: 596  ILQELASVDETFDEFANIFMTQDNNTRRF 624

 Score = 64.7 bits (156), Expect = 9e-10
 Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 5/104 (4%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           ++  DK+F   ++Q+ IFE+   PL    + G+N TV  YG T  GKTYT+ G       
Sbjct: 91  KFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING------- 143

Query: 448 ELNDAAGIIPRVLLKLFDTLEL-----QQSDYVVKCSFIELYNE 564
             ++  GII R + +LF  +E+      +S   +  S++E+YNE
Sbjct: 144 -TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNE 186

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
            Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  120 bits (302), Expect = 5e-28
 Identities = 97/326 (29%), Positives = 162/326 (49%), Gaps = 25/326 (7%)
 Frame = +1

Query: 943  YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDE---- 1110
            YI+ L +  + +  E L  ++ G   R VA T +N+ SSRSH I TI + +   D     
Sbjct: 173  YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 1111 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV-DRSGHIPFRE 1287
            + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L  ++   +P+RE
Sbjct: 233  VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 1288 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDI 1467
            S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L    +   
Sbjct: 293  SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHLNTTQI--- 347

Query: 1468 LVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE---CKREIESLA 1638
                              +K +E ++  Q+  K L + L     E+++    +++++ + 
Sbjct: 348  ------------------SKGEEQLFSLQNQLKELQATLTLQTAELEDQRVLQQQLDKIN 389

Query: 1639 SKNSLL-----VKDKL----KSRET-IQSQNSQMESLKATINHLKAQLDKQHKAELEISG 1788
              N  L      ++K+    ++R T I  ++ Q+ S    I H      +    + +I+ 
Sbjct: 390  ETNKYLQHRLETENKICADFRNRWTQISWESHQLGSALLDIVHATEIASQPFSFDSQITS 449

Query: 1789 -------FNNKLQKMTEVMQVALQDY 1845
                   F + LQK  E +Q  L+ Y
Sbjct: 450  FQRDCAQFQSSLQKDKETIQYLLEKY 475

 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 46/161 (28%), Positives = 74/161 (45%), Gaps = 9/161 (5%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 291
           NI VA+R R +  RE    S +         S E+++       +   +    Y  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPSVIKRKT-----SNEITLQKDNTANVITTVEHTFY-FDQVF 57

Query: 292 GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGI 471
              ++Q  I+ E+A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 472 IPRVLLKLFDTLELQQSD---------YVVKCSFIELYNEE 567
           IP V  +LF  +++ Q +         + V  S+ ++YNE+
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQ 150

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa] {ON}
            YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  123 bits (308), Expect = 7e-28
 Identities = 96/344 (27%), Positives = 175/344 (50%), Gaps = 36/344 (10%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D    I + NL    ++   + ++L+ +G  +R  ++T  N+ SSRSH +  + + ++
Sbjct: 234  REDSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQR 293

Query: 1099 HQD----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 1257
            ++     E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 294  NRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSG 353

Query: 1258 -DRSG-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
              R G H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 354  RKRGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKT 413

Query: 1432 K---------PQLGAFM------------MKDILVKNITMELA--KIKSDLLSTKSKEGI 1542
            K           +G+++            +++   K I +E++  KI  + +     + +
Sbjct: 414  KIIRNQHSLDRHVGSYLKMITEQRQEIEELRERERKMIDLEISRYKISRERIHMAVWDSV 473

Query: 1543 YMSQDHYKNLNSDLESHKNEVQE---CKRE-IESLASKNSLLVKDKLKSRETIQSQNSQM 1710
            +  + +YK  NS+   H   ++    CKR  ++ +  + ++L+K      +   + ++  
Sbjct: 474  HSLRHNYK--NSEKFQHLKVIKSLMLCKRRFLQMVGVELAVLLKHITPDTDMHANCSTLH 531

Query: 1711 ESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQD 1842
            E L   + +L+   D   + E       + L+   EV  V LQ+
Sbjct: 532  EQLNQKVKNLEQSFDSPDELE-------SALEHTREVDMVKLQE 568

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 33/102 (32%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = +1

Query: 265 KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 444
           +++  D+VF   +SQ  ++E    PL    + G+N TV  YG T  GKTYT++G      
Sbjct: 123 QKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP---- 178

Query: 445 GELNDAAGIIPRVLLKLFDTLELQQSD--YVVKCSFIELYNE 564
               +  GII   + +LF  +E  Q    + +  S++E+YNE
Sbjct: 179 ----ENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNE 216

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
            similar to uniprot|P53086 Saccharomyces cerevisiae
            YGL216W KIP3 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 778

 Score =  121 bits (304), Expect = 2e-27
 Identities = 112/436 (25%), Positives = 207/436 (47%), Gaps = 24/436 (5%)
 Frame = +1

Query: 925  DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1104
            D +  I + NL  ++     + ++L+ +G  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 239  DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 1105 DELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-----V 1257
                +     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 299  TADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGT 358

Query: 1258 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1437
             RS H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K 
Sbjct: 359  RRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTKV 418

Query: 1438 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECK 1617
                  + D  V +    +++ K ++   + +E + +     K      E  +  +++C 
Sbjct: 419  SRNNQTL-DRHVSSYLKMISEQKQEIDELRRREQVVIDM-RLKKYQLTQEKVQLAIEDCL 476

Query: 1618 REIESLASKNSLLVKDK-LKSRETIQSQNSQMESLKA--TINHLKAQLDKQ--HKAELEI 1782
            + +++  +K       K +KS    + +  Q+  L+    I+ ++   D Q    + L  
Sbjct: 477  QNVQTAFAKAGNFHNSKNIKSLMLCKRRFLQLVQLELINVISLVQEWTDPQIYQSSTLLH 536

Query: 1783 SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF 1962
                NK++++ +         +  ELDL    E   + ++  LK    ++  N  +   +
Sbjct: 537  DQLTNKIRELEDAFD------QPGELDL--VLERCRTVDLPKLKE---MEGWNDARDLPY 585

Query: 1963 QETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFF--------NVIVEK 2118
             E  +    + ++NE+L     M E+          +IL++  KF         N+    
Sbjct: 586  FEAQLDHLAEFIRNEILINASAMVERV------LQDEILSQRFKFLSLCLAHDTNIAAAV 639

Query: 2119 IDIIRI--EFQNFYKN 2160
             D+++I  EF+ F +N
Sbjct: 640  QDLVKIDEEFETFGRN 655

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 2/101 (1%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           R+  D++F   ++Q  ++E    PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 127 RFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGSP----- 181

Query: 448 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
              +  GII + + +LF+ +E       + +  SF+E+YNE
Sbjct: 182 ---ENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNE 219

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1
          Length = 478

 Score =  119 bits (297), Expect = 2e-27
 Identities = 102/321 (31%), Positives = 156/321 (48%), Gaps = 20/321 (6%)
 Frame = +1

Query: 943  YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL-----YKKHQD 1107
            +++ L+E  + N  E ++ + +G ++R V ST MN  SSRSH IF I++     +KK   
Sbjct: 179  FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 1108 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD----RSGHI 1275
             +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ L +    RS  I
Sbjct: 239  VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 1276 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAF- 1452
            P+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS  K +K    + +  
Sbjct: 299  PYRESALTWILKENLGGNSNTCLVACVSPENY--YESLSTLRYASLTKKVKTNATINSMS 356

Query: 1453 ---MMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKRE 1623
                M+++  K    EL K+ +D   T + +               LE    ++Q     
Sbjct: 357  HIEQMEELKAK--LRELQKMINDKKPTSAHQ-------------HTLERRMEDIQRANFF 401

Query: 1624 IESLASKNSLLVKDKLKS----RETIQSQNSQM-ESL--KATINHLKAQLDKQHKAELEI 1782
            +E   +K S L    L++    R+ + S   QM ES      +N   A+L ++ +     
Sbjct: 402  LEQRMAKESQLADQSLQTARYERDLLASMVLQMIESFNWNQPLNDQAAELWERSQK---- 457

Query: 1783 SGFNNKLQKMTEVMQVALQDY 1845
                N  QK      V LQ Y
Sbjct: 458  --LQNSFQKDRSFFDVTLQKY 476

 Score = 65.5 bits (158), Expect = 4e-10
 Identities = 40/115 (34%), Positives = 59/115 (51%), Gaps = 13/115 (11%)
 Frame = +1

Query: 262 AKRYTVDKVFGPGAS----QDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 429
           AK +  D  FG   S    Q +I+E +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 430 EKLYNGELNDAAGIIPRVLLKLFDTLEL-----QQSDYV----VKCSFIELYNEE 567
           +           GI+PR   +LF+   +     Q+SD +    VKCSF E+YNE+
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQ 155

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8.678
            YPL155C
          Length = 637

 Score =  119 bits (299), Expect = 5e-27
 Identities = 104/377 (27%), Positives = 181/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ I  L E    ++ E    +Q G K+R+ + T  N  SSRSH I  + L   
Sbjct: 244  RDDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNT 303

Query: 1099 HQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 1266
                   +S  ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI+ L   S   
Sbjct: 304  DLRSGETVSSTLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSK 360

Query: 1267 ---------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 1401
                            HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ 
Sbjct: 361  NGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIR 420

Query: 1402 YASKAKN----IKNKPQL--GAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMS---Q 1554
            +AS+AKN    +  +P +  G++  KD  ++N+T +L K    ++  K +  +  S    
Sbjct: 421  FASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHND 480

Query: 1555 DHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATIN 1734
            D   + NS L   +N V +CK           L   +KL  ++TI+ ++S+M ++   + 
Sbjct: 481  DSTVDPNSTLLKAENRVLKCK-----------LSNCEKLLDKDTIELEDSEMVAIIDML- 528

Query: 1735 HLKAQLDKQHKAELEISGFNNKL---QKMTEVMQVALQDYKKRELDLNKKFETHISKEIK 1905
                 +D     E +  G  ++L   ++ T+ ++  L ++ +RE    + F  H++  I+
Sbjct: 529  ----PIDVGSVLETKFQGLESQLRQYKEYTKQLEFKLMNFDRRENVSAEPFTAHVNSVIQ 584

Query: 1906 SLKTALFLQLDNMQQKN 1956
            S    +     ++++K+
Sbjct: 585  SKDVEILELRRSLERKD 601

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 39/106 (36%), Positives = 57/106 (53%), Gaps = 4/106 (3%)
 Frame = +1

Query: 262 AKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 441
           A  +T D+VF    +   I+E  + P+    ++G+N TV  YGMT +GKT+TMTG E   
Sbjct: 109 AGEFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE--- 165

Query: 442 NGELNDAAGIIPRVLLKLFDTLELQQ----SDYVVKCSFIELYNEE 567
                D AG+IP  +  LF  +        S Y V  S++E+YNE+
Sbjct: 166 -----DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEK 206

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
            Anc_3.479 YPR141C
          Length = 739

 Score =  120 bits (300), Expect = 5e-27
 Identities = 76/182 (41%), Positives = 103/182 (56%), Gaps = 13/182 (7%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-K 1098
            +DQS   Y+ N++ F I N  + + L+ +    R  +ST +N  SSRSH IF I L    
Sbjct: 556  DDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYN 615

Query: 1099 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-------- 1254
            H+     ISK+NLVDLAGSE IN S     R KE  SIN+SL  LG VI+AL        
Sbjct: 616  HKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 1255 ----VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 1422
                + ++ HIPFR SKLT LL+ SL G++KT +   +S  +    ET ++L +A+K  N
Sbjct: 676  NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 1423 IK 1428
             K
Sbjct: 736  TK 737

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 37/101 (36%), Positives = 49/101 (48%), Gaps = 3/101 (2%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VF        +F E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 444 FEFDHVFKQDEGNSEVFNEIE-QLIQSALDGYNVCIFAYGQTGSGKTYTM---------- 492

Query: 451 LNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
           LN   G+IP  +  +F   D+L+    +Y V C FIELYNE
Sbjct: 493 LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNE 533

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 106/504 (21%), Positives = 212/504 (42%), Gaps = 63/504 (12%)
 Frame = +1

Query: 1561 YKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSR---ETIQSQNSQ-MESLKAT 1728
            YK  +  L+S +++V   +   ++L++KNSLL  + L  +   +++ S NS  +E +K+ 
Sbjct: 93   YKEYSLQLKSLQSDVNNHQSVRDNLSNKNSLLENEILSLKFKLDSLSSNNSVFVEKVKSK 152

Query: 1729 INHLK----------AQLDKQHKAEL---------EISGFNNKLQKMTEVMQVA-LQDYK 1848
             N LK            +   H  E+         E+S    + +K  E  + + L+ + 
Sbjct: 153  ENQLKELNEIKILKEKNIVDNHHLEINQLKSTHDNELSSIIRQYKKKYESTKFSKLESFG 212

Query: 1849 KRELDLNKKFETHISKEI----KSLKTALFLQLDNMQQKNI--FQETDIQPNLDMVKN-- 2004
             ++ D+N+K    ISK+I    K+L + L    +N  + NI   +E   Q N    +N  
Sbjct: 213  NQKKDINEKLSV-ISKDIINNEKNLNSELRKVDNNQSKSNIDWLKENQTQYNEKTKENNG 271

Query: 2005 ---EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIA--- 2166
               E+  L E ++++ E    +  K++  +     N+  E  D+++ E +N  ++I+   
Sbjct: 272  LTKEIYKLSENIKKQLEPDCSNKRKELQLQIENNNNLDSELSDVLK-EKENLIEHISSIQ 330

Query: 2167 ENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVE---------- 2316
            + L D+  EN    + +++   +N  +++L+  I     N     NQF E          
Sbjct: 331  KKLLDLKNENETQLKLIED---ENEKRKILSKLIIENDTNRRIIHNQFQELRGNIRVYCR 387

Query: 2317 ---------NFKMTLNDHLE--ENKKLI-MQN--MTNATSAVIDQEMDLFEPRRAKWENS 2454
                     N   T +  +E  E+K ++ +QN   T  T  +  +++D      A +   
Sbjct: 388  VRPPLKKITNSPQTSHFSIEIPEDKNILEVQNFDQTKGTQTIKVKKLD--SNNNATYSFE 445

Query: 2455 FDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNN 2634
            FD + K D  N+E +N       +I++ + ++ +  N  I    GQ    +    L  N+
Sbjct: 446  FDHVFKQDEGNSEVFN-------EIEQLIQSALDGYNVCIFAY-GQTGSGKTYTMLNPND 497

Query: 2635 TKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYN-TIEDIMTNHGNKENATKDE 2811
                   K + +    LK N                ++YN  I D+  ++G  +++   E
Sbjct: 498  GVIPMTIKYIFNSMDSLKKN-----GWEYNVSCEFIELYNENIIDLFRDNGPTKDSISHE 552

Query: 2812 MIDNILKEIPNLSKRLPLRISNIN 2883
            +  +   +I  ++     +I NI+
Sbjct: 553  IRHDDQSKITYVTNIKRFKIENIS 576

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 64/287 (22%), Positives = 122/287 (42%), Gaps = 19/287 (6%)
 Frame = +1

Query: 2137 EFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVE 2316
            E  +FYK  +  L  +  + NN +    N   KN+  E     +    +++    + FVE
Sbjct: 88   ELSSFYKEYSLQLKSLQSDVNNHQSVRDNLSNKNSLLENEILSLKFKLDSLSSNNSVFVE 147

Query: 2317 NFKMTLNDHLEENKKLIMQNMT---------NATSAVIDQEM-DLFEPRRAKWENSFDLI 2466
              K   N   E N+  I++            N   +  D E+  +    + K+E++    
Sbjct: 148  KVKSKENQLKELNEIKILKEKNIVDNHHLEINQLKSTHDNELSSIIRQYKKKYEST--KF 205

Query: 2467 NKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLK-NNTKF 2643
            +K +S  N+   ++   LS I K  D  +N  N +  + K    +S++ I  LK N T++
Sbjct: 206  SKLESFGNQ-KKDINEKLSVISK--DIINNEKNLNSELRKVDNNQSKSNIDWLKENQTQY 262

Query: 2644 NDQFKQ---LISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDI---MTNHGNKENATK 2805
            N++ K+   L  +   L +NI+              D  N  +++   + N+ N ++   
Sbjct: 263  NEKTKENNGLTKEIYKLSENIKKQLE---------PDCSNKRKELQLQIENNNNLDSELS 313

Query: 2806 DEM--IDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDEN 2940
            D +   +N+++ I ++ K+L L + N N   ++         IEDEN
Sbjct: 314  DVLKEKENLIEHISSIQKKL-LDLKNENETQLK--------LIEDEN 351

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
            similar to uniprot|P28743 Saccharomyces cerevisiae
            YPL155C KIP2 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 657

 Score =  117 bits (294), Expect = 2e-26
 Identities = 107/366 (29%), Positives = 177/366 (48%), Gaps = 32/366 (8%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L E  +  + + +  +  G  +R+   T  N  SSRSH I  I L   
Sbjct: 266  RDDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCT 325

Query: 1099 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 1254
              +  L   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L       
Sbjct: 326  DLKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQN 382

Query: 1255 --VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
              V    HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +AS+AKNI 
Sbjct: 383  MGVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNIS 442

Query: 1429 ---NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKN 1599
                + ++     KD +++N+  +L +    +   KS  G   + D   + ++     +N
Sbjct: 443  LVVKRNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSEN 502

Query: 1600 EVQECKRE-IESLASKNSLLVKDK----------------LKSRETIQSQNSQMESLKAT 1728
            +V + + E  E L  K+S++++D+                L+S+  IQ   SQ+   KA 
Sbjct: 503  KVLKLRLEHCEKLLDKDSMILQDQELVEIVDMLPPDVSTVLESK--IQGIESQLREHKAY 560

Query: 1729 INHLKAQLDK-QHKAELEISGFNNKLQKMTEV-MQVALQDYKKRELDLNKKFETHISKEI 1902
              HL+ QL   QH    +++G +   +   EV +   L + +   ++L K  E    K I
Sbjct: 561  AAHLEHQLQNLQH----QVTGQSISSRFAAEVDVDAMLHEQEAELMELRKSLERK-DKMI 615

Query: 1903 KSLKTA 1920
            ++L+ A
Sbjct: 616  EALQNA 621

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 33/102 (32%), Positives = 56/102 (54%), Gaps = 3/102 (2%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           ++ D VF P      ++EE A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSG-------- 198

Query: 451 LNDAAGIIPRVLLKLFDTL---ELQQSDYVVKCSFIELYNEE 567
            ++  G+IP  +  +F  +    L    + VK S++E+YNE+
Sbjct: 199 TSNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEK 240

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 819

 Score =  118 bits (295), Expect = 3e-26
 Identities = 70/181 (38%), Positives = 108/181 (59%), Gaps = 9/181 (4%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D    I + NL    +    + ++L+ +G  +R  ++T  N+ SSRSH +  + + +K
Sbjct: 234  REDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQK 293

Query: 1099 HQD----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 1257
            ++     E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 294  NRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGG 353

Query: 1258 DRSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
             R G  H+P+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK IK 
Sbjct: 354  KRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKT 413

Query: 1432 K 1434
            K
Sbjct: 414  K 414

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/123 (31%), Positives = 60/123 (48%), Gaps = 7/123 (5%)
 Frame = +1

Query: 217 SINTTGDTGITAQMNAKR-----YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVL 381
           SI T   +     MN++R     +  D+VF   ASQ+ ++E    PL    + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 382 VYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIEL 555
            YG T  GKTYT++G          +  GII   + +LF  +E       + +  S++E+
Sbjct: 162 AYGATGCGKTYTVSGTA--------ENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEI 213

Query: 556 YNE 564
           YNE
Sbjct: 214 YNE 216

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
            (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  115 bits (289), Expect = 3e-26
 Identities = 93/304 (30%), Positives = 151/304 (49%), Gaps = 36/304 (11%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + ++   +YI+N+ E  ++N  + +  ++ G ++R   ST MN  SSRSH I +IT+ + 
Sbjct: 182  RENRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRT 241

Query: 1099 HQD-----ELFRISKMNLVDLAGSENINRS-GALNQRAKEAGSINQSLLTLGRVINALVD 1260
              D      +   S    VDLAGSE    +    N R KE  SIN+SL TL RV+ +L  
Sbjct: 242  DIDLNTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKK 301

Query: 1261 R-----------SGH---IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 1398
            R           S H   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ STL
Sbjct: 302  REELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESASTL 359

Query: 1399 EYASKAKNIKNKPQLGAFMMKDIL------VKNITMELAKIKSD---------LLSTKSK 1533
             YA  A+ IK    +  +    +L      ++ + +E+ K++ D         +L+    
Sbjct: 360  RYADIAQTIKTNSIINTYSNTTLLDNLQKQLRIMEIEVNKLQKDQNSSLELQYILNNLKL 419

Query: 1534 EGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQ-NSQM 1710
            E  ++ ++     N   E  K  +    ++ + +  K  L ++ KLK  + I ++   ++
Sbjct: 420  ENKFLEKNFINRANLSSEMRKLLIDSEIKKFQLM--KVILAIEIKLKDPKKIDAKLIGRL 477

Query: 1711 ESLK 1722
            E LK
Sbjct: 478  EQLK 481

 Score = 78.6 bits (192), Expect = 3e-14
 Identities = 54/165 (32%), Positives = 72/165 (43%), Gaps = 14/165 (8%)
 Frame = +1

Query: 115 ITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFG 294
           ++V VR   R+E         V+N   I  S      TT           K +  DK F 
Sbjct: 5   VSVYVRVAPRDESRRHRAICKVINTDSILLSSNPKRQTTFIRSSFENKEEKIFKFDKCFD 64

Query: 295 PGA----SQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 462
            G     SQ   ++       +D + GYNC +L YG T +GKTYTM G+ K      ND 
Sbjct: 65  EGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------NDT 118

Query: 463 AGIIPRVLLKLFDTLE----------LQQSDYVVKCSFIELYNEE 567
            G+IPR    LF  +E           Q+S+Y V CS  E+YNE+
Sbjct: 119 RGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQ 163

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
            similar to uniprot|P17119 Saccharomyces cerevisiae
            YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  115 bits (287), Expect = 2e-25
 Identities = 72/148 (48%), Positives = 93/148 (62%), Gaps = 4/148 (2%)
 Frame = +1

Query: 997  LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRS 1173
            +L+R  K R  AST  N+ SSRSH+IF I L  K++    +    +NLVDLAGSE +N S
Sbjct: 540  VLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSS 599

Query: 1174 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 1344
              + +R +E  SIN+SL  LG VI+AL    G   HIPFR SKLT LLQ SL G++KT +
Sbjct: 600  MVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLM 659

Query: 1345 IATISPAKVTSEETCSTLEYASKAKNIK 1428
               ISPA +   ET ++L +ASK  N K
Sbjct: 660  FVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 44/117 (37%), Positives = 58/117 (49%), Gaps = 6/117 (5%)
 Frame = +1

Query: 232 GDTGITAQMNAKR---YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTST 402
           GD G+T      +   +  DK+F    + D IF+EV G L Q  + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEV-GQLIQSSLDGYNVCIFAYGQTGS 439

Query: 403 GKTYTMTGDEKLYNGELNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
           GKTYTM          LN   GI+P  +  +F   D L  +   Y V C FIE+YNE
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNE 486

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 73/334 (21%), Positives = 141/334 (42%), Gaps = 79/334 (23%)
 Frame = +1

Query: 1309 QDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA----KNIKNKPQLGAFMMKDILVK 1476
            Q  +GG  +     T  P ++   ++ S+    S      K+I+++  L +F  +++   
Sbjct: 10   QTGIGGAGQKRRYTTTPPREIRQYQSRSSFGVNSSGNVDGKSIRSRTHLTSFYKENV--- 66

Query: 1477 NITMELAKIKSDLLSTKSK-EGIYMSQDHYKNLNS-----DLE-SHKNEVQECKREIESL 1635
               MEL +++  L   K   +G+   +D Y++L S     DL+   K E ++ K +   L
Sbjct: 67   ---MELNELQDKLFQKKGVLDGL---KDEYEDLKSRYTALDLKWEQKKEERKLKAQKLEL 120

Query: 1636 ASKNSLLVKDKLKSRETI--QSQNSQMESLKATINHLKAQLDKQHKAELE------ISGF 1791
              K    +KD   +++T   +S   ++E L A  N    +++ +++++LE      I  F
Sbjct: 121  KEKELKKIKDDFANKKTFLEESHKLKLEQLTANKNAELNKMNDEYRSKLEALKYEKIKKF 180

Query: 1792 NNKLQKMTEVMQ----------VALQ-------------------DYKKRELDLNKKFET 1884
             N+  ++ E ++          VALQ                   DY+K   ++ +K + 
Sbjct: 181  ENEKNELIEKIEEIRNKMITNDVALQQRMKDIEADHLEEKEKWLKDYQKEWREVTEKNQE 240

Query: 1885 HI--SKEIKS-------------------LKTALFLQLDNMQQKNIFQETDIQPNLDMV- 1998
             I  +KE+KS                   LK+ +    D +Q KN  Q  +I+ N+D+  
Sbjct: 241  SIRKTKELKSEIETVLTPRIDTQNKRLEELKSEIKKLDDTLQNKNE-QVGEIRKNIDLER 299

Query: 1999 ---------KNEVLTLMETMQEKAELMYKDCVKK 2073
                     K E+L  +E  +++ E + K  VK+
Sbjct: 300  EKKDKLLAEKEEILAYIEKSKKEVEEIKKILVKE 333

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 668

 Score =  114 bits (285), Expect = 3e-25
 Identities = 104/367 (28%), Positives = 177/367 (48%), Gaps = 33/367 (8%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L E ++++  E +  +  G  +R+   T  N  SSRSH +  I ++  
Sbjct: 229  RDDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCT 288

Query: 1099 HQDELFR---ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS- 1266
              DE+     +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L   S 
Sbjct: 289  --DEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESS 343

Query: 1267 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
                  GHIP+R+SKLTR+LQ +L G++  A I T+     TS E+ +T+ +AS+AKNI 
Sbjct: 344  GLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNIS 403

Query: 1429 ------------NKPQLGAFMMKDILVKNITMEL---------AKIKSDLLSTKSKEGIY 1545
                        +K QL   + K +  + IT++          + I SD    +  E + 
Sbjct: 404  LAVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLK 463

Query: 1546 MSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKA 1725
            M  +HY+ L + LE    +  E    I+ L     ++++ KL       + +SQ++  K 
Sbjct: 464  MKVEHYERLET-LEPSILKDTELVEIIDMLPQDIGVMLETKL------VNMDSQLQESKR 516

Query: 1726 TINHLKAQLDKQHKAELEISGFNNKLQ--KMTEVMQVALQDYKKRELDLNKKFETHISKE 1899
             I+ L++   +   A    +   + +    +T+V+    Q+  +    L +K      K 
Sbjct: 517  YISQLESARTRDASATAATAELLSNVSDIDLTQVLHEQEQELMQLHQSLERK-----DKM 571

Query: 1900 IKSLKTA 1920
            I++LK+A
Sbjct: 572  IEALKSA 578

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 2/100 (2%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VF P  + D ++E +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 451 LNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
                GIIP  +  +FD +   L +  + V+ S++E+YNE
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNE 197

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
            (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  114 bits (284), Expect = 3e-25
 Identities = 110/387 (28%), Positives = 186/387 (48%), Gaps = 32/387 (8%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D + G+ +  L E    +  E LN ++ G KHR+ +ST  N  SSRSH I  I L   
Sbjct: 224  RDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISS 283

Query: 1099 HQDELFRI-SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL---VDRS 1266
                   + S ++L DLAGSE +    A ++R +E   IN+SLL LG VI+ L   V+ S
Sbjct: 284  DLSSGEVVTSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNS 340

Query: 1267 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
                   HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL +AS+AKN+ 
Sbjct: 341  TESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNVS 400

Query: 1429 ----NKPQLGAF---MMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNS--- 1578
                 K  + A+     KD +++++  +L + K  + + ++   I    D+    +S   
Sbjct: 401  LHVVKKSSISAYDANDQKDRIIESLVQQLQEQKIKIEAMENNYNINSFGDNETITSSYDP 460

Query: 1579 --DLESHKNEVQECKRE-IESLASKNSLLVKDK-------LKSRETIQSQNSQMESLKAT 1728
               L  ++N++   K E  E L  K++  + DK       +   E      ++ + L++ 
Sbjct: 461  SVALLENENKILRYKLEHCERLLDKDTNELHDKEIANIADILPLEIGMLLETKFQGLESQ 520

Query: 1729 INHLKAQLDKQHKAELEISGFNNK--LQKMTEVMQVALQDYKKRELDLNKKFETHISKEI 1902
            I   K   D   K  +E    N K  L   +++    + D +  +LD     +  I++  
Sbjct: 521  IREFKNYTDNLEKEIME-KNTNKKRILSTSSDLSMKDIDDCETEKLDSINPKDAEIAELK 579

Query: 1903 KSLKTALFLQLDNMQQKNIFQETDIQP 1983
            K+L+    L +D +Q     +E  +QP
Sbjct: 580  KTLERKDKL-IDALQSARRLRERALQP 605

 Score = 67.8 bits (164), Expect = 9e-11
 Identities = 38/103 (36%), Positives = 54/103 (52%), Gaps = 4/103 (3%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           YT D VF P AS   ++     PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 451 LNDAAGIIP----RVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
           ++  AG+IP     +  K+FD+   +   Y    S++E+YNE+
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEK 198

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
            Anc_3.479 YPR141C
          Length = 724

 Score =  113 bits (282), Expect = 8e-25
 Identities = 72/167 (43%), Positives = 99/167 (59%), Gaps = 6/167 (3%)
 Frame = +1

Query: 946  IQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 1125
            + N+    + N     N+L++  K R  A+T  N+ SSRSH++F I  Y K ++E+   S
Sbjct: 554  VTNINTIALNNKGIVNNVLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDS 611

Query: 1126 K---MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRE 1287
                +NLVDLAGSE +N S A+  R +E  +IN+SL  LG VI+AL        HIPFR 
Sbjct: 612  SEGILNLVDLAGSERLNSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRN 671

Query: 1288 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
            SKLT LLQ SL G++KT +   ISP K    ET ++L +ASK  + K
Sbjct: 672  SKLTYLLQYSLTGSSKTLMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 37/101 (36%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           Y  D++F    S   +F+E+ G L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 430 YKFDRIFDQADSNTEVFKEI-GQLVQSSLDGHNVCIFAYGQTGSGKTYTM---------- 478

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSD---YVVKCSFIELYNE 564
           LND  G+IP  +  +FD  E  +     Y + C FIE+YNE
Sbjct: 479 LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNE 519

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
            Anc_8.678 YPL155C
          Length = 658

 Score =  112 bits (280), Expect = 1e-24
 Identities = 110/384 (28%), Positives = 173/384 (45%), Gaps = 52/384 (13%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ I  L E     + E +  ++ G  +R+ + T+ N  SSRSH +  + L   
Sbjct: 260  RDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTH 319

Query: 1099 HQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 1266
            +  D     S + L DLAGSE   R+    +R KE   IN+SLL LG VI+ L   S   
Sbjct: 320  NVIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSN 376

Query: 1267 ---------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 1383
                                  HIP+R+SKLTRLLQ +L GN+    I TI P   T  E
Sbjct: 377  SKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAE 436

Query: 1384 TCSTLEYASKAKNI-------KNKPQLG-AFMMKDILVKNITMELAKIKSDLLSTKSKEG 1539
            T +TL +AS+AKN+       KN   +  + + KD ++K +T  L K K  +   K K  
Sbjct: 437  TINTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQKETINDMKLKSS 496

Query: 1540 IYMSQD-HYKNLNSDLESHKNEVQECKRE-IESLASKNSLLVKDKLKS------------ 1677
               S      N N  L   +N + + K E  E++ +K+ + ++D   S            
Sbjct: 497  HDTSNKFSLDNPNISLLQTENSILKKKLENYENIMNKDMIELQDSQMSEIIDMLPIEIGA 556

Query: 1678 --RETIQSQNSQMESLKATINHLK---AQLDKQHKAELEISGFNNKLQKMTEVMQVALQD 1842
                  Q   SQ+   +   N L+     L KQ+++ L  S ++  L K  E+++  LQ 
Sbjct: 557  LLENKFQGMESQIRQFQKYTNELENKILNLKKQNRSLLNNSTYS--LDKDDEILE--LQK 612

Query: 1843 YKKRELDLNKKFETHISKEIKSLK 1914
              +R+  + + F++      ++LK
Sbjct: 613  MLERKDKIIEAFQSVSKLRDRALK 636

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 39/109 (35%), Positives = 56/109 (51%), Gaps = 2/109 (1%)
 Frame = +1

Query: 247 TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 426
           T   N   Y  D VF P      I++  A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 427 DEKLYNGELNDAAGIIPRVLLKLFDTLELQQSD--YVVKCSFIELYNEE 567
           D +       +  GI+P  +  LF+ +   ++D  Y V  S++E+YNE+
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEK 226

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa] {ON}
            complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  112 bits (280), Expect = 1e-24
 Identities = 68/151 (45%), Positives = 101/151 (66%), Gaps = 4/151 (2%)
 Frame = +1

Query: 973  TNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLA 1149
            +N  E   L+QR  K R+ A T MN+ SSRSH++F + +   ++D   R    +NLVDLA
Sbjct: 543  SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 1150 GSENINRSGALN-QRAKEAGSINQSLLTLGRVINALVDRSG--HIPFRESKLTRLLQDSL 1320
            GSE +NRSG ++ +R +E   IN+SL ++G VI+AL   SG  HIPFR +KLT LL+ SL
Sbjct: 603  GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 1321 GGNTKTALIATISPAKVTSEETCSTLEYASK 1413
             G++KT ++ T+SP+  +  ET ++L +A+K
Sbjct: 663  QGSSKTLMLVTVSPSNSSRNETMNSLRFATK 693

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 34/101 (33%), Positives = 48/101 (47%), Gaps = 3/101 (2%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  DK+F    S   +F EV   L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 408 FQFDKIFNYDESNRQVFGEVK-ELVQSALDGHNVCIFTYGQTGSGKTYTM---------- 456

Query: 451 LNDAAGIIPRVLLKLFDTLELQQS---DYVVKCSFIELYNE 564
           LN+  GIIP  L  + D     +     Y +K  F+E+YN+
Sbjct: 457 LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYND 497

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] {ON}
            Anc_3.479 YPR141C
          Length = 706

 Score =  112 bits (280), Expect = 1e-24
 Identities = 74/175 (42%), Positives = 100/175 (57%), Gaps = 6/175 (3%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            +D+S    I N+    +        +L R  K R  ASTK N+ SSRSH+IF I L+ K+
Sbjct: 530  DDESQTTSITNVMTVTLDREETVEKVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKN 589

Query: 1102 Q---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD---R 1263
                ++ + I  +NLVDLAGSE IN S    +R +E   IN+SL  LG VI+AL     +
Sbjct: 590  SKTNEDSYGI--LNLVDLAGSERINSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHK 647

Query: 1264 SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
              HIPFR SKLT LL+ SL GN+KT +   IS +     ET ++L +ASK  + K
Sbjct: 648  ERHIPFRNSKLTHLLKYSLSGNSKTLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 54/160 (33%), Positives = 78/160 (48%), Gaps = 6/160 (3%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTG---ITAQMNAKRY 273
           +EL   + V CR R      +KS   +  P+ +  K  S++    T    IT   N  +Y
Sbjct: 369 QELRGNIRVYCRLRPP----LKS---IEDPNTSHIKVYSLDNDHGTQTMEITKNNNTNKY 421

Query: 274 TVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 453
             DK+F    S   IF+EV G L Q  + GYN  +  YG T +GKT+TM          L
Sbjct: 422 KFDKIFDQFESNSEIFKEV-GQLVQSALDGYNVCIFAYGQTGSGKTFTM----------L 470

Query: 454 NDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
           N + GIIP  +  +F   D L+ +  +Y + C F+E+YNE
Sbjct: 471 NPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNE 510

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
            (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  112 bits (280), Expect = 1e-24
 Identities = 102/359 (28%), Positives = 176/359 (49%), Gaps = 25/359 (6%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D  +G+ +  L E  + ++ + L  +  G  +R+   T  N  SSRSH I T+ L   
Sbjct: 271  RDDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACT 330

Query: 1099 HQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 1266
                     S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L   S   
Sbjct: 331  DLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHT 387

Query: 1267 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI- 1425
                   HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +AS+AKN+ 
Sbjct: 388  TPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVS 447

Query: 1426 ----KNKPQLGAFMMKDILVKNITMELAKIKSDLLSTK-SKEGIYMSQDHYKNLNSDLES 1590
                +N+ +L     KD L+ N+  +L + +  +   K ++E    + D Y  L  + ++
Sbjct: 448  MTVKRNEAELA--HEKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-LRKESDA 504

Query: 1591 HKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQL----DK 1758
             K ++Q C+R    L  K+   V+D            +    L++ I  L++QL    D 
Sbjct: 505  LKRKLQLCER----LLDKDEAAVQDDQLVEIVEMLPPAVGALLESKIQGLQSQLRSHRDY 560

Query: 1759 QHKAELEISGFNNKLQK-----MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTA 1920
              + E ++S  +++L         + +Q+ LQ+ ++   +L+K   T  +K + +L++A
Sbjct: 561  SSQLERQLSDLDSRLSSHQSTASDQSLQILLQEQQEELAELHKSL-TRKNKMLDALQSA 618

 Score = 58.5 bits (140), Expect = 7e-08
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 3/114 (2%)
 Frame = +1

Query: 235 DTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 414
           D    A  +   +  D VF P ++   +++++  P+     +GYN  +  YGMT +GKT+
Sbjct: 127 DEQTIAHNDVGEFKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTF 186

Query: 415 TMTGDEKLYNGELNDAAGIIPRVLLKLFDTL---ELQQSDYVVKCSFIELYNEE 567
           TM+G          + AG+I   +  +F  +    L    + V  S++E+YNE+
Sbjct: 187 TMSGTP--------EEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEK 232

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
            Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (280), Expect = 2e-24
 Identities = 66/180 (36%), Positives = 104/180 (57%), Gaps = 8/180 (4%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D  N   + NL      +  + ++L+ +G  +R  + T  N+ SSRSH +  I + + 
Sbjct: 239  REDTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQS 298

Query: 1099 HQDELFRISK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
             +    +  K    ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 299  SRSVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTG 358

Query: 1267 G----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1434
                 H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK K
Sbjct: 359  RRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = +1

Query: 265 KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 444
           +++  DK+F   A+Q  +F     PL    I G+N TV  YG T  GKT+T++G      
Sbjct: 128 QKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISGTP---- 183

Query: 445 GELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 564
               +  GII   + +LF  +E       + +  S++E+YNE
Sbjct: 184 ----ENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNE 221

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
            Anc_8.678
          Length = 655

 Score =  111 bits (278), Expect = 2e-24
 Identities = 110/378 (29%), Positives = 175/378 (46%), Gaps = 67/378 (17%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L+E    ++ E +  ++RG  HR+ A T  N  SSRSH I  I L   
Sbjct: 272  RDDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNT 331

Query: 1099 HQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 1266
            +  +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L   S   
Sbjct: 332  NVIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAA 388

Query: 1267 -----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 1413
                       GHIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS+
Sbjct: 389  SHGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASR 448

Query: 1414 AKN----IKNKPQLGAFMMKD-----ILVKNITMELAKIKSDL----------------L 1518
            AKN    +  KP + +    D       +  I  E  ++ S L                +
Sbjct: 449  AKNVSLHVNRKPLMNSTDGNDKDQRIAKLNKIIEEQQQLISQLKTNGGNKSVGLGLGLGV 508

Query: 1519 STKSKEGIYMSQDHYKNLNSDLESHKNEVQECKRE-IESLASKNSLLVKDKLKSR----- 1680
            ST    G+ ++++   N N  L   +N+V + K E  E L  K++L ++D   +      
Sbjct: 509  STAHGSGVRVTKE-IMNPNITLLRAENKVLKYKLENCEKLLDKDTLELQDSDLTEIVDML 567

Query: 1681 --------ET-IQSQNSQMESLKATINHLKAQLD------KQHKAELEISGFNNKLQKMT 1815
                    ET IQ   SQ+   +  +  L+ QL       +  K     +G N+++Q++ 
Sbjct: 568  PAGVGSLLETKIQGLQSQLRQYRRYVGQLETQLSLTTSRTEADKENYVAAGKNDEIQELR 627

Query: 1816 EVMQ------VALQDYKK 1851
             +++       ALQ  K+
Sbjct: 628  RMLERKDKIITALQSAKR 645

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 35/102 (34%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D V+ P  S   I+E +  P+     +G+N TV  YGMT +GKTYTM G      G+
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGS----GGD 190

Query: 451 LNDAAGIIPRVLLKLFDTL----ELQQSDYVVKCSFIELYNE 564
             D  G+IP  +  LF  +     + +  + V  S++E+YNE
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNE 232

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] {ON}
            Anc_3.479 YPR141C
          Length = 764

 Score =  112 bits (279), Expect = 2e-24
 Identities = 68/142 (47%), Positives = 90/142 (63%), Gaps = 3/142 (2%)
 Frame = +1

Query: 997  LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-KHQDELFRISKMNLVDLAGSENINRS 1173
            +L+R  K R  AST  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE ++ S
Sbjct: 612  VLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHSS 671

Query: 1174 GALNQRAKEAGSINQSLLTLGRVINALVDRSG--HIPFRESKLTRLLQDSLGGNTKTALI 1347
                +R +E  +IN+SL  LG VI AL D++   HIPFR SKLT LLQ SL GN+KT + 
Sbjct: 672  QVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMF 731

Query: 1348 ATISPAKVTSEETCSTLEYASK 1413
              ISP+     ET ++L +ASK
Sbjct: 732  VNISPSSSHINETINSLRFASK 753

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (2%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  DK+F  G S D +F+EV G L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 472 FKFDKIFDTGESNDEVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 520

Query: 451 LNDAAGIIPRVLLKLFDTLELQQS---DYVVKCSFIELYNE 564
           L+   G+IP  +  +FD +E  +    +Y + C F+E+YNE
Sbjct: 521 LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNE 561

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 74/385 (19%), Positives = 163/385 (42%), Gaps = 5/385 (1%)
 Frame = +1

Query: 1552 QDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQS----QNSQMESL 1719
            ++ + N+ +D+ S  +   +    I+S+ ++ S      LKS   + S    Q  ++  L
Sbjct: 84   KNKHNNVENDMNSRLSLDGKISTGIQSILNRVSGSNITSLKSHSHLASFYKQQVKELNDL 143

Query: 1720 KATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKE 1899
            + T+ + K +LD+  +  LE+     K QK     +   ++ K+++L L    +T +SK 
Sbjct: 144  QTTLYNRKMELDEL-RDNLEVRKDQLKEQKYAVGRESGSKNTKEQQLRLR---QTELSKL 199

Query: 1900 IKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKIL 2079
             + L+      LD  +      E + Q   + +  E        ++K E + +  +KK+ 
Sbjct: 200  KEDLEARKKFLLDGFKLHLKQMEVENQTKKNKLAIEY-------RDKLEAVKRVKIKKME 252

Query: 2080 NESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN 2259
            +E  +    + +++D++R +  N    + + L D++++  N+K+                
Sbjct: 253  DEKDQ----LAKEVDVLREKIANNDSTLDDMLRDVTQKYENMKE---------------- 292

Query: 2260 HHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRA 2439
                            ++++F++   +++E N+K I Q +T     + +      +P+  
Sbjct: 293  ---------------PWLKSFEVKWKENVEINEKCI-QEITELRKELEEN----LQPKAE 332

Query: 2440 KWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAIS 2619
            K ++ FD +        E  + + A L Q +K        + E IS  K  + E+E   +
Sbjct: 333  KLKSKFDSL-------KEQRDELIAKLKQQQK----EHRKIEEEISQKKTTLRETEEREA 381

Query: 2620 LLKNN-TKFNDQFKQLISKHIILKD 2691
             LK   +K     K+L    I++K+
Sbjct: 382  SLKEEISKTESDLKEL--NEILIKE 404

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
            Anc_3.479 YPR141C
          Length = 698

 Score =  111 bits (278), Expect = 2e-24
 Identities = 77/177 (43%), Positives = 102/177 (57%), Gaps = 7/177 (3%)
 Frame = +1

Query: 919  QNDQSN-GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK 1095
            ++DQ N    I N+   ++ +     N+L+R  K R  AST  N+ SSRSH+IF I L  
Sbjct: 521  RHDQENRNTTITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRSHSIFIIHLRG 580

Query: 1096 KHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 1257
             +    +E + I  +NLVDLAGSE IN S     R +E  +IN+SL  LG VI+AL    
Sbjct: 581  SNSLTGEESYGI--LNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALGGPD 638

Query: 1258 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
                HIPFR SKLT LLQ SL GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 639  QGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 50/167 (29%), Positives = 73/167 (43%), Gaps = 13/167 (7%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNER-EIGMKSSVVVNVPDITGS---------KEVSINTTGDTGITA 252
           +EL   + V CR R     I  K +  + V D             K + +N    T I  
Sbjct: 343 QELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNNATQIP- 401

Query: 253 QMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 432
               +R+  DK+F    +   +F+EV G L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 402 ----QRFKFDKIFNQTDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 433 KLYNGELNDAAGIIPRVLLKLFD---TLELQQSDYVVKCSFIELYNE 564
                 L    GIIP  +  +F+    L+ +   Y + C F+E+YNE
Sbjct: 453 ------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNE 493

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  110 bits (274), Expect = 7e-24
 Identities = 69/172 (40%), Positives = 99/172 (57%), Gaps = 5/172 (2%)
 Frame = +1

Query: 928  QSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK--H 1101
            +  G YI N+    +T+  +   +L++  K R  A+T+ N+ SSRSH++F + +  +  H
Sbjct: 535  EKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLH 594

Query: 1102 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG---H 1272
              E  +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI AL        +
Sbjct: 595  TGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRY 653

Query: 1273 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
            IPFR SKLT LLQ SL G++KT +   I P      ET ++L +ASK  + K
Sbjct: 654  IPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 49/161 (30%), Positives = 78/161 (48%), Gaps = 7/161 (4%)
 Frame = +1

Query: 103 EELNITVAVRCRGR----NEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 270
           +EL   + V CR R    NE +  M   ++    +  G++ ++IN         ++ +  
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINRN-----EGRILSYN 414

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D +F P  +   IFEE+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 415 FQFDMIFEPSHTNKEIFEEIR-QLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 463

Query: 451 LNDAAGIIPRVLLKLFD-TLELQQS--DYVVKCSFIELYNE 564
           LN   G+IP  L  +F  T  L++   +Y ++C +IE+YNE
Sbjct: 464 LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNE 504

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] {ON}
            Anc_3.479
          Length = 763

 Score =  108 bits (271), Expect = 2e-23
 Identities = 71/156 (45%), Positives = 94/156 (60%), Gaps = 11/156 (7%)
 Frame = +1

Query: 994  NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 1164
            N+L+R  K R  AST  N+ SSRSH+IF I L   ++   ++ + I  +NLVDLAGSE I
Sbjct: 602  NILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERI 659

Query: 1165 NRSGALNQRAKEAGSINQSLLTLGRVINALVD--------RSGHIPFRESKLTRLLQDSL 1320
            N S    +R +E  +IN+SL  LG VI+AL          +  HIPFR SKLT LLQ SL
Sbjct: 660  NSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSL 719

Query: 1321 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
             GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 720  IGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 7/161 (4%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNE---REIGMKSSVVVN-VPDITGSKEVSINTTGDTGITAQMNAKR 270
           +EL   + V CR R     +E    S + V+   D  G++ + I    +   +      +
Sbjct: 393 QELRGNIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSSNNSTTLK 452

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  DK+F    + D +F+EV G L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 451 LNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
           L+   GIIP  +  +F   + L+ +   Y ++C F+E+YNE
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNE 542

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 731

 Score =  108 bits (269), Expect = 3e-23
 Identities = 70/173 (40%), Positives = 97/173 (56%), Gaps = 4/173 (2%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY-KK 1098
            N ++N   + N+    + +  +   LL++  + R  AST  N+ SSRSH++F I L    
Sbjct: 541  NQETNTTTVTNVTLCPLNSEEQVDGLLRKANRLRSTASTSANERSSRSHSVFIIFLKGSN 600

Query: 1099 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG--- 1269
            H         +NLVDLAGSE IN S  L +R +E  +IN+SL  LG V++AL        
Sbjct: 601  HLTGEQSDGILNLVDLAGSERINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKR 660

Query: 1270 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
            HIPFR SKLT LLQ SL GN+KT +   IS  +    ET ++L +ASK  + K
Sbjct: 661  HIPFRNSKLTYLLQYSLTGNSKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 51/155 (32%), Positives = 75/155 (48%), Gaps = 4/155 (2%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSKEVSINTTGDTGITAQMNAKRYTVDKV 288
           NI V  R R   + E    + + VN   D  G + + I  + +TG +   N K    D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQNFK---FDRI 433

Query: 289 FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAG 468
           F    + + +FEE+ G L Q  + GYN  +  YG T +GKTYTM          LN   G
Sbjct: 434 FDQNETNENVFEEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 469 IIPRVLLKLFDTLELQQS---DYVVKCSFIELYNE 564
           IIP  +  +F  +E  +    +Y + C FIE+YNE
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNE 517

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] {ON}
            Anc_2.633 YKL079W
          Length = 644

 Score =  107 bits (268), Expect = 3e-23
 Identities = 112/415 (26%), Positives = 198/415 (47%), Gaps = 24/415 (5%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            + + + I I+NL+  ++T+ LE L+  ++G   R +AS       SRS  I  IT+ ++ 
Sbjct: 183  DSKKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRD 232

Query: 1102 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD------ 1260
               E+F+     LVDL  S+ I++   L    +    INQS++TL  V  +L        
Sbjct: 233  NVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVK 292

Query: 1261 ----RSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 1422
                RSG  +IP++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K 
Sbjct: 293  NGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKL 352

Query: 1423 IK-----NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLE 1587
            +K     NK    +  M D+L+K+                +KE  Y  Q H + L  +L 
Sbjct: 353  VKNLFQQNKAGTNSKAMLDLLMKDF--------------DAKEKNY--QSHIQLLEKELM 396

Query: 1588 SHKNEVQECKREIESLASKNSLLVKD-KLKSRETIQSQNSQMESLKATINHLKAQLDKQH 1764
            +    +++ +   E+   +N +++++ KLK++    SQ     S KA ++    + D++H
Sbjct: 397  N----LKKLQYGSETADKQNEIMLENKKLKAQLESLSQLLHSSSSKANVS---TKNDEEH 449

Query: 1765 KAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKE----IKSLKTALFLQ 1932
               + I     K +K+ EV Q+ L +       L  + E   SKE      +LK    LQ
Sbjct: 450  SKIMGI--LMEKCEKVMEV-QMRLDNEISSNKSLTSQLEFKSSKEEALAAMNLKLLEQLQ 506

Query: 1933 LDNMQQKNIF-QETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPK 2094
             +  + K++      ++ +L+   N   +  ET+ +   ++ +  V K+ N + +
Sbjct: 507  ANEEEMKDLLASNLHMRQDLEKWSNLANSRFETIGDLEGMLREVHVSKLENPAAR 561

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 34/105 (32%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +1

Query: 250 AQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 429
           A  N K + VD++F PGA        + G        GYN  ++ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFG- 122

Query: 430 EKLYNGELNDAAGIIPRVLLKLFDTLEL---QQSDYVVKCSFIEL 555
                   N   G+I  V  ++F T+E       DY +  S IE+
Sbjct: 123 -------YNKGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEV 160

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
            Anc_3.479 YPR141C
          Length = 704

 Score =  107 bits (268), Expect = 4e-23
 Identities = 74/173 (42%), Positives = 98/173 (56%), Gaps = 4/173 (2%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1101
            N ++    I N+    +T+      LL+R  K R  AST  N+ SSRSH+IF + L  ++
Sbjct: 524  NQETKETTITNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSRSHSIFIVHLSGEN 583

Query: 1102 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG--- 1269
                 R    +NLVDLAGSE IN S  + +R +E  SIN+SL  LG VI+AL        
Sbjct: 584  VLTGERSHGILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKR 643

Query: 1270 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
            HIPFR SKLT LLQ SL GN+KT +   IS     + ET ++L +ASK  + K
Sbjct: 644  HIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 62.0 bits (149), Expect = 6e-09
 Identities = 49/155 (31%), Positives = 73/155 (47%), Gaps = 4/155 (2%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSKEVSINTTGDTGITAQMNAKRYTVDKV 288
           NI V  R R    RE    + + V    D  G++ + +   G  G   Q+    +  D++
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNG-YGSGPQI----FKFDRI 408

Query: 289 FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAG 468
           F    +   +F+E+ G L Q  + GYN  +  YG T +GKTYTM          LN   G
Sbjct: 409 FNEKETNYDVFQEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPTDG 457

Query: 469 IIPRVLLKLFD-TLELQQSD--YVVKCSFIELYNE 564
           IIP  +  +F+ T  L++    Y V C F+E+YNE
Sbjct: 458 IIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNE 492

 Score = 40.8 bits (94), Expect = 0.021
 Identities = 57/279 (20%), Positives = 114/279 (40%), Gaps = 12/279 (4%)
 Frame = +1

Query: 1552 QDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATI 1731
            QD      + L+S  +E+ ECK +   +  K   LV++K    + I  +++++  LK   
Sbjct: 77   QDILFQKKAHLDSLTDEMNECKAKYRDVEFKWDTLVEEKALKYQQINLKSNELTKLKEEQ 136

Query: 1732 NHLKAQLDKQH---------KAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFET 1884
               +  +   H         K E +++   +  +   EV++ A     + E D       
Sbjct: 137  TSRRKFMHDGHGLHLQQLRAKNEADLNRIASDYRAKIEVLRFAKIQKFQNERDTLLNSVE 196

Query: 1885 HISKEIKSLKTALFLQLDNMQQKNIFQ-ETDIQPNLDMVKNEVLTLMETMQEKAELMYKD 2061
                +I      L   L   + K+  + E  +Q   D  K +V    E   E  EL  + 
Sbjct: 197  EARNKISMNSEILRSMLQERESKHSHEKEIWLQRYHDKWKADVEKNEEITDEIVELE-RQ 255

Query: 2062 CVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNN 2241
             +  +  E+ +      +K+D I+ ++QN  + +AE  S   E      Q +++     +
Sbjct: 256  VIGSLRPEAQRER----KKLDSIKEKYQNLQQELAEQESKSVELRQQTAQKIQDTKHLKD 311

Query: 2242 HQELLNHHIDSTYENIEKKTNQFV--ENFKMTLNDHLEE 2352
             +  L  +I +T   +E+ +   V  E+ + TL++ L+E
Sbjct: 312  CKRELEQYIQNTKVELEQISEIMVKEESMRRTLHNELQE 350

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 706

 Score =  107 bits (266), Expect = 6e-23
 Identities = 71/174 (40%), Positives = 98/174 (56%), Gaps = 5/174 (2%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YK 1095
            + +S   ++ N+    +T+      LL+R  K R  A+T  N+ SSRSH++F I L  Y 
Sbjct: 529  DQESQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYN 588

Query: 1096 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG-- 1269
             +  E  +   +NLVDLAGSE IN S     R +E  +IN+SL  LG VI+AL       
Sbjct: 589  SNTGEECQ-GTLNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASK 647

Query: 1270 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
             HIPFR SKLT LLQ SL G++KT +   ISP      ET ++L +ASK  + +
Sbjct: 648  RHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 68.2 bits (165), Expect = 8e-11
 Identities = 47/129 (36%), Positives = 61/129 (47%), Gaps = 9/129 (6%)
 Frame = +1

Query: 205 SKEVSINTTGDTGITAQMNAKR------YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGY 366
           S  V IN   D   T  MN  R      +  DK+F P  S D IFEE+   L Q  + GY
Sbjct: 385 SCHVHINLFNDDEGTQSMNITRDSKKHEFKFDKIFDPENSNDDIFEEIR-QLVQSSLDGY 443

Query: 367 NCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQS---DYVVK 537
           N  +  YG T +GKTYTM          L+   G+IP  L  +F  + L +    +Y + 
Sbjct: 444 NVCIFAYGQTGSGKTYTM----------LHPQNGMIPSTLDHIFQWIHLLKERGWEYEIS 493

Query: 538 CSFIELYNE 564
             FIE+YNE
Sbjct: 494 SQFIEIYNE 502

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 654

 Score =  106 bits (265), Expect = 7e-23
 Identities = 98/299 (32%), Positives = 135/299 (45%), Gaps = 19/299 (6%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            + D   G+ I  L E    ++ E L  ++ G K R+   T  N  SSRSH I  I L K 
Sbjct: 255  REDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKT 314

Query: 1099 HQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 1266
               E   +S  ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L   S   
Sbjct: 315  DLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSH 371

Query: 1267 ----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 1416
                      GHIP+R+SKLTR+LQ +L GN     I TI      S ET +TL +AS+A
Sbjct: 372  RNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRA 431

Query: 1417 KNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH-YKNLNSDLESH 1593
            KN+     L  F                 K  L S     GI   +D    +L   LE  
Sbjct: 432  KNV----SLHIFR----------------KPLLPSMSGSNGIVEEKDKTIMSLTRQLEEQ 471

Query: 1594 KNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMES----LKATINHLKAQLDK 1758
            +  + + + +  SL S +S  V     SR +     + +E+    LK  + H +  LDK
Sbjct: 472  QLLIGKLRDDTRSLPSVSSNGVGGGASSRGSSDPSTNLVETENKFLKYKLEHCEKLLDK 530

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 4/136 (2%)
 Frame = +1

Query: 172 SVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQD 351
           SVV+ +    G +E+      D       +   +  D VF    +   ++ + + P+   
Sbjct: 90  SVVIRLKP-NGGRELDPWFVRDEHTMQHADYGEFKYDHVFKTACNNVEVYAQTSKPMIDR 148

Query: 352 FIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTL--ELQQSD 525
             +G N TV  YGMT +GKT+TM G E        +  G+IP  +  L+  +  E  Q D
Sbjct: 149 VFEGLNATVFAYGMTGSGKTFTMAGTE--------ETLGLIPLSVAYLYSRVMEESLQGD 200

Query: 526 --YVVKCSFIELYNEE 567
             + +  S++E+YNE+
Sbjct: 201 SRFEIAVSYLEIYNEK 216

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
            Ashbya gossypii AGR253W
          Length = 711

 Score =  106 bits (265), Expect = 9e-23
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 5/166 (3%)
 Frame = +1

Query: 946  IQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 1125
            I N+ +  +T+  +  ++L+R  + R  A T+ N+ SSRSH++F + +   H D+   +S
Sbjct: 543  ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQTGEVS 601

Query: 1126 --KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRES 1290
              K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI AL        HIPFR S
Sbjct: 602  HGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 1291 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
            KLT LLQ SL G++KT +   I   +  + ET ++L +ASK  + K
Sbjct: 662  KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 36/98 (36%), Positives = 51/98 (52%), Gaps = 3/98 (3%)
 Frame = +1

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
           DK+F P  +   +F+E+   L Q  + GYN  +  YG T +GKTYTM          LN 
Sbjct: 420 DKIFEPHNTNADVFQEIC-QLVQCSLDGYNVCIFAYGQTGSGKTYTM----------LNP 468

Query: 460 AAGIIPRVLLKLFD-TLELQQSD--YVVKCSFIELYNE 564
             G+IP  L  +F  T +L +    Y + C +IE+YNE
Sbjct: 469 GDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNE 506

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3.479
            YPR141C
          Length = 676

 Score =  105 bits (263), Expect = 1e-22
 Identities = 69/181 (38%), Positives = 103/181 (56%), Gaps = 6/181 (3%)
 Frame = +1

Query: 904  RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTI 1083
            R  +  +D S    ++NL+   +T+      +L+  +K R  AST  N+ SSRSH+IF I
Sbjct: 492  RHKIHHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFII 551

Query: 1084 TLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 1254
             ++  ++   +E  R   +NL+DLAGSE ++ S   ++R KE   IN+SL  LG V+N+L
Sbjct: 552  KIHGINEGLGEE--RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSL 609

Query: 1255 VDRSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 1425
                    HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A K  + 
Sbjct: 610  GSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNST 669

Query: 1426 K 1428
            K
Sbjct: 670  K 670

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 3/103 (2%)
 Frame = +1

Query: 268 RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 447
           +Y+ DKVF    +   IF+EV+  L Q  + G+N  +  YG T +GKT+TM         
Sbjct: 382 KYSFDKVFSQTDTNQEIFKEVS-ELIQSSLDGFNVCIFAYGQTGSGKTFTM--------- 431

Query: 448 ELNDAAGIIPRVLLKLFDTLELQQSD---YVVKCSFIELYNEE 567
            LN   GIIP     +FD ++    +   Y V C F+E+YN+E
Sbjct: 432 -LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDE 473

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
            similar to Ashbya gossypii ACR145W
          Length = 687

 Score =  105 bits (263), Expect = 1e-22
 Identities = 99/400 (24%), Positives = 186/400 (46%), Gaps = 22/400 (5%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ + +L E  + +  E +  +  G K+R+   T  N  SSRSH I  + L + 
Sbjct: 269  RDDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRC 328

Query: 1099 HQDELFRI-SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 1266
                   + S ++L DLAGSE   R+     R KE   IN+SLL LG VI  L   S   
Sbjct: 329  ELKTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGS 385

Query: 1267 -------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 1407
                         GHIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+ +A
Sbjct: 386  GSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFA 445

Query: 1408 SKAKNIK---NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNS 1578
            S+AKNI     K ++     KD +++N+  +L +  + + + +        +   + ++S
Sbjct: 446  SRAKNISLNVRKNEMDTSNEKDSIIQNLRKQLDEQHATIAALRRNNSTSSRKLDNRRVSS 505

Query: 1579 --DLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQL 1752
               L    + +++   E+E+   K  L   +KL  ++ +  ++  +  +   +       
Sbjct: 506  GGSLTERAHNMEKGLLEVENNILKTKLEHCEKLLDKDMVVLEDPHVREIVDMLPQ----- 560

Query: 1753 DKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQ 1932
            D     E ++ G  ++L++    +Q    D  K + ++    ETH + +     T     
Sbjct: 561  DIASVLESKVQGMESQLRQYRHYVQRLESDLIKSQKNI---IETH-TVQFNRQSTV---- 612

Query: 1933 LDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELM 2052
              N+Q+K    E D++  L+  ++E++ L   ++ K +++
Sbjct: 613  --NIQEK-YGGEIDVELLLEEQESELIELRRALERKDKMI 649

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 32/104 (30%), Positives = 54/104 (51%), Gaps = 5/104 (4%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VF    +   ++  +  P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 451 LNDAAGIIPRVLLKLFD-----TLELQQSDYVVKCSFIELYNEE 567
                G+IP  +  +FD     T +  +  Y VK S++E+YNE+
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEK 240

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
            KAR3Minus-end-directed microtubule motor that functions
            in mitosis and meiosis, localizes to the spindle pole
            body and localization is dependent on functional Cik1p,
            required for nuclear fusion during mating; potential
            Cdc28p substrate
          Length = 729

 Score =  105 bits (261), Expect = 3e-22
 Identities = 66/148 (44%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = +1

Query: 997  LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 1173
            +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577  ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 1174 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 1344
              +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637  QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 1345 IATISPAKVTSEETCSTLEYASKAKNIK 1428
               ISP+     ET ++L +ASK  + +
Sbjct: 697  FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 50/158 (31%), Positives = 77/158 (48%), Gaps = 4/158 (2%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNE-REIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 279
           +EL   + V CR R   + +    + ++NV +   +  V          TAQ++  ++  
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKF-- 438

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
           DK+F    +   +F+EV G L Q  + GYN  +  YG T +GKT+TM          LN 
Sbjct: 439 DKIFDQQDTNVDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 460 AAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
             GIIP  +  +F   + L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNE 525

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
            complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  104 bits (260), Expect = 3e-22
 Identities = 67/150 (44%), Positives = 89/150 (59%), Gaps = 6/150 (4%)
 Frame = +1

Query: 997  LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 1167
            L+++  K R  A+T  N+ SSRSH+IF I L   +    +  + I  +NLVDLAGSE +N
Sbjct: 539  LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGI--LNLVDLAGSERLN 596

Query: 1168 RSGALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKT 1338
             S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT
Sbjct: 597  SSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKT 656

Query: 1339 ALIATISPAKVTSEETCSTLEYASKAKNIK 1428
             +   ISP +   +ET ++L +ASK    K
Sbjct: 657  LMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 3/103 (2%)
 Frame = +1

Query: 265 KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 444
           +++  D++F        +F+E+ G L Q  + GYN  +  YG T +GKT+TM        
Sbjct: 395 QKFQFDRIFDQHEVNKDVFDEI-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM-------- 445

Query: 445 GELNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
             LN   G+IP  +  +F   D+L+ +  +Y V C F+E+YNE
Sbjct: 446 --LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNE 486

 Score = 40.8 bits (94), Expect = 0.020
 Identities = 49/259 (18%), Positives = 113/259 (43%), Gaps = 12/259 (4%)
 Frame = +1

Query: 2140 FQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVEN 2319
            FQN  +  +EN   +   N+NL  +   +  + N  +    +  +  ++++ + N++ EN
Sbjct: 36   FQNKSQEHSENAPVLQRSNSNLTSFYNQNLTELNELQDNLFNKKTKLDSLKDELNEYKEN 95

Query: 2320 FKMTLN--DHLEENKKLIMQNMTNATSAVI---DQ---EMDLFEPRRAKWENSFDLINKC 2475
            +K   +  ++L E++    + ++  T+ +I   DQ   + D      A         N  
Sbjct: 96   YKEIQSKWENLRESRVYKQEQLSLKTNELIKLKDQFKCKEDFMNKEHALKLKQMKASNTS 155

Query: 2476 D--SMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFND 2649
            D   ++N++ +++     +  K  +   N++ + ++++K ++  S N   + KNN + + 
Sbjct: 156  DISRLSNKYMSDIDKLKFEKIKKYEQERNNLLDEVNIIKEKI--SNNYTIVKKNNDEADS 213

Query: 2650 QFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENA--TKDEMIDN 2823
            +F+Q   K   LK+                D++ N   D+  N   K N+  +K E +  
Sbjct: 214  KFEQ--EKSSWLKELDSNISSNEELKKKYNDEVTNLTNDLNDNLNPKLNSQISKLESLKC 271

Query: 2824 ILKEIPNLSKRLPLRISNI 2880
             L E+ ++       +S+I
Sbjct: 272  KLDELKSIMNEKKKHVSDI 290

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  104 bits (259), Expect = 4e-22
 Identities = 102/402 (25%), Positives = 186/402 (46%), Gaps = 24/402 (5%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK- 1095
            ++D   G+ + +L E  +++  + +  +  G ++R+   T  N  SSRSH I  + L + 
Sbjct: 268  RDDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRY 327

Query: 1096 --KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV---- 1257
              K   E    S ++L DLAGSE   R+     R KE   IN+SLL LG VI  L     
Sbjct: 328  DLKTGSEA--TSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGS 382

Query: 1258 --------DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 1413
                      +GHIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +AS+
Sbjct: 383  QANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASR 442

Query: 1414 AKNIK---NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNS-- 1578
            AKNI     K ++ +   KD +++N+  +L +    ++  +              L+S  
Sbjct: 443  AKNIALNVRKNEMDSHAEKDTIIQNLRKQLDEQHETIVMLRRSAAAPSGNGSTSPLDSPG 502

Query: 1579 ----DLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKA 1746
                 L    + +++   E+E+   K  L   +KL  ++ +  ++  +  +   +     
Sbjct: 503  VGGTSLSERTHNMEKGLLEVENSILKTKLEHCEKLLDKDMMVLEDPHVREIVEML----- 557

Query: 1747 QLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALF 1926
             LD     E ++ G  ++L++    +Q    D  K + ++     TH S +     TA  
Sbjct: 558  PLDIASVLESKVQGMESQLRQYRVYVQKLESDLLKAQRNI---ITTH-SVQFNRQSTA-- 611

Query: 1927 LQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELM 2052
                N+Q+K    + DI+  L+  + E++ L   ++ K +++
Sbjct: 612  ----NVQEK-YGSDVDIELLLEEQEAELMELRNALKRKDKMI 648

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 32/103 (31%), Positives = 56/103 (54%), Gaps = 4/103 (3%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VF  G     +++ +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSD----YVVKCSFIELYNEE 567
                G+IP+ +  +FD +  +       Y VK S++E+YNE+
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEK 240

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  104 bits (259), Expect = 4e-22
 Identities = 107/419 (25%), Positives = 185/419 (44%), Gaps = 41/419 (9%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L E    ++ E +N + +G K R+ A T  N  SSRSH I  I L   
Sbjct: 274  RDDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTS 333

Query: 1099 HQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 1266
               +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L   S   
Sbjct: 334  DMKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKN 390

Query: 1267 ------------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1374
                                    GHIP+R+SKLTRLLQ +L G++    I TI     +
Sbjct: 391  RSPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNES 450

Query: 1375 SEETCSTLEYASKAKNI----KNKPQLGA---FMMKDILVKNITMELAKIKSDLLST--- 1524
            S ET +TL +AS+AKNI      KP +        K+  +  +T +L + +  L+ST   
Sbjct: 451  SAETLNTLRFASRAKNISLHVNRKPLVHTGEDSDDKNYKIMQLTKKLQE-QQQLISTLRQ 509

Query: 1525 KSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNS 1704
              K    +S   Y ++      +  +        E+   K+ L   +KL  ++T++  + 
Sbjct: 510  DDKSLNKVSSSVYDHMPGTTSGNLIDPTIALIYAENKVLKHKLTNCEKLLDKDTVELDDP 569

Query: 1705 QMESLKATINHLKAQLDKQHKAELEISGFNNKL---QKMTEVMQVALQDYKKRELDLNKK 1875
            ++  +   + +    L      E +I G  ++L   ++ T  ++  ++D++      +++
Sbjct: 570  EIIEIVEMLPYEVGSL-----LETKIQGLQSQLRQYKEYTNELESKIRDFENANKGTSRQ 624

Query: 1876 FETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELM 2052
            +    S  I            N  ++NI Q+ +         N++L L + +  K +++
Sbjct: 625  YPNKGSPSI-----------SNSNKENIIQDKE---------NQILELQKMLNRKDKMI 663

 Score = 55.5 bits (132), Expect = 6e-07
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 4/115 (3%)
 Frame = +1

Query: 235 DTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 414
           D    A  +   +  D VF    S   I++ +  P+     +G+N T+  YGMT +GKTY
Sbjct: 125 DEKTIAHDDVGEFKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTY 184

Query: 415 TMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSD----YVVKCSFIELYNEE 567
           TM G       E     G+IP  +  LF  +  +  D    + +  S++E+YNE+
Sbjct: 185 TMMGCP-----EREQKDGLIPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEK 234

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
            YPL155C
          Length = 696

 Score =  104 bits (259), Expect = 4e-22
 Identities = 94/364 (25%), Positives = 167/364 (45%), Gaps = 37/364 (10%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   GI +  L E   ++  + +  ++ G K+++++ T+ N  SSRSH+I  + L   
Sbjct: 242  RDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIAT 301

Query: 1099 HQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG-- 1269
              +  +   S ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI  L   S   
Sbjct: 302  DLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQH 358

Query: 1270 -----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 1398
                             HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL
Sbjct: 359  RNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTL 418

Query: 1399 EYASKAKNIK----NKPQLGAFMMKDILVKNITMEL---AKIKSDLLSTKSKEGIYMSQD 1557
             +AS+AKN+      K  +     KD L+  +  +L    K+  D+   K    +   + 
Sbjct: 419  RFASRAKNVSLHVTKKQNVSKDEEKDKLIFTLIQQLEEQKKLIDDMNVNKMSGNVLNFEK 478

Query: 1558 HYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINH 1737
            H     +++ ++ N        I++  ++ S +V     S   ++S+N   + LK  + H
Sbjct: 479  HAVPFANEMVANANSGP--NNNIDTSRTEKSNIVD---PSYALLESEN---KVLKFKLEH 530

Query: 1738 LKAQLDKQ----------HKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETH 1887
             +  LDK           +  E+   G    L+   + ++  ++ YK    +L K+  ++
Sbjct: 531  CENLLDKDIVELQDRQMINIVEMLPDGVGTLLEMKFQGLESQIRQYKLYTANLEKRLASN 590

Query: 1888 ISKE 1899
             + E
Sbjct: 591  KNDE 594

 Score = 64.7 bits (156), Expect = 9e-10
 Identities = 39/135 (28%), Positives = 65/135 (48%), Gaps = 4/135 (2%)
 Frame = +1

Query: 175 VVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDF 354
           +V   P    + E  +    D    A  +   + +D++F    S   I+ E+  PL    
Sbjct: 77  IVAIRPKPISNNEKKVWNIVDNKRIAHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKL 136

Query: 355 IKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLE----LQQS 522
             GYN T+  YGMT +GKT+TM+G +        +  G+IP  +  LF+T+     L + 
Sbjct: 137 AMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKK 188

Query: 523 DYVVKCSFIELYNEE 567
            Y +  S++E+YNE+
Sbjct: 189 KYEMLVSYMEIYNEK 203

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
            YPR141C (REAL)
          Length = 729

 Score =  104 bits (259), Expect = 5e-22
 Identities = 66/148 (44%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = +1

Query: 997  LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 1173
            +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577  ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 1174 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 1344
              +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637  QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 1345 IATISPAKVTSEETCSTLEYASKAKNIK 1428
               ISP+     ET ++L +ASK  + +
Sbjct: 697  FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 48/158 (30%), Positives = 76/158 (48%), Gaps = 4/158 (2%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNERE-IGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 279
           +EL   + V CR R   E +    + ++ V +   ++   + +   T I +      +  
Sbjct: 381 QELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNR--GVQSMEVTKIQSTTQVHEFKF 438

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
           DK+F    + + +F+EV G L Q  + GYN  +  YG T +GKT+TM          LN 
Sbjct: 439 DKIFDQQNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNT 487

Query: 460 AAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
             GIIP  +  +F   + L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNE 525

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
            YPR141C (REAL)
          Length = 729

 Score =  104 bits (259), Expect = 5e-22
 Identities = 66/148 (44%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = +1

Query: 997  LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 1173
            +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577  ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 1174 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 1344
              +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637  QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 1345 IATISPAKVTSEETCSTLEYASKAKNIK 1428
               ISP+     ET ++L +ASK  + +
Sbjct: 697  FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 68.2 bits (165), Expect = 8e-11
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 4/158 (2%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSV-VVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 279
           +EL   + V CR R   E    S   ++NV +   +  +          TAQ++  ++  
Sbjct: 381 QELRGNIRVYCRIRPALETLEDSDTSLINVNEFDDNCGIQSMEVTKIHNTAQVHEFKF-- 438

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
           DK+F    +   +F+EV G L Q  + GYN  +  YG T +GKT+TM          LN 
Sbjct: 439 DKIFDQKDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 460 AAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
             GIIP  +  +F   + L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE 525

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
            YPR141C (REAL)
          Length = 731

 Score =  104 bits (259), Expect = 5e-22
 Identities = 67/148 (45%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = +1

Query: 997  LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 1173
            +L+R  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 576  VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 1174 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 1344
              +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 636  QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 1345 IATISPAKVTSEETCSTLEYASKAKNIK 1428
               ISP+     ET ++L +ASK  + +
Sbjct: 696  FVNISPSSSHINETLNSLRFASKVNSTR 723

 Score = 69.7 bits (169), Expect = 3e-11
 Identities = 50/158 (31%), Positives = 78/158 (49%), Gaps = 4/158 (2%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNERE-IGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 279
           +EL   + V CR R   E +    + ++NV +   ++ V          T Q++  ++  
Sbjct: 381 QELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNRGVQSMEVTKIQNTPQVHEFKF-- 438

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
           DK+F    + + +F+EV G L Q  + GYN  +  YG T +GKT+TM          LN 
Sbjct: 439 DKIFDQRNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 460 AAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 564
             GIIP  +  +F   + L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE 525

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 44/186 (23%), Positives = 87/186 (46%), Gaps = 11/186 (5%)
 Frame = +1

Query: 1480 ITMELAKIKSDLLSTKSKEGIYMS------QDHYKNLNSDLESHKNEVQECKREIESL-- 1635
            IT+  + ++  L  ++ K+G+         Q  +KN       H N++   K+EIE++  
Sbjct: 234  ITLNPSTLQEMLDESEQKQGLEKEEWLTEYQAQWKNSIELNNKHMNDIDNIKKEIENVLR 293

Query: 1636 --ASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 1809
               S+   ++ +K K  ET++    ++E  K     L+ ++  + KA  E       L+K
Sbjct: 294  PKLSEKKRILTEKHKEYETLK---LKVEEKKEETTKLRNEVASKEKANQE------TLEK 344

Query: 1810 MTEVMQVALQDY-KKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPN 1986
            + E     L++Y K  EL + +  E  I +E  +++  L  +L  + + NI     I+P 
Sbjct: 345  IKE-----LEEYIKDTELGMKELNEILIKEE--TVRRTLHNELQEL-RGNIRVYCRIRPP 396

Query: 1987 LDMVKN 2004
            L+ ++N
Sbjct: 397  LESLEN 402

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] {ON}
            similar to uniprot|P28743 Saccharomyces cerevisiae
            YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  103 bits (257), Expect = 7e-22
 Identities = 104/396 (26%), Positives = 176/396 (44%), Gaps = 63/396 (15%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L +     + E L+ + +G K+R+ + T+ N  SSRSH I  I L  K
Sbjct: 262  RDDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISK 321

Query: 1099 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDRSG- 1269
              +     I  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+ L  + +G 
Sbjct: 322  DIRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGS 378

Query: 1270 -----------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSE 1380
                                   HIP+R+SKLTRLLQ +L G++    + TI  A  +S 
Sbjct: 379  HHTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSS 438

Query: 1381 ETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 1560
            ET +TL +AS++KN+         +    + K I        S    +K   G   S+  
Sbjct: 439  ETLNTLRFASRSKNVA--------LDVSRVYKRINRSAHPFSS---PSKLDGGDDRSEQR 487

Query: 1561 YKNLNSDLESHKNEVQECKREIESLAS------------------KNSLLVKDKLKSRET 1686
             + L   L++   E+ + +     +AS                  K +LL+K+KLK  E+
Sbjct: 488  IQELLIQLQTRDRELAKLREVSAGVASGTMNGAQQNLHPDTQLLTKENLLLKNKLKHYES 547

Query: 1687 I-----------QSQNSQMESLKATINHLKAQLD-KQHKAELEISGFNNKLQKMTEVM-- 1824
            +            ++N+   S  +T+      LD K   A    +G + +L+++ +++  
Sbjct: 548  LLVEDGMGVSGASTRNTSNSSSSSTLVSSSPALDNKGRYAGTNSTGVDAELEEIAQLLPS 607

Query: 1825 QVALQ-----DYKKRELDLNKKFETHISKEIKSLKT 1917
            +VA+      D  +R+L    ++   + K++    T
Sbjct: 608  EVAVMLETKFDNLRRQLQSAHRYSESLEKQLNDSHT 643

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 44/128 (34%), Positives = 62/128 (48%), Gaps = 4/128 (3%)
 Frame = +1

Query: 196 ITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCT 375
           I G K +S N  GD           +T D VF  G S   I+ +   PL    I+GYN T
Sbjct: 119 IHGDKVISHNDIGD-----------FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNAT 167

Query: 376 VLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTL----ELQQSDYVVKCS 543
           +  YGMT +GKT+TM+G E        +  G+IP  +  LF +L      +     V  S
Sbjct: 168 IFAYGMTGSGKTFTMSGTE--------EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVS 219

Query: 544 FIELYNEE 567
           ++E+YNE+
Sbjct: 220 YLEIYNEK 227

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa] {ON}
            similar to uniprot|P17119 Saccharomyces cerevisiae
            YPR141C KAR3 Minus-end-directed microtubule motor that
            functions in mitosis and meiosis localizes to the spindle
            pole body and localization is dependent on functional
            Cik1p required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 702

 Score =  102 bits (255), Expect = 1e-21
 Identities = 69/174 (39%), Positives = 98/174 (56%), Gaps = 5/174 (2%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YK 1095
            +++S   +I N+    +T+      +L+R LK R  A+T  N  SSRSH++F I L  Y 
Sbjct: 525  DNESRTTHITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYN 584

Query: 1096 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG-- 1269
                E      +NLVDLAGSE I+      +R +E  +IN+SL  LG VI+AL       
Sbjct: 585  TISGEK-STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASK 643

Query: 1270 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
             HIPFR SKLT LLQ SL G++KT +   +SP   +  ET ++L +A+K  + K
Sbjct: 644  RHIPFRNSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 61.6 bits (148), Expect = 8e-09
 Identities = 49/156 (31%), Positives = 71/156 (45%), Gaps = 5/156 (3%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAK--RYTVDK 285
           NI V  R R   E E    SS+ +         E   + TG   IT + ++K  ++T D+
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEI---------EKFSDETGMQSITIKRDSKQHKFTFDR 413

Query: 286 VFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAA 465
            F    +   +F E+ G L Q  + GYN  +  YG T +GKT+TM          LN   
Sbjct: 414 CFSAQETNGDVFSEI-GQLIQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPND 462

Query: 466 GIIPRVLLKLFDTLELQQS---DYVVKCSFIELYNE 564
           GIIP  L  +F  +E  +     Y +   F+E+YNE
Sbjct: 463 GIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNE 498

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
            complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score =  102 bits (254), Expect = 2e-21
 Identities = 100/381 (26%), Positives = 176/381 (46%), Gaps = 30/381 (7%)
 Frame = +1

Query: 934  NGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DE 1110
            NG  ++NL+   +   LE L +L       Q    + N+   RSHTI  +++ K+++ DE
Sbjct: 191  NGFQVENLRTTQVLT-LEELKILINICLLNQ--KERHNNLIQRSHTIMEVSIEKRNKLDE 247

Query: 1111 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DRSGHI--- 1275
               +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN LV  +R G I   
Sbjct: 248  SITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTD 307

Query: 1276 --------PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1431
                    P++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+   
Sbjct: 308  ISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANT 367

Query: 1432 KPQLGAFMMKDILVKNITMELAKIKSDLL-----STKSKEGIYMSQ-----DHYKNLNSD 1581
             P++  F +      +I +   K+K D       +  ++    M+Q     D  K  N++
Sbjct: 368  NPRINRFGLNSKATMDIFLTDMKLKEDNFISITNNLTNQVNNLMTQANSLEDELK--NNE 425

Query: 1582 LESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQ 1761
             + +K E    K ++E+L     LL     +S+  +++QN   E L   +         +
Sbjct: 426  TKYNKKETNILKSQVETL---TELLNNPNNRSQVDLRNQNENTEILTKLLEKC------E 476

Query: 1762 HKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFE------THISKEIKSLKTAL 1923
            H A LE+S  ++K++++  +++    +YK R        +      T +  ++KSL    
Sbjct: 477  HNASLELS-LDDKMKEIL-ILRRRESEYKARIASTETMNQHLLDRVTELELQMKSLLVGN 534

Query: 1924 FLQLDNMQQKNIFQETDIQPN 1986
                  +  +N+ Q + + PN
Sbjct: 535  SNFEIGIDNENMGQYSSLTPN 555

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 41/129 (31%), Positives = 68/129 (52%), Gaps = 12/129 (9%)
 Frame = +1

Query: 217 SINTTGDTGITA----QMNAKRYTVDKVFGPGASQDLIFE--EVAGPLFQDFIKGYNCTV 378
           SIN T DT +T     Q+   +Y  DKVF   AS D   E  E      +  ++GYN ++
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVF---ASNDTGVEHQEFIESNLESLLQGYNTSI 107

Query: 379 LVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSD------YVVKC 540
           + YG + TGK++ + G+++          G+I ++L KLF+ ++ +  +      Y VK 
Sbjct: 108 VTYGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKF 158

Query: 541 SFIELYNEE 567
           SF+E+Y E+
Sbjct: 159 SFLEVYQEK 167

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 690

 Score =  101 bits (252), Expect = 3e-21
 Identities = 64/163 (39%), Positives = 93/163 (57%), Gaps = 2/163 (1%)
 Frame = +1

Query: 946  IQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DELFRI 1122
            I N+    +        +L+   K + +A+T  N+ SSRSH++FTI ++  +        
Sbjct: 524  ITNVTSIKLETRARVNTVLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD 583

Query: 1123 SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS-GHIPFRESKLT 1299
              +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI AL  +   HIPFR SKLT
Sbjct: 584  GVLNLVDLAGSERIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLT 643

Query: 1300 RLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
             LLQ SL G++KT +   +SP+    +ET ++L +ASK  + K
Sbjct: 644  YLLQYSLIGDSKTLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 78.2 bits (191), Expect = 6e-14
 Identities = 56/156 (35%), Positives = 75/156 (48%), Gaps = 4/156 (2%)
 Frame = +1

Query: 112 NITVAVRCRGRNEREIGMKSSV-VVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKV 288
           NI V  R R   E E+   S + V N  +  GS+ + I+         +    R+  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISN--------EDRNSRFLFDKV 409

Query: 289 FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAG 468
           F   AS   +FEEV G L Q  + GYN  +  YG T +GKTYTM          +ND  G
Sbjct: 410 FSSNASNRDVFEEV-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDG 458

Query: 469 IIPRVLLKLFDTLELQQS---DYVVKCSFIELYNEE 567
           +IP  L  +FD   L +    DY  +  FIE+YNE+
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQ 494

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 59/306 (19%), Positives = 130/306 (42%), Gaps = 24/306 (7%)
 Frame = +1

Query: 1528 SKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKS--------RE 1683
            SK+G  +     +  +S     +  ++    +++S+  + SL    + +S        +E
Sbjct: 13   SKDGSNIPSPTQQGSSSPKYKPRQSIRLNPEDVQSINRRRSLTPSTENRSSTHMTFFYKE 72

Query: 1684 TIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELD 1863
             ++  N   E L      L    D+ +  + ++     K+  + E  QV ++    ++ +
Sbjct: 73   NLKELNRLQEELSRKKIKLNTAQDEMNSLKSKVETVEFKMNNLKEEKQVKVRQIGLKQNE 132

Query: 1864 LNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQ--ETDIQPNLDMVKNEVLTLMETMQE 2037
            LN   + H  K ++ ++    L++  ++ K   +  ET+ +   ++ + E   + +  QE
Sbjct: 133  LNSMDQDHELK-LEFMRNGFDLEIKKIEGKYHCEMNETESKFKFEVQQIEFEKIQKFKQE 191

Query: 2038 KAELMYKDC--VKKILNESPKFFNVIVEKIDII--------RIEFQNFYKNIAENLSDIS 2187
            K  L+ KD   +   +N +    N + E++D           +EFQ  +KNI E    + 
Sbjct: 192  KEHLL-KDIHNLNDEVNNNDNVINQLKEELDKKYSNLKEKWMVEFQTEWKNITEANQSMI 250

Query: 2188 EENNNLKQYLKNHFFKNNHQELLNHHI-DSTYENIEKKTNQ---FVENFKMTLNDHLEEN 2355
            ++ N L Q ++N       Q     +I +     +E+K N+   F E+  + ++   EE 
Sbjct: 251  KDINKLSQDIENDMTNELDQSKDKRNILEKELAKLEEKLNEKNVFKESITVQIDTVEEEI 310

Query: 2356 KKLIMQ 2373
            ++ I Q
Sbjct: 311  EQTISQ 316

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 678

 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 97/376 (25%), Positives = 174/376 (46%), Gaps = 55/376 (14%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D  +G+ +  L E  + ++ + L  ++ G  +R+   T  N  SSRSH I TI   K 
Sbjct: 268  RDDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTI---KV 324

Query: 1099 HQDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 1266
               EL       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L   S
Sbjct: 325  TCTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVS 381

Query: 1267 G----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 1398
            G                H+P+R+SKLTR+LQ +L G++    I TI        ET +T+
Sbjct: 382  GASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTI 441

Query: 1399 EYASKAKNIK---NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK- 1566
             +AS+AKN+     + +  A   KD L+ ++  +L + + DL+    +      Q   + 
Sbjct: 442  RFASRAKNVSMTVKRNEAEATHDKDELLHSLRRQLDE-QQDLICELRRAQPPADQSSCEA 500

Query: 1567 ----------NLNSDLESHKNEVQECKR----------------EIESLASKNSLLVKDK 1668
                       L  + E+ K ++Q C+R                 +E L      L++ K
Sbjct: 501  TPLGPSATVLMLRRENETLKKKLQHCERLLDKDDAAVEDEQFVEIVEMLPPAVGALLESK 560

Query: 1669 LKSRET-IQSQNSQMESLKATINHLKAQ---LDKQHKAELE-ISGFNNKLQKMTEVMQVA 1833
            ++  E+ ++   +    L+  ++  +A+   + +Q +A+ + +SG +  LQ++    +  
Sbjct: 561  IQGLESQLREHRAYTAQLEQRLSEAEAEARLVTQQARAQAQTLSGDDGTLQRVVREQEEE 620

Query: 1834 LQDYKKRELDLNKKFE 1881
            L++ ++     NK  +
Sbjct: 621  LEELQRSLARKNKMLD 636

 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 3/99 (3%)
 Frame = +1

Query: 280 DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 459
           DKVF P  +   ++EE+  P+     +GYN T+  YGMT +GKT+TM+G          D
Sbjct: 143 DKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSG--------TRD 194

Query: 460 AAGIIPRVLLKLFDTL---ELQQSDYVVKCSFIELYNEE 567
            AG+I   + ++F  +    +    Y V+ S++E+YNE+
Sbjct: 195 EAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEK 233

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
            KIP2Kinesin-related motor protein involved in mitotic
            spindle positioning, stabilizes microtubules by targeting
            Bik1p to the plus end; Kip2p levels are controlled during
            the cell cycle
          Length = 706

 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 68/201 (33%), Positives = 97/201 (48%), Gaps = 32/201 (15%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296  RDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 1099 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 1254
            + ++   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L       
Sbjct: 356  NVKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNS 412

Query: 1255 ------------------------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1362
                                       S HIP+R+SKLTRLLQ +L G++    I T+  
Sbjct: 413  VGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 1363 AKVTSEETCSTLEYASKAKNI 1425
                + ET +TL +AS+AKN+
Sbjct: 473  RNDAAAETMNTLRFASRAKNV 493

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 31/102 (30%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VF    +   ++E  + P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSD----YVVKCSFIELYNE 564
                G+IP  +  LF  +  Q  +    + V  S++E+YNE
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNE 256

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
            (REAL)
          Length = 715

 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 101/379 (26%), Positives = 165/379 (43%), Gaps = 75/379 (19%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L E    ++ + L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296  RDDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 1099 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDR--- 1263
              +D   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  D+   
Sbjct: 356  DVRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNS 412

Query: 1264 ---------------------------------SGHIPFRESKLTRLLQDSLGGNTKTAL 1344
                                             S HIP+R+SKLTRLLQ +L G++    
Sbjct: 413  VGSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTT 472

Query: 1345 IATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMM-------KDILVKNITMELAKI 1503
            I T+      + ET +TL +AS+AKN+       + +        KD  ++ +  +L   
Sbjct: 473  ICTVDTRNDAAAETMNTLRFASRAKNVSLHVSKKSIINNGNYDGDKDRTIELLRRQLEDQ 532

Query: 1504 KSDLLSTKSKEGI------YMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKD 1665
               +   K +  +        ++++YK+ N+ + SHK +      + E+   K  L   +
Sbjct: 533  HRLISELKDRANLGERSTQSSNENNYKD-NNVIVSHK-DPNLALMKAENRILKYKLDNCE 590

Query: 1666 KLKSRETIQSQNSQMES------------LKATINHLKAQLDKQHK---------AELEI 1782
            KL  ++ +  Q+S++              L+  I  L++Q+ +  K           +E 
Sbjct: 591  KLLDKDVVDLQDSEIMEIVEMLPLEVGTLLETKIQGLESQIRQYRKYTQKLEDKIMAMEK 650

Query: 1783 SGFNNKLQKM---TEVMQV 1830
            SG+N KL      TEVM++
Sbjct: 651  SGYNAKLSAPCDGTEVMEL 669

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 4/102 (3%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VF    +   ++E+ + P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSD----YVVKCSFIELYNE 564
                G+IP  +  LF  +  Q  +    + V  S++E+YNE
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNE 256

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
            YPL155C (REAL)
          Length = 706

 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 70/201 (34%), Positives = 96/201 (47%), Gaps = 32/201 (15%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L E    +  E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296  RDDSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTST 355

Query: 1099 HQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 1254
              +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L       
Sbjct: 356  DVNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTS 412

Query: 1255 VDR------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1362
            VD                         S HIP+R+SKLTRLLQ +L G++    I T+  
Sbjct: 413  VDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 1363 AKVTSEETCSTLEYASKAKNI 1425
                + ET +TL +AS+AKN+
Sbjct: 473  RNDAAAETMNTLRFASRAKNV 493

 Score = 59.3 bits (142), Expect = 4e-08
 Identities = 32/102 (31%), Positives = 52/102 (50%), Gaps = 4/102 (3%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VF    +   ++E    P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSD----YVVKCSFIELYNE 564
                G+IP  +  LF  +  Q  D    + V  S++E+YNE
Sbjct: 218 ---ELGLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNE 256

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
            Anc_2.633 YKL079W
          Length = 682

 Score = 90.9 bits (224), Expect = 7e-18
 Identities = 86/381 (22%), Positives = 169/381 (44%), Gaps = 31/381 (8%)
 Frame = +1

Query: 928  QSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ- 1104
            +  G+ + NL++ H+ +  E L    + +    V ++K ++   R++TIF I + K  + 
Sbjct: 205  EHKGLPVDNLRQVHVASFKETLYYFNQAMS---VLNSKHDNSFPRTNTIFNINIEKLDKL 261

Query: 1105 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS------ 1266
            DE    S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I +L   S      
Sbjct: 262  DESTTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKN 321

Query: 1267 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1428
                    +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K
Sbjct: 322  YEFSLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSK 381

Query: 1429 NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNS--------DL 1584
              PQ+  F + +    +I +E  K+K +    +  E +   ++    + +        +L
Sbjct: 382  TVPQINKFGLNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEESIVLEEL 441

Query: 1585 ESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQH 1764
               ++E  + K ++ +L     L+V  KL S   +   N  + +  A  N        + 
Sbjct: 442  NKLRSENAKLKAQVNTL---TQLMVSPKLASPSPMLENNKTVRNNSAERN--------ET 490

Query: 1765 KAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTA-------- 1920
              E  +     K +K+ +  +++L D K +++ + K+    I   I S++T         
Sbjct: 491  SYENVVQTLMEKCEKLADT-ELSLDD-KLKDILVLKRENDQIKSNIASIETLNSHLLDRI 548

Query: 1921 --LFLQLDNMQQKNIFQETDI 1977
              L LQL  +   N   E ++
Sbjct: 549  TNLELQLKQLSTSNTIMEKEL 569

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 6/97 (6%)
 Frame = +1

Query: 286 VFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAA 465
           +F   ++ DLI   +   +  + ++GYN  ++ YG   +GKTY+      LY  +++D+ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 466 GIIPRVLLKLFDTLELQQSD------YVVKCSFIELY 558
           G+   +   LF  +    +D      ++VK SF+E++
Sbjct: 143 GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVW 179

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
            YPL155C (REAL)
          Length = 704

 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 68/201 (33%), Positives = 97/201 (48%), Gaps = 32/201 (15%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296  RDDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 1099 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDR--- 1263
              +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  D+   
Sbjct: 356  DLESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINP 412

Query: 1264 ---------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1362
                                       + HIP+R+SKLTRLLQ +L G++    I T+  
Sbjct: 413  TGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 1363 AKVTSEETCSTLEYASKAKNI 1425
                + ET +TL +AS+AKN+
Sbjct: 473  RNDAAAETINTLRFASRAKNV 493

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 4/102 (3%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VF    +   ++E  + P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 451 LNDAAGIIPRVLLKLF-DTLELQQS---DYVVKCSFIELYNE 564
                G+IP  +  LF + +EL  +    + V  S++E+YNE
Sbjct: 218 ---ELGLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNE 256

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 57/161 (35%), Positives = 91/161 (56%), Gaps = 3/161 (1%)
 Frame = +1

Query: 940  IYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DELF 1116
            I + + ++  I  + +   L++ G   R   ST MN+ SSRSH++F + +   ++  +  
Sbjct: 508  IKLTHNEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEH 567

Query: 1117 RISKMNLVDLAGSENINRSGALNQRA--KEAGSINQSLLTLGRVINALVDRSGHIPFRES 1290
               ++NLVDLAGSE + +   +  +   KE  SIN+SL  L  VI+++  R  +IPFR S
Sbjct: 568  STGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNS 627

Query: 1291 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 1413
            KLT LL++SL   +KT +   ISP   +  ET ++L  A K
Sbjct: 628  KLTYLLKNSLINKSKTLMYVNISPNINSIRETINSLRLARK 668

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 3/101 (2%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +T DK+FG       +F+++   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 451 LNDAAGIIPRV---LLKLFDTLELQQSDYVVKCSFIELYNE 564
           LN+  GII +    ++     L     +Y ++  FIE+YNE
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNE 473

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
            YPL155C
          Length = 625

 Score = 89.0 bits (219), Expect = 2e-17
 Identities = 77/267 (28%), Positives = 124/267 (46%), Gaps = 29/267 (10%)
 Frame = +1

Query: 919  QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1098
            ++D   G+ +  + E     A E +  +  G   R+   T  N  SSRSH I  + L   
Sbjct: 236  RDDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITT 295

Query: 1099 HQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG-- 1269
            +  +     + ++L DLAGSE  +      +R KE   IN+SLL LG VI+ L   S   
Sbjct: 296  NLLNGTTHFNTLSLCDLAGSEKASEQ---LERRKEGSFINKSLLALGTVISKLSAESNAH 352

Query: 1270 -------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 1410
                         HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +AS
Sbjct: 353  DSSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFAS 412

Query: 1411 KAKNIKNKPQLGAFMM--------KDILVKNITM---ELAKIKSDLLSTKSKEGIYMSQD 1557
            +AKN+       +           KD  V+++T    E   I S+L   +   G  + + 
Sbjct: 413  RAKNVSLNVSRKSISYRPDSQDAEKDKRVRSLTKLVEEQDLIISNLKKQQQHAGSALQRP 472

Query: 1558 HYKNLNSDLESH--KNEVQECKREIES 1632
            + +    + E+   ++++Q C+R +++
Sbjct: 473  NSRTALLEAENRVLRDKLQHCERLLDN 499

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 34/99 (34%), Positives = 53/99 (53%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           +  D VFGP A+ + +F E+ G L +    G N T+L YG T +GKTYTM G    +N  
Sbjct: 127 FQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG----HNDG 182

Query: 451 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 567
           +    G    V  ++ +  + +Q    V  S++E+YNE+
Sbjct: 183 IVKMCG--DCVFTRMLNAADERQVKRSVTVSYLEIYNEK 219

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 91/376 (24%), Positives = 169/376 (44%), Gaps = 34/376 (9%)
 Frame = +1

Query: 934  NGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 1113
            +G +I++L + H+T+ +E  + L+ G K+     + ++   S+    F +    + +D++
Sbjct: 195  HGDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCIDR-KDDV 249

Query: 1114 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD----RSGHIPF 1281
             R S +  +DL GS+ + +  A    + +    NQ +  L  +I  L +     S H  F
Sbjct: 250  TRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--F 307

Query: 1282 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ-----LG 1446
            ++S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P      L 
Sbjct: 308  KDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLN 364

Query: 1447 AFMMKDILVKNITME----LAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQEC 1614
            A    D+LV+++ ++    LAKI  +LL T+ K     +     + ++ LE+   E  + 
Sbjct: 365  AKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKTLKTENDSTTNSTSNSLENALQENSKL 422

Query: 1615 KREIESL--------------ASKNSL-----LVKDKLKSRETIQSQNSQMESLKATINH 1737
            K ++ESL              ++KN +     L+K  + + E + +    +++ K     
Sbjct: 423  KLQLESLQQILGTMSLANPSSSNKNEMNEHDELLKKLMSTCEDVANLQLSVDNGKHINRK 482

Query: 1738 LKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFET--HISKEIKSL 1911
            LK Q+D     E      N+ L K  +  +  L++       L  +FE    +S   K  
Sbjct: 483  LKKQIDANSSKEDVFETMNSTLLKQIQNQEKELEELLTANASLQIEFENLRKVSNSRKER 542

Query: 1912 KTALFLQLDNMQQKNI 1959
             T L   L ++Q  N+
Sbjct: 543  ITHLEKILKDLQNHNV 558

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +1

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
           Y  D +F   + +   ++ +   L  D  KGYN T++ YG TS+GK++ + GD    N  
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 451 L 453
           L
Sbjct: 146 L 146

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
            YPL155C
          Length = 468

 Score = 84.7 bits (208), Expect = 3e-16
 Identities = 53/150 (35%), Positives = 85/150 (56%), Gaps = 5/150 (3%)
 Frame = +1

Query: 991  LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 1170
            L L+ +G ++R+V ST+ N  SSRSH +  + +         +   + L DLAGSE    
Sbjct: 241  LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSMGS---KARVLTLCDLAGSER--- 294

Query: 1171 SGALNQRA--KEAGSINQSLLTLGRVINALVDR---SGHIPFRESKLTRLLQDSLGGNTK 1335
              +++ R    E G+IN+SL+ LG V+  L +    S H+P+R+SKLTRLL+ SL GN  
Sbjct: 295  -ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGL 353

Query: 1336 TALIATISPAKVTSEETCSTLEYASKAKNI 1425
              ++ T+S +    E++  TL +A +A  +
Sbjct: 354  VTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 23/64 (35%), Positives = 33/64 (51%)
 Frame = +1

Query: 373 TVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIE 552
           T++ YG T +GKTYTM G +         A G I  V L + D L     +  +  S++E
Sbjct: 142 TIIAYGATGSGKTYTMHGTK---------AEGGI--VQLSIRDLLTQLSKNCQITISYLE 190

Query: 553 LYNE 564
           +YNE
Sbjct: 191 IYNE 194

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
            that interacts with Myo2p, proposed to be involved in
            exocytosis; N-terminal domain is related to the motor
            domain of kinesins
          Length = 656

 Score = 82.0 bits (201), Expect = 4e-15
 Identities = 79/331 (23%), Positives = 153/331 (46%), Gaps = 42/331 (12%)
 Frame = +1

Query: 1057 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 1233
            SRSH +F + + ++++ D++ + S + LVDL G+E  ++             +NQS+  L
Sbjct: 233  SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 1234 GRVINALVDR----------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 1383
               + +L  +          S    +RES+LT +L+DSLGGN KT +I T   + V +  
Sbjct: 293  KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 1384 TCSTLEYASKAKNIKNK----------PQLGAFMMKDILVK--NITMELAKIKSDLLSTK 1527
            T STLE+    + I NK           +     ++D+ +K  N   ++  +K+++ S K
Sbjct: 351  TLSTLEFGDSIRQINNKVTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQINILKAEIDSLK 410

Query: 1528 SKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSR------ETI 1689
            S     + +D  K +   LE+ K E  + K +++S+    S    +   +R      E +
Sbjct: 411  SLHNKSLPEDDEKKM---LENTKKENIKLKLQLDSITQLLSSSTNEDPNNRIDEEVSEIL 467

Query: 1690 QSQNSQMESLKATINH-------LKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYK 1848
              +  Q+  L+ + +        L+ +L+ +   E  +   N +L +  ++ +  +Q+  
Sbjct: 468  TKRCEQIAQLELSFDRQMNSNSKLQQELEYKKSKEEALESMNVRLLEQIQLQEREIQELL 527

Query: 1849 KRELDLNKKFETHI------SKEIKSLKTAL 1923
                 L  + ETH       S+ IKSL++++
Sbjct: 528  TTNAILKGELETHTKLTETRSERIKSLESSV 558

 Score = 59.3 bits (142), Expect = 4e-08
 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 4/111 (3%)
 Frame = +1

Query: 247 TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 426
           T +     +  DKVF   A+Q+ + + +  P+  D + GYN TV+ YG + +GK+Y++ G
Sbjct: 67  TTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIG 126

Query: 427 DEKLYNGELNDAAGIIPRVLLKLFDTLELQQ----SDYVVKCSFIELYNEE 567
            +        ++ GI+P +   LFDTLE  +      + V     E+Y E+
Sbjct: 127 SK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEK 169

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
            (REAL)
          Length = 656

 Score = 81.6 bits (200), Expect = 5e-15
 Identities = 91/365 (24%), Positives = 166/365 (45%), Gaps = 17/365 (4%)
 Frame = +1

Query: 1045 NDFSSRSHTIFTITLYKKHQD-ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQS 1221
            N   S+SH +F + + +++++ ++ R S + L+DL G+E  ++   +         +NQS
Sbjct: 229  NTERSKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQS 288

Query: 1222 LLTLGRVINAL----------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1371
            +  L  ++  L          V  S    +RES+LT +L+DSLGGN KT +I T   + V
Sbjct: 289  IEALKNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNV 348

Query: 1372 TSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMS 1551
            ++  T STLE+    + I NK           ++ N T    K K DL     K      
Sbjct: 349  ST--TLSTLEFGECIRQITNK-----------VIDNTTGLNLKKKMDLFIEDMK-----I 390

Query: 1552 QDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATI 1731
            +D+  N  S +   K E+   K     L S+  +  K +   +E  + +  Q++S+   +
Sbjct: 391  RDN--NYASRINILKAEIDSLKTPSGELVSQGDMKTKFENSEKENAKLK-LQLDSISLLL 447

Query: 1732 NHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSL 1911
            +   ++ +  H  + E++    K  +    ++++          L K+ E  ISKE K+L
Sbjct: 448  SSSTSE-NPNHSIDEEVAEILMKRCEQVAQLELSFDRQMNVNSKLQKELEYKISKE-KAL 505

Query: 1912 KTALFLQLDNMQQKNIFQETDIQPNLD---MVKNEVLT---LMETMQEKAELMYKDCVKK 2073
            ++     L+ +Q     QE +IQ  L    ++K E+ T   L ET  E+ + +     + 
Sbjct: 506  ESMNVRLLEQIQ----IQEKEIQELLTTNAILKGELETHAKLTETRSERIKYLESSIKEL 561

Query: 2074 ILNES 2088
             +N+S
Sbjct: 562  SINKS 566

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 34/102 (33%), Positives = 54/102 (52%)
 Frame = +1

Query: 205 SKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLV 384
           + E S  TTGDT  T       +  DKVF   A+Q+ + + +  P   D + GYN T++ 
Sbjct: 60  TSEPSHETTGDTYST-------FKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIIT 112

Query: 385 YGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLE 510
           YG + +GK+Y++ G +        +  GI+P +   LF+TLE
Sbjct: 113 YGPSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLE 146

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
            YKL079W
          Length = 803

 Score = 80.1 bits (196), Expect = 2e-14
 Identities = 100/468 (21%), Positives = 206/468 (44%), Gaps = 42/468 (8%)
 Frame = +1

Query: 931  SNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QD 1107
            ++ + I+NL++ ++ +  E  + L  G  +R      M   +SRS+ +  I L +   +D
Sbjct: 234  NSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLED 288

Query: 1108 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRE 1287
            +L + S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN L + +G  P+ +
Sbjct: 289  QLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE-TGTSPYDQ 347

Query: 1288 -----------SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI--- 1425
                       S L  ++   +GGN KT  I+TISP      ET  TL  + + K+I   
Sbjct: 348  QINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITLRISEQIKSIISS 407

Query: 1426 -----KNKPQLGAFMMKDILVKNITM-------ELAKIKSDLLSTKSKEGIYMSQDHYKN 1569
                 KN   L +    +++  +I +       ++  ++  L   KS   I    +  +N
Sbjct: 408  SNNINKNIKGLNSKKELELIRMDINLKEEYYKCQIRILEEQLKLMKSHSNIITETNTTRN 467

Query: 1570 --LNSDLESHKNEVQECKREIESLA------SKNSLLVKDKLKSRETIQSQNSQMESLKA 1725
              L  +++  + E ++ K+++++LA      ++N+    + + + +  Q       ++  
Sbjct: 468  SGLQEEIKYQEKENRKLKKQVKTLAYILTKTNRNNKSATNTISNDDMNQGDEIDGNNIND 527

Query: 1726 TINHLKAQLDKQHKAELEISGFNNKL--QKMTEVMQVALQDYKKRELDLNKKFETHISKE 1899
              N L  Q       + +  G  N L  +  +E +   L +  ++ ++L    +  I+K 
Sbjct: 528  DDNELNKQDTNLADEDDDDDGDGNSLETEDNSEHLLNTLLEKCEQVVELQLSLDEEINKG 587

Query: 1900 IKSLKTALFLQ-----LDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDC 2064
            +   K   F +     L+ M  K + Q   ++ +L M      TL E + ++ E+ +   
Sbjct: 588  LILQKQTEFSKFKGQTLETMNLKLLDQINLLEADLQM------TLAENVSKRKEIEH--- 638

Query: 2065 VKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLK 2208
            +K+I N        +   I    I  ++   N + +++  +  NNNLK
Sbjct: 639  LKQIANSRKSRIQYLENDIKEKDISIKSIATNNSLSVNQ-TNSNNNLK 685

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = +1

Query: 199 TGSKEV-SINTTGDTGITAQMNAKRYTVDKVFGPGASQ-DLIFEEVAGPLFQDFIKGYNC 372
           TG++ + +  TTG+T          + VDKVF     Q DL+  ++      +   G+N 
Sbjct: 35  TGTRIIFTSETTGNT---------EFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNS 85

Query: 373 TVLVYGMTSTGKTYTMTGDEKL 438
           +++ +G + TGK++TM G+  L
Sbjct: 86  SIIAFGQSGTGKSFTMFGNNSL 107

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
            (REAL)
          Length = 656

 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 94/372 (25%), Positives = 180/372 (48%), Gaps = 30/372 (8%)
 Frame = +1

Query: 1057 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 1227
            S+SH +F + + ++++ +++ + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233  SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALK--KLNQSIE 290

Query: 1228 TLGRVINALVDR----------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 1377
             L  ++  L  +          S    +RES+LT +L+DSLGGN K  +I T   + V +
Sbjct: 291  ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT 350

Query: 1378 EETCSTLEYASKAKNIKNKPQLGA----------FMMKDILVK--NITMELAKIKSDLLS 1521
              T STLE+    + I NK                 ++D+ +K  N   ++  +KS+L S
Sbjct: 351  --TISTLEFGDNIRQIINKVMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQINILKSELDS 408

Query: 1522 TKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQN 1701
             K       S++   ++ ++LE+++ E  + K +++S+          +L S  T ++ N
Sbjct: 409  LKDLSNESSSRE---DMKTELENYEKENVKLKLQLDSIT---------QLLSSSTNENPN 456

Query: 1702 SQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFE 1881
            + ++   A I   +     +  A+LE+S F+ ++   ++               L K+FE
Sbjct: 457  NNIDDEVAEILMKRC----EQIAQLELS-FDRQMNANSK---------------LRKEFE 496

Query: 1882 THISKE--IKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLT---LMETMQEKAE 2046
               SKE  ++S+   L  Q+  +Q+K I    ++  N  ++K E+ T   L ET  EK +
Sbjct: 497  YKKSKEEALESMNVRLLEQI-QLQEKEI---QELLTNNAILKGELDTHTKLAETRSEKIK 552

Query: 2047 LMYKDCVKKILN 2082
             + +D VK++ N
Sbjct: 553  SL-EDSVKELTN 563

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 44/148 (29%), Positives = 70/148 (47%), Gaps = 4/148 (2%)
 Frame = +1

Query: 136 RGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDL 315
           +G    E   K + V N      SK +  N TG    T Q        DKVF   A+Q  
Sbjct: 38  KGLQNNESTFKINSVDNTVLFRTSKPLH-NATGSPHSTFQF-------DKVFDANATQKD 89

Query: 316 IFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKL 495
           + + +  P  +D + GYN T+L YG + +GK+Y++ G +  YN       G++P +   L
Sbjct: 90  VQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN------EGVLPNICQVL 141

Query: 496 FDTLELQQ----SDYVVKCSFIELYNEE 567
           F+TLE  +    +++ V     E+Y E+
Sbjct: 142 FETLEENEETKGTNFCVSVLAFEIYMEK 169

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 128/634 (20%), Positives = 273/634 (43%), Gaps = 60/634 (9%)
 Frame = +1

Query: 1246 NALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 1425
            NAL ++S  +  R  ++  L  +S     K  L AT+  + + ++E  +  +  S  +N 
Sbjct: 1804 NALTEKSNLLQKRLEEIKEL--ESTLSKYKADLEATMKNSDLKNDEFENVCKELSVKENE 1861

Query: 1426 KNKPQLGAFMMKDILVK------NITMELAKIKSDLLSTKS-------------KEGIYM 1548
              K +      +D++ +      N+  EL + KS LL  K              KE +  
Sbjct: 1862 IKKIEEILSSKEDLIAEIESQKDNLKDELNE-KSLLLDKKESQLEAFQEDVEVQKENLQK 1920

Query: 1549 SQDHYKNLNSDLESHKNEVQECKREIESL-----ASKNSL---------LVKDKLKSRET 1686
                Y NL   +     ++ +C+++IE L     +S N L         L  +  ++++ 
Sbjct: 1921 KITEYDNLQKLMSLDNKKLVKCEKQIEDLELKLESSSNHLKEQEGKYEKLEFESGENKKL 1980

Query: 1687 IQSQNSQMESLKATINHLKAQLDK--QHKAELEISGFNNKL-----QKMTEVMQVALQDY 1845
            I  ++  +++L+  I++ K ++ K     + L+ +  N +L     +KM + +   LQ+ 
Sbjct: 1981 ISEKDELIQTLQLDISNNKDEIQKLSDKISTLQNNSENTELTLEEKEKMVDELNSKLQEK 2040

Query: 1846 KKR----ELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQE---TDIQPNLDMVKN 2004
            + +    ELDLNK  ET + KE++S  + L +  DN++ +NI Q+   T+++  +D  + 
Sbjct: 2041 EAQVETLELDLNKLKET-LDKELES-SSELQIAHDNLRDENIIQKQKITELKVKIDDSEK 2098

Query: 2005 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 2184
            +   +++ M+E  E +    ++  L+        + E +     E +   K +AE  ++ 
Sbjct: 2099 DSQVIIDNMKEMEENIMD--LRNDLSSKTIQIEKVNEDLSSKNSEIEQLNKKLAEKCAEY 2156

Query: 2185 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTN---------QFVENFKMTLN 2337
                + L    K    + N  + L+  I+   E +E K           Q   N     N
Sbjct: 2157 DSIKSELVASSKLSESEKNDMKQLSDEINELKEQLELKNENLKKVTSDLQIANNTSDKYN 2216

Query: 2338 DHLEENKKLIMQNMTNATSAVIDQEMDLFE-PRRAKWENSFDLINKCDSMNNEFYNNMAA 2514
            D L+     I +  +   +  + +++DL E        +  DL  K D+ + E     + 
Sbjct: 2217 DELKVANNTIREIESKIPN--LQKQLDLKEIEYNDTLSSKKDLDKKLDNFSKE-----SE 2269

Query: 2515 TLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHII-LKD 2691
             LS+  K++      + +  + +  ++++ +N I  L N  K N++    +   II LKD
Sbjct: 2270 ILSKEVKSLKKEKLDLEKEKNDLIVELDKYKNDIIDLNNTLKENEKNGSEVETEIIGLKD 2329

Query: 2692 NIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMID--NILKEIPNLSKRLPL 2865
             IE               + + I+ ++    +K  +++ E+I+  N L+   ++S  +  
Sbjct: 2330 KIEFYKLNVSQLNEEKGKLESDIKTLVGERDDKLKSSQSEIIELTNKLESFKDIS--VAY 2387

Query: 2866 RISNINGCSVQDIISPKKHTIEDENPSSENADSE 2967
              S +    +++ +S  + ++E+ N + ++A+ E
Sbjct: 2388 EESKVESDGLKNKLSEIEKSLEESNENVDSANKE 2421

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 144/683 (21%), Positives = 262/683 (38%), Gaps = 57/683 (8%)
 Frame = +1

Query: 1105 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 1284
            +EL  ++K NL D + S+  N    +++  +E  S+   +  L   I  +  ++ H   +
Sbjct: 1073 EELVEVTKNNLND-SESQVSNLIAKISELDEENKSVKLEVEKLENEITEI--KNSHKSAQ 1129

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTS--EETCSTLEYASKAKNIKNKPQLGAFMM 1458
              K T  LQ  L    +T L+   S  ++ S   E  STL   S  +N++N  +  +  +
Sbjct: 1130 --KETDTLQTKLD---ETELLLQSSKEEILSLKNEYSSTL---SDKENLENSEKKSSEKI 1181

Query: 1459 KDI---------LVKNITMELAKIKSDLLSTKSK------------EGIYMSQDHYKNLN 1575
            +++           +NIT E   +K +   T+ K            E I    D    LN
Sbjct: 1182 EELEKNFSNLQEQFENITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSLSDEKDKLN 1241

Query: 1576 SDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMES-------LKATIN 1734
              ++  +  +     ++ES++    ++ K K    E + +  S++         L++  +
Sbjct: 1242 GIIDDKEKIISNLNEKLESISEDIDIIEKAKNLLEEKLATMTSELNDSENGSSELRSLYD 1301

Query: 1735 HLKAQLDKQHKAELEISG----FNNKLQKMTEVMQVALQDYKKREL----------DLNK 1872
             LK + ++  K   + S       NK   +TE  ++ L+D KK E           DL K
Sbjct: 1302 SLKIEFEELQKTNSDKSANLKELENKHTSLTETQEILLEDKKKMESSINDYVKIKDDLEK 1361

Query: 1873 KFETHISK----EIKSLKTALFLQLDNMQQKNIFQETD-IQPNLDMVKNEVLTLMETMQE 2037
            + E  ++K    E K  K  + L+ +N   K +    D ++   ++ KNE+   M+   E
Sbjct: 1362 EKEDLLNKYNVLEDKKDKLEIILEENNSSIKVLEHSIDALKKENEIYKNEIHD-MKLQME 1420

Query: 2038 KAELMYKD-------CVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEEN 2196
             +   YK+        + ++  E  K  N   EKI+ + +E +N             ++ 
Sbjct: 1421 SSNSEYKNKAGEQEKKISRLKEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQFEDKI 1480

Query: 2197 NNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQN 2376
             +LKQ +                   + E  +K+  + ++N K TL   LEE K      
Sbjct: 1481 TSLKQEI------------------ISIEKSKKQDEKVLKNQKNTLQKELEELK----DQ 1518

Query: 2377 MTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSN 2556
             TN+                   EN +  I K D+  NE        ++ ++K       
Sbjct: 1519 FTNS-------------------ENEY--IKKLDNFQNE--------INSVRKEKLDIEA 1549

Query: 2557 SMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXN 2736
             +N  I  +K  + +SE    +L+ + K     K  + +  + K N E            
Sbjct: 1550 VLNSKIETLKADLSKSEEKSLILEKSNK-EHLIKMEVIQKSLEKQNKEL----------- 1597

Query: 2737 VDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQ-DIISP 2913
              DI    +D +T + N E     E I++ + +I NL   L     N+    V+ D +  
Sbjct: 1598 --DILGNEKDTLTMNLNNEIKGLKEEINSKVDQIGNLKTELNTVSENMEDIQVRYDQLKE 1655

Query: 2914 KKHTIEDENPSSENADSEGSRKI 2982
            +K  I D+   SE    E    I
Sbjct: 1656 EKSEISDKLIESEEKLKENFSSI 1678

 Score = 72.0 bits (175), Expect = 8e-12
 Identities = 124/628 (19%), Positives = 252/628 (40%), Gaps = 98/628 (15%)
 Frame = +1

Query: 1399 EYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNS 1578
            E    A+N  NK      M K++   +   E  +I+   L  K +E I + +D     N 
Sbjct: 824  ERKDNAENGVNK------MNKELSNLSKEKEQLRIEQGKLEKKIQEQISVYEDSKIKFNQ 877

Query: 1579 DLESHKNEVQECKREIES-------LASKNSLLVKD------KLKSRET-IQSQNSQMES 1716
            +LES + ++ + +  +ES       L  + S L+K+      K KS +  +     +++S
Sbjct: 878  ELESTEKQITDLQSNLESKNTELDNLNKEKSGLMKELTEWKAKFKSHDALVPKLTEKLKS 937

Query: 1717 LKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVA--LQDYKKRELDLNKKFETHI 1890
            L  +   L+ + D      +EI+   NK  +++ + +    L+  K + LD   K    +
Sbjct: 938  LANSYKELQTERDNYSSQLIEIN--KNKTSELSSLSESISNLKIEKDKILDEKSKLINKV 995

Query: 1891 SKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVK 2070
            S E++S  T      +  ++K I  + +++  L +  NE L  +ET +E       +  K
Sbjct: 996  S-ELESQITENCKIFEEEKEKLILSKDELE-ELVIDLNEQLKELETQKETTSKNADELNK 1053

Query: 2071 KILNESPKF---FNVIVEKIDIIRIEFQNF------YKNIAENLSDISEENNNLK---QY 2214
             I N + +     + ++E  +++ +   N         N+   +S++ EEN ++K   + 
Sbjct: 1054 SIANLNTQLKQKDSKLIELEELVEVTKNNLNDSESQVSNLIAKISELDEENKSVKLEVEK 1113

Query: 2215 LKNHF--FKNNHQ------ELLNHHIDST---------------------------YENI 2289
            L+N     KN+H+      + L   +D T                            EN 
Sbjct: 1114 LENEITEIKNSHKSAQKETDTLQTKLDETELLLQSSKEEILSLKNEYSSTLSDKENLENS 1173

Query: 2290 EKKTNQFVENFKMTLNDHLEENKKLIMQNM--------TNATSAVIDQEMDLFEPRRAKW 2445
            EKK+++ +E  +   ++  E+ + +  +N         T      +++++D +    +  
Sbjct: 1174 EKKSSEKIEELEKNFSNLQEQFENITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSL 1233

Query: 2446 ENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD---TSSNSMNESISVMKGQVEESENAI 2616
             +  D +N       +  +N+   L  I + +D    + N + E ++ M  ++ +SEN  
Sbjct: 1234 SDEKDKLNGIIDDKEKIISNLNEKLESISEDIDIIEKAKNLLEEKLATMTSELNDSENGS 1293

Query: 2617 S---------------LLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNV---- 2739
            S               L K N+  +   K+L +KH  L +  E           ++    
Sbjct: 1294 SELRSLYDSLKIEFEELQKTNSDKSANLKELENKHTSLTETQEILLEDKKKMESSINDYV 1353

Query: 2740 ---DDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNINGCS--VQDI 2904
               DD+    ED++  +   E+  K + ++ IL+E  +  K L   I  +   +   ++ 
Sbjct: 1354 KIKDDLEKEKEDLLNKYNVLED--KKDKLEIILEENNSSIKVLEHSIDALKKENEIYKNE 1411

Query: 2905 ISPKKHTIEDENPSSENADSEGSRKIPK 2988
            I   K  +E  N   +N   E  +KI +
Sbjct: 1412 IHDMKLQMESSNSEYKNKAGEQEKKISR 1439

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 143/663 (21%), Positives = 270/663 (40%), Gaps = 63/663 (9%)
 Frame = +1

Query: 1195 KEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTR-LLQDSLGGNTKTALIAT----IS 1359
            KE    ++ + TL   + AL ++         KL   LL+D      + + +      + 
Sbjct: 1208 KELTESSEKIKTLNAELEALTEKLNQNEMEAEKLRENLLKDQNASKEEISALENTLKELH 1267

Query: 1360 PAKVTSEETCSTLE----------------YASKAKNIKNKPQLGAFMMKDI--LVKNIT 1485
              K T  E  S LE                +AS+ +++  + +      KD   +++   
Sbjct: 1268 SEKETQMEEKSKLESDIKSLETELDETKKKHASEIESLHEQIEKINEETKDFKAIIEKAA 1327

Query: 1486 MELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKD 1665
              L + +SDL   K K     +++  K +    + H    ++ + E E L ++  +L +D
Sbjct: 1328 SNLKRTESDLKVLKEK--YTKNEEKLKIMEVASKEHAELKKKQESEYELLENRLKMLEED 1385

Query: 1666 -KLKSRETIQSQNSQMESLK----ATINHLK---AQLDKQHKAELEISG----------- 1788
             KLK +E  + + S +E+ +    +TI   K   A  D+++K E EI             
Sbjct: 1386 VKLKEKELSEHKKSLLEAQEQEKSSTIELAKLKSAAADEKNKLEEEIKSCKVELKNKAQA 1445

Query: 1789 FNNKLQKMTEVMQVALQDYKKRELDLNKKFET----HISK--EIKSLKTALFLQLDNMQQ 1950
            F  + + + E      ++Y ++  +L  K E     H SK  E+ SLKT + ++L+N   
Sbjct: 1446 FEKERKLLNEGSSSITKEYSEKVSELEDKLEAVNSAHQSKLEELDSLKTNM-IELENKNS 1504

Query: 1951 KNIFQETD----IQPNLDMVKNEVLTL---METMQEKAELMYKDCVKKI--LNESPKFFN 2103
            + + +E      ++  +   K ++  L   +E  QEK + + KD  KK+  +  + + ++
Sbjct: 1505 EQLKKEKASIVILEETISKQKKDIDNLHSEVEDSQEKCKNINKDLTKKLREMQSASETYD 1564

Query: 2104 V----IVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHID 2271
                 + E I+   +E +   K+I E   ++  +   LK        +N + E++  + D
Sbjct: 1565 SNLKRMEETIEEKNVEIEKSSKSIEELEKELGSQQLKLKD------LQNENTEVIKKNKD 1618

Query: 2272 STYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWEN 2451
               E I +     + N K       E+N+ L  +N T + SA  DQ       R    + 
Sbjct: 1619 ILDEKISE-----IGNLK-------EKNESLSEENETLSKSA--DQLKSEVSKRDEALKI 1664

Query: 2452 SFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKN 2631
            S  +I++   + +E  + + + L+Q+ K    S  +M E +    G  EE+        N
Sbjct: 1665 SKKVIDEY-KVKDEQLSKLQSQLAQVNKEYSDSKQAM-EDLQKRIGDAEENTKQF----N 1718

Query: 2632 NTKFNDQ--FKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATK 2805
            NTK +D+   KQL  +   +K  +E            + ++   IED      NKE    
Sbjct: 1719 NTKKDDEDKIKQLEKEVEDMKAKLELSESSVANDQLKISELEKIIED------NKEILLA 1772

Query: 2806 DEMIDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIP 2985
            +       KE+    ++           S+Q +   KK  +E++    E  D E ++ I 
Sbjct: 1773 E-------KEVNQKQEK-----------SIQSLELEKKTVVEEKRKLEEKLDEESAQHIK 1814

Query: 2986 KTE 2994
            KTE
Sbjct: 1815 KTE 1817

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 100/478 (20%), Positives = 205/478 (42%), Gaps = 29/478 (6%)
 Frame = +1

Query: 1354 ISPAKVTSEETCSTLEYASKAKNI-----KNKPQLGAFMMKDILVKNITMELAKIKSDLL 1518
            +S  K   E  C +LE   K K+      KNK        K   ++ +  +L ++K+++ 
Sbjct: 854  LSREKQELEGKCGSLERDMKIKSNNFDQEKNKLNQ-KIQEKSKEIETLNKKLEELKNNIT 912

Query: 1519 ST-KSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKL-------K 1674
            S  K K+G  ++  H+K   S  ESH   V +   +++SLA+   LL K+KL       K
Sbjct: 913  SLEKEKDGTALALQHWK---SKFESHDALVPKLTEKLKSLATSFKLLEKEKLALENDFTK 969

Query: 1675 SRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYK-- 1848
             R     QN++ +     I   +  L  + + E  ++ F ++L+++++ ++    D+   
Sbjct: 970  YRSEHSHQNAEFQKAIGDITKERDLL--RSEKETLVANF-SQLKELSDKLKTENSDHSAA 1026

Query: 1849 ----KRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLT 2016
                K EL+ +        KE+++ K     +L N+++K    +  ++      K++ LT
Sbjct: 1027 YEAVKNELEESMLHMNEQLKELETEKAEGDQKLANLEEKLNMMKKQLED-----KDQQLT 1081

Query: 2017 LM---ETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDIS 2187
             +   E   +K  +  ++ +  +  +   F    +EK++   +E +     + +      
Sbjct: 1082 KLCEGEANNKKQLVTAEETISSLKADKETF----MEKLEASGLEVEKLQTELKDTKLQHG 1137

Query: 2188 EENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEE--NKK 2361
            E    L    K H  K+      N  I S  E+++K+  Q V + +    + LEE  N+K
Sbjct: 1138 EAETRLTNMKKEHADKDIAN---NEKICSLEEDLKKQ--QIVMDKEKANAEELEEKLNEK 1192

Query: 2362 LIMQNMTNATSAVIDQEM----DLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQI 2529
                       A I++E+    +  +   A+ E   + +N+ +    +   N+    +  
Sbjct: 1193 ETELADVLRNKAAIEKELTESSEKIKTLNAELEALTEKLNQNEMEAEKLRENLLKDQNAS 1252

Query: 2530 KKTVDTSSNSMNESISVMKGQVEESENAISLLKN-NTKFNDQFKQLISKHIILKDNIE 2700
            K+ +    N++ E  S  + Q+EE     S +K+  T+ ++  K+  S+   L + IE
Sbjct: 1253 KEEISALENTLKELHSEKETQMEEKSKLESDIKSLETELDETKKKHASEIESLHEQIE 1310

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] {ON}
            similar to uniprot|P32364 Saccharomyces cerevisiae
            YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 84/428 (19%), Positives = 181/428 (42%), Gaps = 50/428 (11%)
 Frame = +1

Query: 904  RSPMTQNDQSN--GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 1077
            R P+  + ++   G+Y Q     +I +  E   +++    +++ +  KM+   S SH + 
Sbjct: 192  RKPLKSHHETKKFGLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVI 251

Query: 1078 TITLYKKHQDELFRI------SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGR 1239
              ++     ++L R+      S +   DL GS    +        +    +N S+  L  
Sbjct: 252  RCSV-----EQLDRVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLES 306

Query: 1240 VINALVDRSG--------------------HIPFRESKLTRLLQDSLGGNTKTALIATIS 1359
            V+N+++                         +P+++S+LT L+Q++LGGN++T ++    
Sbjct: 307  VVNSVLQNQQKNHLYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCF 366

Query: 1360 PAKVTSEETCSTLEYASKAKNIKNKPQ-----LGAFMMKDILVKNITMELAKIKSDLLST 1524
              K   EET +TL +  + +NI N  +     L +    D+L+ N  M++ +   D   T
Sbjct: 367  DDKSHHEETIATLRFGVQLQNILNFVRADVTGLNSKKTLDLLIDN--MKVIENNYDQKIT 424

Query: 1525 KSKEGIYMSQDHYK------NLNSDLESHKNEVQECKREIESLASK-NSLLVKDKLKSRE 1683
              +  +    D  K       L +++    +E+++ + ++E++    N++  K+   +++
Sbjct: 425  LLESELNKLADTVKKAKVTEELETEIVEKNDEIKKLREQLETMTQLFNNIDPKESEDTKK 484

Query: 1684 TIQSQNSQMESLKATINHLKAQLDKQH--KAELEISG--------FNNKLQKMTEVMQVA 1833
             IQ+   + ES+      L+ QL +    K + EI           N++L +  +  + +
Sbjct: 485  IIQTLMEKCESVAQLQLELEGQLHENSILKGDGEIKDAKIRTLETMNSRLVEQLQNQESS 544

Query: 1834 LQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVL 2013
             QD  K    L K+ E  +S   KS +  + +    ++   +   T+  P    V +  +
Sbjct: 545  TQDILKSNGILKKELEA-LSNISKSQQEKIKILEAKLRDSVVISSTESSPRKGSVSSSSI 603

Query: 2014 TLMETMQE 2037
              M  + E
Sbjct: 604  NTMLPIDE 611

 Score = 35.4 bits (80), Expect = 0.92
 Identities = 18/70 (25%), Positives = 36/70 (51%)
 Frame = +1

Query: 223 NTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTST 402
           NT     IT   +   +  +KV+  G     I + ++  + +D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 403 GKTYTMTGDE 432
           GK++T+ G+E
Sbjct: 131 GKSFTLFGNE 140

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 112/533 (21%), Positives = 225/533 (42%), Gaps = 49/533 (9%)
 Frame = +1

Query: 1375 SEETCSTLEYA------SKAKNIKNKPQLGAFMMKDILVKNITME--LAKIKSDLLSTKS 1530
            +EE  STL +       S   N+KN   L A +  D   K  T+E  L ++++D      
Sbjct: 691  NEEPVSTLSFEIFEKLQSDCTNLKNS--LSA-LENDSSSKIDTLEEKLTELQNDFNILSE 747

Query: 1531 KEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQM 1710
            K  I +S D+  +LNS+ E+ KNE+     ++   + +N  L          ++S N ++
Sbjct: 748  KHSI-LSGDNI-SLNSNYENIKNELNSISEQLSMASKENENLKATNASQEVDVKSLNKEL 805

Query: 1711 ESLKATINHLKAQLD----KQHKAELEISGFNNKLQKMTEVMQVALQD-------YKKRE 1857
               + +I  L+ QL+    ++ KA+  I+  NN+L+K+   +    +D        K ++
Sbjct: 806  NEKEKSIYELEKQLNLTKTEKDKAQEGINKMNNELRKLMTSIDTLNEDKSRLQNEIKLQK 865

Query: 1858 LDLNKKFETHI-------SKEIKSLKTALFLQLDNMQQ---------------KNIFQET 1971
            ++L+ K ET I       SKE  +LK  L L+ + +++               K  FQ  
Sbjct: 866  IELDDK-ETKINSEMEKTSKEYDNLKKLLALKEEEIEELKSKLLISARDLKEYKGKFQSH 924

Query: 1972 D-IQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQN 2148
            D + P L      + T  + ++ + + + +       N S +  +++  K+DII+ E   
Sbjct: 925  DSLVPKLTEKLKTLATSFKELEIERDALLQSLKTNEENTSSE-LSLLTSKLDIIKSENAT 983

Query: 2149 FYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKM 2328
              KN    L +IS   + ++  +  H    N ++ L            +++ + +E F +
Sbjct: 984  LEKNKKTLLENISNLESKIEDMITAH---TNEKKAL------------EESKEELEEFVI 1028

Query: 2329 TLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNM 2508
            +LN+ LE+ +   +++   A+   ++ ++  F      ++N  D  N   S      +  
Sbjct: 1029 SLNEQLEDLETSKLESSNKASE--LEAKIKSFNNEVNSYKNQLDTANNLISKLQISLDEA 1086

Query: 2509 AATLSQIKKTVDTSSNSMNESISVMKGQVEESENA----ISLLKNNTKFNDQFKQLISKH 2676
             + + Q+++   +   ++ +    ++ +  E  NA      LL+      D+      K 
Sbjct: 1087 NSKIEQLEEDKVSDLKNLTKKDQKLEARDNELSNAKLQNDELLRERQSLKDELLSTKEKF 1146

Query: 2677 IILKDNIEXXXXXXXXXXXNVDDIYNTIED---IMTNHGNKENATKDEMIDNI 2826
              + D++E            ++  Y TIE+    + N  N+   T  E+ DNI
Sbjct: 1147 NSVNDDLE-----------ELNSKYVTIEEEKRTLENSINENQFTIKELKDNI 1188

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 98/494 (19%), Positives = 202/494 (40%), Gaps = 10/494 (2%)
 Frame = +1

Query: 1459 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLA 1638
            K I   N   +++++KSD+++ +            K  +   E +K E  E K EIE L 
Sbjct: 1494 KKINQTNFNDKISELKSDIINLE------------KEKDDSKEKNKTESAELKSEIEELQ 1541

Query: 1639 SKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTE 1818
            +KN  ++++      TI            T++ LK  +++  KA+ +    NN L    E
Sbjct: 1542 NKNFKMIEE-----HTI------------TLDALKTDVERLEKAKEDFQVQNNSLTSDLE 1584

Query: 1819 VMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQK-NIFQETDIQ-PNLD 1992
                 L   K++            +  I SLK  L  Q   +++K    +E+ I+  N+ 
Sbjct: 1585 TKNELLHKLKEKS-----------ANTISSLKEDLETQNLQLKEKTKCAEESAIELSNIS 1633

Query: 1993 MVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAEN 2172
               NE+    E++  K  L  +D + +I NE+ +           +  + +   + IA+ 
Sbjct: 1634 KDLNELSAKYESLNSKLSLK-QDALSEITNENAE-----------LNSQLEKHKEEIADL 1681

Query: 2173 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND---H 2343
             S +++ N+ L   +KN                  +++IE K N  +E   + +N+   H
Sbjct: 1682 NSSLNDINSRLDLKIKN------------------FDSIESK-NSDLEKELLKVNEELAH 1722

Query: 2344 LEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLS 2523
            L+E+    + ++ +  +++ ++    FE  R +     D I K     +E  N +  +L 
Sbjct: 1723 LKESSSKTILSLNDKITSLSEE----FEKERTQLTEGSDSITK---EYSEKINRLEESLR 1775

Query: 2524 QIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTK-----FNDQFKQLISKHIILK 2688
            +++   D  +      ++ +  Q+ E+E  ++  + + K      NDQ   L   H    
Sbjct: 1776 KVELDKDKETLEYKNKLTSIIDQLSETEKDLTAAEEDKKILTETLNDQKTSLDKSH---- 1831

Query: 2689 DNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLR 2868
            + +E           +     N I ++ +N     N    + ++++  +I +L  +  L 
Sbjct: 1832 EELELLNKQLSDALSDAQSKVNCISELQSN-----NEALIKEVESLHLQITDLDSK--LN 1884

Query: 2869 ISNINGCSVQDIIS 2910
             +N+N  S ++ IS
Sbjct: 1885 EANVNSNSKENEIS 1898

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 121/588 (20%), Positives = 238/588 (40%), Gaps = 47/588 (7%)
 Frame = +1

Query: 1336 TALIATISPAKVTSEETCSTL-EYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSD 1512
            T L + ++ A V S    + + +   KAK+  N  QL     +   +K +T E  ++   
Sbjct: 1877 TDLDSKLNEANVNSNSKENEISDLLIKAKD--NSDQLSEMHSR---IKTLTNEF-ELNEK 1930

Query: 1513 LLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLK-SRETI 1689
            LL+ KS+E           + +  E  +NE+++  +E+ +L+ +   ++K KLK S ET 
Sbjct: 1931 LLNEKSEE--------LSAIKAVTEGKENEIKKLTQEL-ALSEEEIAVIKSKLKNSDETA 1981

Query: 1690 QSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQD--------- 1842
             S   ++   K  ++ +   L   +K + ++S    + +K  +V+ + + +         
Sbjct: 1982 ASTERKLLETKEILSQMPTDLTTANKDKSDLSIQLTETKKQLDVLNLQINENGDLLSSKI 2041

Query: 1843 --YKKRELDLNK-KFETHISKE-IKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEV 2010
               K++E  L K + E+  SKE I+ LK  L  +L       +  + D++  +   +N +
Sbjct: 2042 ESLKEKEDQLEKLQIESDNSKEEIEKLKHQLS-KLSENHDSILLDKNDLEAKVHDYENAI 2100

Query: 2011 LTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISE 2190
                E   ++ +L+        LNE  +  N   +KI +   E  +    +        E
Sbjct: 2101 AE-RENEVKRYQLL--------LNEKERTSNDFKDKITVAEEEIHSLKSELDRLKIAFDE 2151

Query: 2191 ENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIM 2370
            +  +L              +L +    +T   +E K     +NF+  L++  ++  +LI+
Sbjct: 2152 QKKSL--------------DLASEEKYNTNSILEDKLRISRDNFEKQLSEKDDKISELII 2197

Query: 2371 QNMTNATS--AVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 2544
             N T+AT   + +  E+   +    + +   DL    +   N+   ++ A+++ IK    
Sbjct: 2198 AN-TDATEKYSSLQTEIQSLKHLIDEIKEERDLYESNNKNKNDTIKDLTASIANIK---- 2252

Query: 2545 TSSNSMNESISVMKGQVEESENAISLLKNNTKFND------------QFKQLISKH---- 2676
                      S  K ++ E +  I LLK NTK+ +            ++  L SK     
Sbjct: 2253 ----------SDCKMKIYEKDEEIELLKANTKYEERRLDEELTSLKQKYDDLKSKSTEEA 2302

Query: 2677 IILKD-------NIEXXXXXXXXXXXNVDDI-------YNTIEDIMTNHGNKENATKDEM 2814
            I+LKD       NIE           N+ ++        +  EDI+    + ++ +K   
Sbjct: 2303 ILLKDKLQHKALNIETLNTEITRLETNISELNLDTSKFKSLNEDILLKQSDNDSLSK--K 2360

Query: 2815 IDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDENPSSENA 2958
            ID I+KE  +L              S  + +  K  T+E+E     N+
Sbjct: 2361 IDEIVKEKTDLK-------------SANEELVIKSRTLEEEMKELSNS 2395

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 140/696 (20%), Positives = 277/696 (39%), Gaps = 67/696 (9%)
 Frame = +1

Query: 1081 ITLYKKHQDELFRISKMNL-VDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 1257
            +TL  +++  + +IS + L +D     N  +S    Q + +   + +S++ L   +N + 
Sbjct: 981  VTLTTENKGLISKISNLELTIDNLKKSNDAKSA---QFSDDKNELEESIMHLNEQLNEIE 1037

Query: 1258 -----------DRSGHIPFRESKLTRLLQDSLGGNTKTALI---ATISPAKVTSEETCST 1395
                       D  G +   +S+LT+ + +     TK   +    T S  K+   E    
Sbjct: 1038 AEKEINERKVNDLEGQLNSVKSELTKNMDEITLLKTKLDTVNEDLTTSKQKLIESEN-EK 1096

Query: 1396 LEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLN 1575
             E +   +N KN           ++  N  +E + +K D L  K        Q + K+ +
Sbjct: 1097 RELSKLLENSKNA----------MIDSNNKLEESTLKYDTLLKKYDSLEKNGQANEKSFH 1146

Query: 1576 SDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLD 1755
              ++  K ++QE  +E++    + S+  K+K      IQS  +Q+ESL A    ++   +
Sbjct: 1147 DQVDELKLQLQE--KELQYTTLETSIEEKEK-----NIQSIQTQLESLAAEKERIQGIAN 1199

Query: 1756 KQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETH---ISKEIKSLKTALF 1926
               +   E+    N+++ + E +    + Y+K + +LNKK E H   ++K    L  +L 
Sbjct: 1200 TSSE---EVVSLENRIKDLNEQLDSVRELYEKSKQELNKKNEEHQSMLAKYESDLADSL- 1255

Query: 1927 LQLDNMQQKNIFQETDI---QPNLDMVKNEVLTLMETMQEKAELMYKDC---------VK 2070
             + D     N+  E+ I   +  LD+ K +    +E ++++ + + ++C          K
Sbjct: 1256 AKADTATSTNVELESQIKVMKNELDLNKEKHTEALEILKKEIKNIEEECESTKSDTVVAK 1315

Query: 2071 KILNESPKFFNVIVEKIDIIR---IEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNN 2241
                +S K    + E   I      E QN  + +  ++  + E    + +   +   K +
Sbjct: 1316 NEFAKSQKELKKLQESFSINEKKSEELQNELQELQRSVQTMKEWEEAMVKKSTDLETKIS 1375

Query: 2242 HQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL---IMQNMTNATSAVIDQE 2412
              EL         +N+E+   + V   +    +  EE KKL   I+Q   +    + D E
Sbjct: 1376 KTELELSKEKKKLQNVEESKRKVVSELESVKKESGEEKKKLVQEIIQIKADLKIKIHDFE 1435

Query: 2413 MD---LFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVM 2583
             +   L E   +  +   + I+K +   +E      +  ++++K    S NS  E+  + 
Sbjct: 1436 KERKLLNEGSSSITQEYSEKISKLEERLDEAKFENESKGAEVEKIKKASKNSEMETQKI- 1494

Query: 2584 KGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIE 2763
               +EE +  I+ L+       + K L  +   +K+ I            N++++ N I 
Sbjct: 1495 ---IEEKDTQITTLRET--ITSKEKDLDERSQTIKNLISEKEQELSASNQNLEELKNQIS 1549

Query: 2764 DIM--TNHGNKENATKDEMIDNILKEIPNLS---KRLPLRISNINGC------------- 2889
            +I        +E A KD M+ ++ K + +L    K   L I  +N               
Sbjct: 1550 EIKEELKSSKEEMAKKDMMLIDLNKTLASLKGDVKDKVLAIEKLNETLASLKGNIKDKDL 1609

Query: 2890 ----------SVQDIISPKKHTIEDENPSSENADSE 2967
                      S++D I  K  TIED      + +SE
Sbjct: 1610 AIEKLEKTLNSLKDDIKDKDQTIEDLKKKKASEESE 1645

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 97/467 (20%), Positives = 195/467 (41%), Gaps = 24/467 (5%)
 Frame = +1

Query: 1351 TISPAKVTSE-ETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTK 1527
            T S  ++T E +T   L+  ++ K  KN+  L  +  K   ++NI  +L  I   L   K
Sbjct: 773  TTSLKQITEERDTLDALKKENENKIEKNEELLKEYKEK---LQNIETQLQTII--LAKQK 827

Query: 1528 SKEGIYMSQDHYKNLNSDLESHKNEVQEC----KREIESLASKNSLLVK------DKLKS 1677
            ++EG+         +N +L +   E QE     K  ++ L  K ++L K      DKL  
Sbjct: 828  AEEGV-------NKMNRELFALSREKQELEGNQKIALKDLQKKTAVLEKEKRQLSDKLNE 880

Query: 1678 RET-IQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKR 1854
            +E  I   N ++ +L+ T+  L+++ +++ K   E+  + +K Q    ++         +
Sbjct: 881  KEKDITRLNEELATLENTVKSLESEKNEKRK---EVEEWKSKFQNHDNLVP--------K 929

Query: 1855 ELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQ 2034
              D  K   T   KE++  + +L  QL  ++  N+  ET+++ N+  +    +TL  T +
Sbjct: 930  LTDKLKSLATSF-KELEKERDSLQEQLTELESANLSHETELKNNIKQMTENNVTL--TTE 986

Query: 2035 EKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQY 2214
             K                      ++ KI  + +   N  K+     +  S++ N L++ 
Sbjct: 987  NKG---------------------LISKISNLELTIDNLKKSNDAKSAQFSDDKNELEES 1025

Query: 2215 LKNHFFKNNHQELLNHHIDSTYENIEKKTNQF---VENFKMTLNDHLEENKKLIMQNMTN 2385
            +       +  E LN  I++  E  E+K N     + + K  L  +++E   L+   +  
Sbjct: 1026 IM------HLNEQLN-EIEAEKEINERKVNDLEGQLNSVKSELTKNMDE-ITLLKTKLDT 1077

Query: 2386 ATSAVIDQEMDLFEPRRAKWENSFDLINKCDSM---NNEF------YNNMAATLSQIKKT 2538
                +   +  L E    K E S  L N  ++M   NN+       Y+ +      ++K 
Sbjct: 1078 VNEDLTTSKQKLIESENEKRELSKLLENSKNAMIDSNNKLEESTLKYDTLLKKYDSLEKN 1137

Query: 2539 VDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHI 2679
               +  S ++ +  +K Q++E E   + L+ + +  ++  Q I   +
Sbjct: 1138 GQANEKSFHDQVDELKLQLQEKELQYTTLETSIEEKEKNIQSIQTQL 1184

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
            (REAL)
          Length = 657

 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 83/369 (22%), Positives = 159/369 (43%), Gaps = 38/369 (10%)
 Frame = +1

Query: 1057 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 1233
            SRSH +F + + ++++  ++ + S + L+DL G+E  ++             +NQS+  L
Sbjct: 234  SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 1234 GRVINAL----------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 1383
               + +L             S    +RES+LT +L+DSLGGN KT +I T   + V +  
Sbjct: 294  KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 1384 TCSTLEYASKAKNIKNKPQ-----LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYM 1548
            T STL++    + I N+       L      D+ V+++ ++     S +   K++  I  
Sbjct: 352  TLSTLKFGDSIRQINNRVMDNTSGLNLRKKMDLFVQDMKIKDDNYISQINILKAEVEILK 411

Query: 1549 SQ----DHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMES 1716
             Q    D  +++ +  +  K E  + K +++S+A      +  KL + E   S N ++  
Sbjct: 412  GQSSESDSKEDMATKFDDSKKENTKLKLQLDSIAQ-----LLGKLTNEEPNNSINDEVSV 466

Query: 1717 LKAT----INHLKAQLDKQHKA------ELE--------ISGFNNKLQKMTEVMQVALQD 1842
            +       I  L+   D+Q  A      ELE        +   N KL +  ++ +  +Q+
Sbjct: 467  ILMNRCEQIAQLELSFDRQVNANSKLEKELEYKKSKEEALESMNVKLLEQIQLQEKEIQE 526

Query: 1843 YKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLM 2022
                   L  + ETH SK  ++    +     ++++  I +     P    V +     M
Sbjct: 527  LLTTNAILKGELETH-SKLTETRNERIKSLEGSVKELGINKSATPSPRKGSVSSSSGNTM 585

Query: 2023 ETMQEKAEL 2049
              ++E +EL
Sbjct: 586  SHIEEGSEL 594

 Score = 65.1 bits (157), Expect = 7e-10
 Identities = 50/163 (30%), Positives = 76/163 (46%), Gaps = 7/163 (4%)
 Frame = +1

Query: 100 NEELNITVAVRC---RGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 270
           +E  +I V +R    +G    E   K+S   N      S     NTTGDT  T Q     
Sbjct: 23  SEPCHIDVLLRAIPEKGLPNDESTFKASSSDNTVLFRTSNGPLQNTTGDTHSTFQF---- 78

Query: 271 YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 450
              DKVF   A+Q  + + +  P   D + GYN T+L YG + +GK+Y++ G +      
Sbjct: 79  ---DKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ------ 129

Query: 451 LNDAAGIIPRVLLKLFDTLELQQ----SDYVVKCSFIELYNEE 567
             D  GI+P +   LF TLE ++    +++ V     E+Y E+
Sbjct: 130 --DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEK 170

>Kwal_56.22402 s56 complement(111953..112234) [282 bp, 93 aa] {OFF}
           [contig 185] FULL
          Length = 93

 Score = 63.9 bits (154), Expect = 1e-11
 Identities = 34/48 (70%), Positives = 37/48 (77%)
 Frame = -2

Query: 245 IPVSPVVLMETSLEPVISGTFTTTELFMPISLSFLPLHRTATVIFNSS 102
           +PVSPVVL+ETSL PV SGT TTTEL    S S  PLHRTATVI +SS
Sbjct: 1   MPVSPVVLIETSLVPVTSGTATTTELLAFTSFSLRPLHRTATVILSSS 48

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 108/513 (21%), Positives = 220/513 (42%), Gaps = 28/513 (5%)
 Frame = +1

Query: 1207 SINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 1386
            S N+S + L  + N +   S     +E +  ++ + S+  N +  L  TIS  + T EE 
Sbjct: 988  SKNESSIQLSNLQNKIDSMS-----QEKENFQIERGSIEKNIEQ-LKKTISDLEQTKEEI 1041

Query: 1387 CSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK 1566
             S      K+ + K++ +    ++K+ L    T     +      TK++E +      YK
Sbjct: 1042 IS------KSDSSKDEYESQISLLKEKLETATTANDENVNKISELTKTREELEAELAAYK 1095

Query: 1567 NLNSDLESH----KNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATIN 1734
            NL ++LE+     +  ++E K   E L  +   L K+  ++++ + S  + +ESL+    
Sbjct: 1096 NLKNELETKLETSEKALKEVKENEEHLKEEKIQLEKEATETKQQLNSLRANLESLEKEHE 1155

Query: 1735 HLKAQL--------DKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHI 1890
             L AQL        +K+ +   EIS  N+++    +  +   +  K  EL+   K     
Sbjct: 1156 DLAAQLKKYEEQIANKERQYNEEISQLNDEITSTQQENESIKK--KNDELEGEVKAMKST 1213

Query: 1891 SKEIKSLK----TALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLME-----TMQEKA 2043
            S+E  +LK     AL LQ+  +++KN   E  +  ++  V++E + + E       +EK 
Sbjct: 1214 SEEQSNLKKSEIDALNLQIKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKE 1273

Query: 2044 ELMYKDCVKKILNESPKFFNV------IVEKIDIIRIEFQNFYKNIAENLSDISEENNNL 2205
                +D +K   +++ K+  +      I E++D    E +   + I  NLS   E++ + 
Sbjct: 1274 VSELEDKLKASEDKNSKYLELQKESEKIKEELDAKTTELKIQLEKIT-NLSKAKEKSESE 1332

Query: 2206 KQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTN 2385
               LK    K + +E  N       E +EK  N+         N   E+ +KL+ +  + 
Sbjct: 1333 LSRLK----KTSSEERKN-----AEEQLEKLKNEI-----QIKNQAFEKERKLLNEGSST 1378

Query: 2386 ATSAVIDQEMDLFEPRRAKWENSFDL-INKCDSMNNEFYNNMAATLSQIKKTVDTSSNSM 2562
             T     ++++  E    + +N  +L   + D+  +E      +    +++  +T  +  
Sbjct: 1379 ITQE-YSEKINTLEDELIRLQNENELKAKEIDNTRSELEKVSLSNDELLEEKQNTIKSLQ 1437

Query: 2563 NESISVMKGQVEESENAISLLKNNTKFNDQFKQ 2661
            +E +S         E  +S+ ++N +  +  K+
Sbjct: 1438 DEILSYKDKITRNDEKLLSIERDNKRDLESLKE 1470

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 76/414 (18%), Positives = 176/414 (42%), Gaps = 16/414 (3%)
 Frame = +1

Query: 1471 VKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEV-----------QECK 1617
            + N   EL K+     S  + E +   Q+  K+L  ++ S+K+++           ++ K
Sbjct: 1408 IDNTRSELEKV-----SLSNDELLEEKQNTIKSLQDEILSYKDKITRNDEKLLSIERDNK 1462

Query: 1618 REIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNN 1797
            R++ESL        K++L++ +  +S+    E LK              K E E S    
Sbjct: 1463 RDLESL--------KEQLRAAQ--ESKAKVEEGLK--------------KLEEESSKEKA 1498

Query: 1798 KLQKMTEVMQVALQDYKKRELDLNKKFET--HISKEIKSLKTALFLQLDNMQQKNIFQET 1971
            +L+K  E+M+      +  E +L    ET     ++++  K +    + N+Q     +++
Sbjct: 1499 ELEKSKEMMKKLESTIESNETELKSSMETIRKSDEKLEQSKKSAEEDIKNLQH----EKS 1554

Query: 1972 DIQPNLDMVKNEVLTLMETMQEKAELMYK-DCVKKILNESPKFFNVIVEKIDIIRIEFQN 2148
            D+   ++  + ++  L   ++ +A+   + + VK+ LN + +   +  E+  +++ + ++
Sbjct: 1555 DLISRINESEKDIEELKSKLRIEAKSGSELETVKQELNNAQEKIRINAEENTVLKSKLED 1614

Query: 2149 FYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEK-KTNQFVENFK 2325
              + + +  ++I  ++N  ++ L     K   QEL     DST +  +K +  +  E  K
Sbjct: 1615 IERELKDKQAEI--KSNQEEKELLTSRLKELEQEL-----DSTQQKAQKSEEERRAEVRK 1667

Query: 2326 MTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNN 2505
              +     + K ++++   N          DL    +A W+   D + K      +    
Sbjct: 1668 FQVEKSQLDEKAMLLETKYN----------DLVNKEQA-WKRDEDTVKKTTDSQRQEIEK 1716

Query: 2506 MAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAIS-LLKNNTKFNDQFKQL 2664
            +A  L  +K     + NS  +  +  + ++++    ++ L + N K+  + K L
Sbjct: 1717 LAKELDNLK-----AENSKLKEANEDRSEIDDLMLLVTDLDEKNAKYRSKLKDL 1765

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
            Anc_2.633
          Length = 598

 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 84/365 (23%), Positives = 162/365 (44%), Gaps = 25/365 (6%)
 Frame = +1

Query: 934  NGI----YIQNLQEFHITNALEGLNLLQRGLKHR-QVASTKMNDFSSRSHTIFTITLYKK 1098
            NGI    +++NL    I +    L+ LQ+  K   Q +S  +N  +++     +I + K 
Sbjct: 198  NGIKGDKHVKNLSHIQIAS----LDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKI 253

Query: 1099 H------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 1260
            H      +D+L+++S ++ +DL G +   +   +     E   +N  + +   +I  L D
Sbjct: 254  HLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSD 312

Query: 1261 RSGHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETCSTLEYASKAKN 1422
                +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+
Sbjct: 313  PKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKS 371

Query: 1423 IKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNE 1602
            IKN   +  F +       + ++ +K++ +   TK    I   Q      N  LE    +
Sbjct: 372  IKNPLIMNVFGLNLQKQMLLFIKSSKLREENCQTK----INYLQSELALKNKLLEPVATD 427

Query: 1603 VQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEI 1782
              E     ES  S    ++K KLK           +ESL+  + H+     +  K++ E 
Sbjct: 428  HHEENYNDESSCSDKETIMKLKLK-----------IESLEQVLEHIST--SENPKSKTET 474

Query: 1783 SGFNNKLQKMTE------VMQVALQDYKKRELDLNKKFETHISKE--IKSLKTALFLQLD 1938
            +  +  L+K+ +       +QV ++  K     L +  +   SK+  ++++   L  QL 
Sbjct: 475  NEHDELLKKLMDKCEDVAKLQVEIEAEKNTNSKLKQDLKYSASKQHALETMNLKLLEQLQ 534

Query: 1939 NMQQK 1953
            N +++
Sbjct: 535  NQEKE 539

 Score = 35.4 bits (80), Expect = 0.90
 Identities = 23/117 (19%), Positives = 56/117 (47%)
 Frame = +1

Query: 175 VVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDF 354
           VV+N+  +  +++ +     +   T +++++ +  D +F   + Q+   E +     +D 
Sbjct: 37  VVLNLSSLKANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDL 93

Query: 355 IKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSD 525
             GYN + + YG +++GK+ T+           N+  G+I  +  +LF  ++   +D
Sbjct: 94  FDGYNQSFITYGKSNSGKSDTL----------FNEKDGLIRLLFEQLFKKVQSLTAD 140

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
            YDR356W
          Length = 989

 Score = 69.3 bits (168), Expect = 4e-11
 Identities = 101/518 (19%), Positives = 214/518 (41%), Gaps = 9/518 (1%)
 Frame = +1

Query: 1456 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESL 1635
            MK   ++N+ +EL  +K   L+TK KE +   ++   N++S+ E +K +      E    
Sbjct: 345  MKLSEIENLELELNDLKD--LNTKLKESLNDKENELTNVSSEYEKYKLDA-----EAHMG 397

Query: 1636 ASKNSLLVKDKLKSRET-IQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKM 1812
              K+S    DKLK++   I+ +N ++ S    +N +   L             N++L  +
Sbjct: 398  IMKDS---DDKLKNQVIEIRKKNIELNSKLLQMNEVNENL-------------NDELMSL 441

Query: 1813 TEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLD 1992
             ++++   QD KK +L           +E+KSLK++   Q+++++Q N+  E  ++ NLD
Sbjct: 442  KDIIEKLEQD-KKAKL-----------QELKSLKSSDISQIEDLKQNNLTLERKLKENLD 489

Query: 1993 MVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAEN 2172
              KN  +  +       +      V K+  ES        +KI+ +  + ++   +++ N
Sbjct: 490  -EKNVEINKLRRQHVDMQKTNSALVDKLTKESQSLRKEYEDKINDLENQLKSNITDLSTN 548

Query: 2173 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEE 2352
               ++ E N+    L     +N H       + ++ E I+   NQ +EN           
Sbjct: 549  KDLLAVEYNSKMDKLNKELEENKHA------LKTSEEIIKDLKNQLIENV---------T 593

Query: 2353 NKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFD-LINKCDSMNNEFYNNMAATLSQI 2529
            N    +  +T A ++ I+  +   E  R K+    + LIN+ +     +   +       
Sbjct: 594  NSSQKLAKLTEAKNSEIESLLSQMESLRNKYRKKTETLINEQEEERQSYIRKLREEKLST 653

Query: 2530 KKTVDTSSNSM----NESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNI 2697
            ++  D     +    +E  +++  + E  +N       N K N   ++L+ +       +
Sbjct: 654  EREKDNYDKLLLQFNSEKNAIINSKKELEDNL------NNKIN-SLEKLLQQTSSTDVEL 706

Query: 2698 EXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISN 2877
            E            + ++Y  ++ +          +K+E+  + LK I ++++ L + +  
Sbjct: 707  ETLKSELRGKELEIKELYKKVKSV--------TDSKEELNSDYLK-IRSINRELKVELKK 757

Query: 2878 INGCSVQDIISPKKHTIEDE---NPSSENADSEGSRKI 2982
            I      + I+ K  T+ DE   N  ++N   E    +
Sbjct: 758  I--VDEYNDIAKKYRTLNDEFINNSKAKNGLEEAKANL 793

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 119/605 (19%), Positives = 255/605 (42%), Gaps = 52/605 (8%)
 Frame = +1

Query: 1306 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNIT 1485
            LQD+L  N K  +I ++   K   +E    ++   K  N K+       + +  L   + 
Sbjct: 242  LQDNL--NKKNLIIESLQNDK---KENLKLMDSMKKTINEKSSSIEALDIQRTDLAHQLQ 296

Query: 1486 MEL--AKIKSDLLSTKSKEGIYMSQD----HYKNLNSDLESHKNEVQECKREIESLASKN 1647
              L  + I++D     SK  I   Q+      + L+SD++S  ++     ++I SL  KN
Sbjct: 297  YLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQEKN 356

Query: 1648 SLLVKDKLKSRETIQSQNSQMESLKA-----TINHLKAQL----DKQHKAELEISGFNNK 1800
              L K       +++S+ S++++ +      TIN  K  +    +  +  +LEI    +K
Sbjct: 357  MELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLEIGTLQSK 416

Query: 1801 LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQ--KNIFQE-T 1971
            + ++   +  + ++ +K+  + +      +  ++  L       ++N+ +  +N++ E T
Sbjct: 417  ISELQSSIPNS-KESEKQHFNYHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERT 475

Query: 1972 DIQPNLDMVK------NEVLTLMETMQ-----EKAELMYKDCV-KKILNESPKFFNVIVE 2115
            DI  NL+  K      NE LTL++        E  EL  K+ + ++ LNE  K  N ++ 
Sbjct: 476  DILINLEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLN 535

Query: 2116 ---KIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEN 2286
               K     ++F N    +  N   + EENN+LKQ +K+++ +    +  + H++ + EN
Sbjct: 536  DYIKCKTNLLDFTNRLTLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLEN 595

Query: 2287 IEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVID------QEMDLFEPRRAKWE 2448
               K    V+  ++ ++  L E K ++ + + N    + D       ++  ++ +  ++E
Sbjct: 596  EISKYTDKVKELELNIS-KLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYE 654

Query: 2449 NSFDLINK---CDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQ--------- 2592
             +   +      D+ N++      A       +  +SS S NE    + G          
Sbjct: 655  KTIKTLESRLPADTQNSKALVEDKALEDSRDASPVSSSASCNEITIRIFGDSNKTKKIYP 714

Query: 2593 VEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIM 2772
            +EE +N   + K       + + L +++ +L + +E            VDDI+ ++    
Sbjct: 715  IEEEKNLELITKELEDTKVRVQNLATQNRLLLEKLE------RSANLEVDDIFVSL---- 764

Query: 2773 TNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQDI-ISPKKHTIEDENPSS 2949
                  E  T  + + N  K++  +   L    S +N  + Q +    ++  ++D    +
Sbjct: 765  ----RYERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGN 820

Query: 2950 ENADS 2964
             N ++
Sbjct: 821  VNEET 825

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 98/468 (20%), Positives = 195/468 (41%), Gaps = 43/468 (9%)
 Frame = +1

Query: 1693 SQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNK 1872
            ++NS  ES K      K ++D  +   L+I   NN   K++  ++  ++ +   ++D NK
Sbjct: 36   NENSDTESFKD-----KFKIDNLN---LQIQHINNDNLKLSNQLKNIIEKFNLSKIDQNK 87

Query: 1873 KFET------HISKEIKSLKTALF------------LQLDNMQQKNIFQETDIQPNLDMV 1998
              E        +  E K+L +               L L  ++ KN+    D    L++ 
Sbjct: 88   TIENLKLKLFKLENENKTLNSTNLNLTDKNDTLNNNLNLKLIELKNL---NDNITELELK 144

Query: 1999 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNV--IVEKIDIIRIEFQNFYKNIAEN 2172
            +N  + L + + ++     ++ +K  L +SPKF N   I+     I  + +N    I  +
Sbjct: 145  RNNDIQLKDKLIQQLNSKIENLLK--LGKSPKFKNEVEIINDSKTINDDIENSKATIPPS 202

Query: 2173 LSD-ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIE---KKTNQFVENFKMTLND 2340
             +  +S++NN LK  ++N+  +   Q  L  +  +  EN++    K N  +E    +L +
Sbjct: 203  PAKALSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIE----SLQN 258

Query: 2341 HLEENKKLI--MQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAA 2514
              +EN KL+  M+   N  S+ I    +  + +R    +    +    S+ N+  NN   
Sbjct: 259  DKKENLKLMDSMKKTINEKSSSI----EALDIQRTDLAHQLQYLLIHSSIQND--NNGPL 312

Query: 2515 TLSQI---KKTVDTSSNSMNESI-SVMKGQVEESENAISLLKNNTKFNDQFKQLI----S 2670
            + S+I   +  ++     ++  + SV+  ++ + ++ +SL + N +     + L     S
Sbjct: 313  SKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLES 372

Query: 2671 KHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIM--TNHGNKENATKDEMIDNILKEIPN 2844
            K   +K++ E            +++   TI  +    N    E  T    I  +   IPN
Sbjct: 373  KESEIKNSRE------NYDNDTINEAKETILSLQEYNNVLKLEIGTLQSKISELQSSIPN 426

Query: 2845 LSKRLPLRISNINGCSVQDIISP-------KKHTIEDENPSSENADSE 2967
             SK    +  N +   V+D+ S         + TIE+ N   +N  +E
Sbjct: 427  -SKESEKQHFNYHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNE 473

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 82/361 (22%), Positives = 147/361 (40%), Gaps = 11/361 (3%)
 Frame = +1

Query: 1027 VASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAG 1206
            V++ K  ++ +R + +   TL  K+ D    I+    V+    EN   S   N+  K+A 
Sbjct: 891  VSNEKAENWKTRFNEL---TLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQA- 946

Query: 1207 SINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 1386
              N+ L       N L ++S  +  R + L R L + +                    E 
Sbjct: 947  --NERLHASKVAQNNLTEQSNELKARNTDLERNLSEQM--------------------ER 984

Query: 1387 CSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK 1566
               LE +   K+     +LG+       + N   +  K + +L+ T S+          +
Sbjct: 985  FKELENSISLKD----QELGSIGDLKEQLANALDKSKKFEEELIKTVSES---------E 1031

Query: 1567 NLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRET-IQSQNSQMES--------L 1719
            +L SDL          K EIESL         +KLKS+E+ +  Q S++E+        L
Sbjct: 1032 SLVSDL----------KNEIESL--------NEKLKSKESSVGLQESEIENAKKILIAEL 1073

Query: 1720 KATINHLKAQLDKQHKAELEI--SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHIS 1893
            +  +N  K++LD +HK EL++  + +   +QK     + AL+  +K  L   +K  T I 
Sbjct: 1074 EEKLNKTKSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALK--RKIRLPSEEKINTIIE 1131

Query: 1894 KEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKK 2073
             ++  L+     +L+ +  ++   E   Q   D + N      E  +++A +  K    K
Sbjct: 1132 SKVADLEEDYKKKLETVSAESTDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENK 1191

Query: 2074 I 2076
            I
Sbjct: 1192 I 1192

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 142/752 (18%), Positives = 290/752 (38%), Gaps = 113/752 (15%)
 Frame = +1

Query: 961  EFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLV 1140
            E  + +  E LN + + L+       K N F+ +    +  T++K  Q+E  R  +  L 
Sbjct: 794  EIELKSITESLNEMTK-LRDALETKDKDNSFALQE---YKSTIHK--QEEAIRTLEKELE 847

Query: 1141 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSL 1320
             ++  +     G +N+  K+  ++++    +     +L            K T+ L+D +
Sbjct: 848  TISSQKKKAEDG-INKMGKDLFALSREKQAVEEKQRSLQKEKDKSNSDHQKETKSLKDEI 906

Query: 1321 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMEL-- 1494
                K   I T++   V ++   S L    +  + +       F   D LV  +T +L  
Sbjct: 907  --TKKIIEIKTLNENLVKTKTQHSALSEEKEQISKELVEYKSRFQSHDNLVAKLTEKLKS 964

Query: 1495 ---------AKIKSDLLS---TKSKEGIYMS--QDHYKNLNSDLESHKNEVQECKREIES 1632
                     AK +S + S   TKS+    +S  QD + +L+ + ES + E +    +I+ 
Sbjct: 965  LANNYRDLQAKHESLMQSIEVTKSENDTQLSNLQDKFDSLSREKESFQTEKEHLTDDIKE 1024

Query: 1633 LASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKM 1812
            L    S L   + K+ ET     S  +  ++ IN LK QL+     + +     ++L K 
Sbjct: 1025 LKETISRL---EHKNEETTSRYTSAKDDYESQINQLKEQLETATTTQDDNMDKISELSKN 1081

Query: 1813 TEVMQVALQDYKKRELDLNKKFET--------------------HISKEIKSLKTALFLQ 1932
               +++ L+  K  + DL  K E                      + KE+ + K  L   
Sbjct: 1082 IRNLEMLLETCKSSKHDLQTKLEASEKTLAEMHENEERLKEEKAQLEKEVVNTKKELSTL 1141

Query: 1933 LDNMQQ-------------------------------------KNIFQETD-IQPNLDMV 1998
             +N +                                      ++I QE + +  N D +
Sbjct: 1142 RENFESLEKEHKDSVTQVGEYEKQITDKAKEYNENISKLNDDIRSIQQENEALCKNNDNL 1201

Query: 1999 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNV--------IVEKIDIIRIEFQNFY 2154
            K EV  + +T++E++ L  ++   + LN   K   V        + E +    IE +   
Sbjct: 1202 KGEVEQVKQTLEEQSNL--RESTVEALNTQIKDLEVKNQSSEAKLSESVKNKEIETEKMI 1259

Query: 2155 KNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTL 2334
            + + +  +   EE + L++ LK    +N+H   L   ++     +E +TN+     +   
Sbjct: 1260 E-LQKECNSRKEEISELEEKLKTSEVENSHNLELLKELEEDKRELEIRTNEVKNQSEKIA 1318

Query: 2335 N-DHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMA 2511
            N D L E  +  +  +   ++   D++ +L E +  K  N   + ++      +  N  +
Sbjct: 1319 NLDKLREKTEAELCRLKKTST---DEKSNL-EEQLGKLRNEIKIKSQAFEKERKLLNEGS 1374

Query: 2512 ATLSQ----------------------IKKTVDTSSNSMNESISVMKGQVEESENAISLL 2625
            +T++Q                        + +DTS N + ++       +EE  N I  +
Sbjct: 1375 STITQEYSEKINMLEDQLNKLENENESKTRLIDTSKNELEKATLSHDEILEEKRNEIKSM 1434

Query: 2626 KN-----NTKFNDQFKQLIS---KHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNH 2781
            K+       K N+   +L+S    H    ++++            V+   N +E+   ++
Sbjct: 1435 KDEILSYKEKINEANTKLLSTERDHESRSNSLKEQLEAVQESKAEVERKMNEMEEESAHY 1494

Query: 2782 GNKENATKDEMIDNILKEIPNLSKRLPLRISN 2877
             ++ N +K E+++N+  +I N  K+L L + +
Sbjct: 1495 KSELNKSK-EIVENLKSDIENNEKKLELLVES 1525

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 108/542 (19%), Positives = 220/542 (40%), Gaps = 58/542 (10%)
 Frame = +1

Query: 1516 LSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQS 1695
            +S  S E +   Q     L S+L S + E    K   E L  K   L K+  +  E  QS
Sbjct: 722  ISKISFEEVEELQKQCAKLKSELGSLQTET---KTTNEDLTEKLGTLSKEHEELVEKYQS 778

Query: 1696 QNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYK--------- 1848
              S   SLK  ++ L+ +L    ++  E++   + L+   +    ALQ+YK         
Sbjct: 779  LTSSHMSLKENVSSLEIELKSITESLNEMTKLRDALETKDKDNSFALQEYKSTIHKQEEA 838

Query: 1849 ----KRELDL----NKKFETHISKEIKSL------KTALFLQLDNMQQKNIFQETDIQPN 1986
                ++EL+      KK E  I+K  K L      K A+  +  ++Q++     +D Q  
Sbjct: 839  IRTLEKELETISSQKKKAEDGINKMGKDLFALSREKQAVEEKQRSLQKEKDKSNSDHQKE 898

Query: 1987 LDMVKNEVL-------TLMETM-----QEKAELMYKDCVKKILNESPKFFNVIVEKIDII 2130
               +K+E+        TL E +     Q  A    K+ + K L E    F    +  D +
Sbjct: 899  TKSLKDEITKKIIEIKTLNENLVKTKTQHSALSEEKEQISKELVEYKSRF----QSHDNL 954

Query: 2131 RIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQF 2310
              +     K++A N  D+  ++ +L Q ++    +N+ Q     ++   ++++ ++   F
Sbjct: 955  VAKLTEKLKSLANNYRDLQAKHESLMQSIEVTKSENDTQ---LSNLQDKFDSLSREKESF 1011

Query: 2311 VENFKMTLNDHLEENKKLI--MQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSM 2484
             +  K  L D ++E K+ I  +++    T++      D +E +  + +   +        
Sbjct: 1012 -QTEKEHLTDDIKELKETISRLEHKNEETTSRYTSAKDDYESQINQLKEQLETATTTQDD 1070

Query: 2485 NNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQL 2664
            N +  + ++  +  ++  ++T  +S ++    ++ ++E SE  ++ +  N +   + K  
Sbjct: 1071 NMDKISELSKNIRNLEMLLETCKSSKHD----LQTKLEASEKTLAEMHENEERLKEEKAQ 1126

Query: 2665 ISKHII--------LKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHG------------ 2784
            + K ++        L++N E            V +    I D    +             
Sbjct: 1127 LEKEVVNTKKELSTLRENFESLEKEHKDSVTQVGEYEKQITDKAKEYNENISKLNDDIRS 1186

Query: 2785 -NKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDENPSSENAD 2961
              +EN    +  DN+  E+  + + L  + SN+   +V+ + +  K  +E +N SSE   
Sbjct: 1187 IQQENEALCKNNDNLKGEVEQVKQTLEEQ-SNLRESTVEALNTQIK-DLEVKNQSSEAKL 1244

Query: 2962 SE 2967
            SE
Sbjct: 1245 SE 1246

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 51/159 (32%), Positives = 73/159 (45%), Gaps = 5/159 (3%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAK--RYT 276
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 277 VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN 456
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM          LN
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 457 DAAGIIPRVLLKLFDTLELQQS---DYVVKCSFIELYNE 564
              GIIP  L  +F  +E  +     Y +   FIE+YNE
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNE 497

 Score = 35.8 bits (81), Expect = 0.68
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1089
            +  S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 524  DSDSQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 51/159 (32%), Positives = 73/159 (45%), Gaps = 5/159 (3%)
 Frame = +1

Query: 103 EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAK--RYT 276
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 277 VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN 456
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM          LN
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 457 DAAGIIPRVLLKLFDTLELQQS---DYVVKCSFIELYNE 564
              GIIP  L  +F  +E  +     Y +   FIE+YNE
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNE 497

 Score = 35.8 bits (81), Expect = 0.70
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +1

Query: 922  NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1089
            +  S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 524  DSDSQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa] {ON}
            Anc_4.46 YLR309C
          Length = 1065

 Score = 65.5 bits (158), Expect = 6e-10
 Identities = 107/499 (21%), Positives = 211/499 (42%), Gaps = 46/499 (9%)
 Frame = +1

Query: 1342 LIATISPAKVTSEETCSTLEYASKAKN------IKNKPQLGAFMMKDILVKNITMELAKI 1503
            LI   +  K+  E++ S +++ S+  +        NK Q       +     +  +L ++
Sbjct: 469  LIEEYNEFKINHEKSISDIKHTSELDDELQLLRSTNKEQEDKIDDLEAEKNKVLADLGEL 528

Query: 1504 KSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQEC-----------KREIESLASKNS 1650
            K+ L S    E I   +D  + + ++L   K+++++            KRE++ L  KNS
Sbjct: 529  KAALKS--KNEEIENLRDMLRTVGNELVEAKDQIKDAGSLNAKEAESLKRELDDLREKNS 586

Query: 1651 LLVK-------DKLKSRETIQSQNSQMESLKATINHLKAQLDKQ-HKAELEISGFNNKLQ 1806
             +++       D  K  + ++++  ++ S  A     +  LDK+  + E  IS F    Q
Sbjct: 587  AVIQTYETKIADLKKDFDNMKNEKDKLLSNAALTERQRKILDKKISQMEEHISQF----Q 642

Query: 1807 KMTEVMQVALQDYKKRELDLNKKFETHISKEI-KSLKTALFL--QLDNMQQKNIFQETDI 1977
            K    +   L+DY     DL  K ET++   I +  KT  +L  Q+ +  +K+   +  I
Sbjct: 643  KEKVELDTKLKDY-----DLLVKSETYLKTSITQKEKTIAYLEKQVKDYNEKSASNKQAI 697

Query: 1978 QPNLDMVK--NEVLTLMETMQEKAELMYKDCVKKILNESPKFF---NVIVEKIDIIRIEF 2142
                D+VK  +E   L  +  +K     K+  KK +  S  +     ++ E+I I++ +F
Sbjct: 698  ----DLVKKESEQYKLRMSALQKENRDLKENSKKNITSSENYIKENGILSERIKILQEKF 753

Query: 2143 ---QNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFV 2313
               QN   N  E +  I  +   L   LK     N     L   ++     I++KT +  
Sbjct: 754  DHAQNLKSNSNEQVESIQRQCEELNVKLKE---SNKRVMSLEDELNDYSNIIQEKTREAT 810

Query: 2314 ENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDL--------IN 2469
               ++  + H  +++KL            +  ++D F     + ++ F+L        + 
Sbjct: 811  TMRQLISDSHNGDSQKL----------RELHDKIDYFTDENKRLKSEFELSSGKMSRELQ 860

Query: 2470 KCDSMNNEFYNNM-AATLSQIKKTVDTSS-NSMNESISVMKGQVEESENAISLLKNNTKF 2643
            +  + N++   ++ A TLS+ +   +  +  S+NESI   K      E+   L K+N+  
Sbjct: 861  EAQAKNSKLQTSIHALTLSEQRLNAEIENLKSVNESI--RKKSTVNGEDTDELEKSNSSL 918

Query: 2644 NDQFKQLISKHIILKDNIE 2700
             +   +  +K   L++NIE
Sbjct: 919  KEALSKADTKVRDLQENIE 937

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 42/200 (21%), Positives = 86/200 (43%), Gaps = 16/200 (8%)
 Frame = +1

Query: 2137 EFQNFYKNIAENLS-----DIS-------EENNNLKQYLKNHFFKNNHQELLNHHIDSTY 2280
            +   F KN+ + LS     DIS       ++N+ L + +++   K    E     + S Y
Sbjct: 4    QISQFSKNLTDELSKGLADDISSPGEPVPDDNSGLPKEVQDKLRKFEKYEQKYPLLLSAY 63

Query: 2281 ENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFD 2460
            +N + K+ +F++             +K+I +N   ++    +     F+   AK     +
Sbjct: 64   KNEKMKSEKFIQM------------EKIITENTPISSLDDAESLTSFFQNLDAKTSMYNE 111

Query: 2461 LINKCDSMNNE----FYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLK 2628
             I +  S+N+E      N++ +T S+I  T +  + S N+S      Q+E+    I  L+
Sbjct: 112  EIKRLTSLNSENEKRMKNSIGSTTSEI-DTAEEKATSENDSAK----QIEDLLEKIKELE 166

Query: 2629 NNTKFNDQFKQLISKHIILK 2688
            +    +D+  + + K   +K
Sbjct: 167  DKVTSSDEKNKELKKSYEVK 186

>TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {ON}
            Anc_1.110 YNL250W
          Length = 1303

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 109/489 (22%), Positives = 207/489 (42%), Gaps = 24/489 (4%)
 Frame = +1

Query: 1510 DLLSTKSKEGIYMSQDHYKNLNSDLESHKNE---VQECKREIESLASKNSLLVKDKLKSR 1680
            DL+ T   E  Y+  D  + L  D+ S  NE   V + K + ES  +K+     DKL++ 
Sbjct: 709  DLVETMKHEKEYL--DSLRKLEKDVNSLFNERELVNKLKTDFESNKTKS-----DKLRAE 761

Query: 1681 ETIQSQN--SQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKR 1854
              IQ  +  S  E L+   + ++  +++    + EIS  NN LQ +T+ +++        
Sbjct: 762  VKIQDAHIKSLKEKLETVTSTIRPLIEENFHLQKEISSLNNDLQNITDELKL-------- 813

Query: 1855 ELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQ 2034
                N   +  ++ E    K  L  Q    ++K I    D + +    K  +  +++   
Sbjct: 814  ---YNISSDGLLTLEELQSKQTLCNQTLREKRKKISLLQDGRESRAKEKATLSGIIKDRS 870

Query: 2035 EKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQY 2214
             K E M  D +KK   E+ +  N+ +E++  I +   +F K++    + I+E N N+ + 
Sbjct: 871  LKVEKMKNDLLKKESLENER--NLKLEEVSNIEVRLNSFEKDVKLLQNKITEINANITK- 927

Query: 2215 LKNHFFKN--NHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNA 2388
            LK+   K   N +E++        E + K  +QF      TL + ++E      +   NA
Sbjct: 928  LKDQHDKAALNKKEII--------EGLSKTMDQF-----KTLQNSIKE-----FELTGNA 969

Query: 2389 TSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIK-KTVDTSSNSMN 2565
                 ++E+   E  ++K +N            N   +   A LS++K + +D++S   N
Sbjct: 970  DLKACNEEL---EDYKSKLKNI-----------NVAIDQKTANLSKLKEELIDSNSRKKN 1015

Query: 2566 -------ESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXX 2724
                    S+ V     E+  N I  ++N  +  D++++ IS+   L++  E        
Sbjct: 1016 LMDNLELHSLKVKLSNTEKEINCID-VENAERQRDKYQEEISR---LRNLYEQLSADNAG 1071

Query: 2725 XXXNVDDIYNTIEDIM----TNHGNKENATKDEMI-----DNILKEIPNLSKRLPLRISN 2877
                +  + N I+ +     T++ + +N  K E         + ++I   SK L   I  
Sbjct: 1072 KLGEIKQLQNQIDSLSHQLHTDYKDIDNKYKTEWAKLQTKTFVTEDINTYSKALDSAIMR 1131

Query: 2878 INGCSVQDI 2904
             +G  +QDI
Sbjct: 1132 YHGLKMQDI 1140

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 63/274 (22%), Positives = 122/274 (44%), Gaps = 16/274 (5%)
 Frame = +1

Query: 1717 LKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISK 1896
            LK ++ HLK   D+    +  I     KLQ   E  +  +++ + + +D+ K+ +  + K
Sbjct: 205  LKQSVEHLKVDKDRSKATKFNIE----KLQHKCEQFKKTVKEIESQLVDITKQSD-EVFK 259

Query: 1897 EIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKI 2076
              +  +  L   L+N+++           N + + +++  L ET+      +    V++I
Sbjct: 260  TNQDFQKVL-AHLENLKR-----------NREYISHQINRLSETIN-----VISLPVEEI 302

Query: 2077 LNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQY---LKNHF--FKNN 2241
                  F      K D I+ + +N    + +N++ I E++N L +    LK+++  + NN
Sbjct: 303  EQNLVIFDRDTATKDDQIK-QLENDISELKQNVNQIQEQSNILLEKQGKLKSYYDIYINN 361

Query: 2242 HQELLN--HHIDSTYENIEKKTNQFVENFKMTLNDHLE-ENKKLIMQNMT--------NA 2388
               L N   ++   Y NI K+ +   E F+  LNDHL+ EN  L+  N T        N+
Sbjct: 362  LSSLKNLKENVSRQY-NINKEFSD--ETFQTALNDHLDKENNHLLQLNNTFSNELEGLNS 418

Query: 2389 TSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNN 2490
              + +D   DL    + +  N  D I   + ++N
Sbjct: 419  KKSTLD--YDLVVQLQQQEYNKKDKIKASEKLDN 450

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_5.702
            YIL149C
          Length = 1183

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 116/550 (21%), Positives = 227/550 (41%), Gaps = 26/550 (4%)
 Frame = +1

Query: 1366 KVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIY 1545
            + TS    ++ E+ +    +K+  +L   +  + LV + ++ L+   S+    K +    
Sbjct: 5    ETTSSIVVNSEEWDALHNKLKDLKELNNGLKNEFLVLSNSLNLSNNNSNNSINKKQLDFS 64

Query: 1546 MSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKA 1725
              +  ++ +NS  E  KNE          L +KN    + K       Q  + ++E  K+
Sbjct: 65   ELEKRFEVINSINEQLKNE----------LYTKNKEYFQIK-------QECDVKIEDYKS 107

Query: 1726 TINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIK 1905
             +N LK +L K      EI    N  QK+  V + ++ +  + +    K FE   + E K
Sbjct: 108  NLNELKHRLSK------EILQNKNNKQKIINVYEHSINESLENDKKYVKDFEKLETLESK 161

Query: 1906 SLKTALFLQLDNMQQKNIFQETDIQPNLD----------MVKNEVLTLMETMQEKAELMY 2055
             L+T  + Q++ M+ K  F      P  +           V N   +   +++   +L  
Sbjct: 162  FLET--YDQMNIMKNKIYFNTQPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLNI 219

Query: 2056 KDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNH--- 2226
            K  V K+         +  E + II++  +N   NI  +L +++  NNNL  Y   H   
Sbjct: 220  KKVVYKLQERLETVSTMNKELLKIIKLS-ENEEMNI--SLQNLNSNNNNL--YNDTHSNN 274

Query: 2227 ---FFKNNHQELLNHHIDSTYEN--IEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNAT 2391
               F  NN  ++    I   YE   +EKK N F+ + +  L  +L+ N    ++N TN  
Sbjct: 275  DFEFDINNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKL-PYLQNNS---VENETNNG 330

Query: 2392 SAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNES 2571
            + + +Q++ + E    K EN    I   D      + +   TL Q +  +    N +  +
Sbjct: 331  NKIEEQKI-IHEHDSLKLENQSLKIKLND------FESTVKTLLQQRSDLGHQINYLLIT 383

Query: 2572 ISVMKGQVEE--SENAISLLKN-----NTKFNDQFKQLISKHIILKDNIEXXXXXXXXXX 2730
             S +     +  +EN ++ ++N        ++ + + +IS+ ++   N+           
Sbjct: 384  QSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLI 443

Query: 2731 XNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKR-LPLRISNINGCSVQDII 2907
              V ++ N +E I      K+N+ K   ++   K I    +R + L+  N+    + + I
Sbjct: 444  SLVRELTNKMESI-----EKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQI 498

Query: 2908 SPKKHTIEDE 2937
              +K  +ED+
Sbjct: 499  ISEKKLLEDK 508

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 92/457 (20%), Positives = 184/457 (40%), Gaps = 9/457 (1%)
 Frame = +1

Query: 1624 IESLASKNSLL---VKDKLKSRETIQSQNSQ----MESLKATINHLKAQLDKQHKAELEI 1782
            +  L +KN  L   V++     E+I+ QNSQ    +E    +I+  K ++    +  ++ 
Sbjct: 432  VSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKN 491

Query: 1783 SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF 1962
                N++    ++++  +        +LNK      S EIK   T   L+L    Q  + 
Sbjct: 492  KDIINQIISEKKLLEDKIHGLNSTVTELNK------SMEIKREPTLKNLELQKTNQSLLE 545

Query: 1963 QETDIQPNLDMVKNEVLTLMETMQEKAELMYKDC--VKKILNESPKFFNVIVEKIDIIRI 2136
            +   +   +    NE     + ++EK +L+ K    +K++ +E   +    V   D    
Sbjct: 546  KNNQLSIEISNASNE----NKILKEKFDLLIKSYTELKELKSEISTYTKSSVISKD---- 597

Query: 2137 EFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVE 2316
               N    I+E L D+  +  NL++  K+   K    E+ N+++    + +  + N F +
Sbjct: 598  --GNETAKISE-LVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYNTF-K 653

Query: 2317 NFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEF 2496
            + + T+ D   +NK  I  N  N    ++ +E++  +      E    L      +  E 
Sbjct: 654  STRGTI-DSFNQNKNSIGIN-ENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEK 711

Query: 2497 YNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKH 2676
            Y       SQIK   D   + MN ++ V    +  S  + ++LKN  + ++  KQ+ +K 
Sbjct: 712  YK------SQIKWYQD-KIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKS 764

Query: 2677 IILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKR 2856
              L ++++               +    +D +      EN  +++  D + K    L +R
Sbjct: 765  KELTESLDRFAR-----------LKKQAKDKLNEFKGTENKLREDYCD-LEKSKNELEQR 812

Query: 2857 LPLRISNINGCSVQDIISPKKHTIEDENPSSENADSE 2967
            L L  S+      ++I+  K   +   N    N  S+
Sbjct: 813  LLLLESSEKSLQ-EEIVKMKDELMTSNNELDNNQRSQ 848

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 101/506 (19%), Positives = 208/506 (41%), Gaps = 39/506 (7%)
 Frame = +1

Query: 1459 KDILVKNITMELAKIKS-DLLSTKSKEGIYMSQDHYKNLNSDLES-----------HKNE 1602
            K+ L+K      +K +S D L +K  E +    + YK L ++ +S             NE
Sbjct: 895  KNALIKESGEWKSKFQSHDNLISKMTEKLKSFSESYKELQNERDSLSRSLHEASSNSSNE 954

Query: 1603 VQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESL------------------KAT 1728
            +   K E+ +L+++   L  +K +  E + S NS  ESL                  K T
Sbjct: 955  LTALKNELATLSAEKVKLNSEKQELLEQVSSLNSSYESLSKRHQDETSDLNVEVEKLKET 1014

Query: 1729 INHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKS 1908
            ++HLK Q+D+   +  +I+   N LQ+  ++ +  +++ +  + +  K++          
Sbjct: 1015 VSHLKVQVDELKTSRDQITENANNLQEQCKIFEGQIENQEAEKKEAEKRY---------- 1064

Query: 1909 LKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELM-YKDCVKKILNE 2085
                       M+ K  FQ +               L +  +EK EL   K   +K LN+
Sbjct: 1065 -----------MELKQNFQVS------------TTDLEKLAKEKQELNDAKGSNEKELNK 1101

Query: 2086 SPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLK--NHFFK---NNHQE 2250
              K      +K+  I    Q   K + E  +  ++    LK+ +K   H  K   +N +E
Sbjct: 1102 LKKDLEGKEQKLKSITERAQELEKTLDEQRNSNADSERKLKENIKALEHQKKEAISNSKE 1161

Query: 2251 LLNH--HIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLF 2424
            L N    + + +++++++  + VE  K  + + +E+ +     N+    + + ++   L 
Sbjct: 1162 LENELDQLKNKHKSLDEQNTKSVEELKTRVLE-VEKERDEKHNNVQKIENKLQEESKSLE 1220

Query: 2425 EPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEES 2604
              ++++  N   L    D ++         +L Q K  + +  N++ E+ + +K   EES
Sbjct: 1221 SLQKSQESNKSKLKVLQDKLD---------SLLQEKNDLVSEKNNLKENFAKVKEDFEES 1271

Query: 2605 ENAISLLK-NNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNH 2781
            +  I  LK +  K N +  +L  K    K  ++           + +++   ++++  + 
Sbjct: 1272 QRKIHGLKESEKKKNHELHELQKK---FKGELDVKQKQIADLERSREEVDKNLKNLQVDV 1328

Query: 2782 GNKENATKDEMIDNILKEIPNLSKRL 2859
             N     K ++I+ + KE   LS  L
Sbjct: 1329 KNVSEENK-KVIEKLEKEKEALSLEL 1353

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 112/573 (19%), Positives = 236/573 (41%), Gaps = 23/573 (4%)
 Frame = +1

Query: 1015 KHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGAL-NQR 1191
            K R++ +   +  + +     T+   K HQ EL    K   ++ A S     SG L NQ 
Sbjct: 1479 KERKLLNEGSDAVTKQYSERITVLEDKVHQTELEVQRKNKELESAKSAADEASGELRNQL 1538

Query: 1192 AKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1371
             ++   ++    T+G    A+      +        + ++D L G  + AL   +S  + 
Sbjct: 1539 EEKVVEVSSLKSTIGEQEKAIKKLESDLTDSRESGNKKIED-LNGELE-ALKKALSDKQA 1596

Query: 1372 TSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTK-SKEGIYM 1548
              E   S L    +A   K      A + K   V+N +  L ++++   S+K ++E +  
Sbjct: 1597 EIEANKSDLN--KRAGERKELEDTIATLQKK--VENSSKALQQLENSTDSSKKNQENLIK 1652

Query: 1549 SQD-HYKNLNSDLESHKNEVQECKREIESLASKNSLL-------VKDKLKSRETIQSQNS 1704
             +D + + L    +  + + ++  +++ +L S+ S +       VK+K +S    +SQ +
Sbjct: 1653 EKDTNIEKLEVAAKDLRKKDEDKSKQLAALESEKSSMKENLEKNVKEKDESIAQFKSQVA 1712

Query: 1705 QMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFET 1884
             MESLK  ++    +L++    E       ++++K+TE+     ++ KK + +L K+   
Sbjct: 1713 DMESLKKELDENTNKLERMKFEE------KSRIEKLTEI----TEEKKKIQKELEKR--- 1759

Query: 1885 HISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDC 2064
              S++ ++ +T L             Q+TD                       EL   + 
Sbjct: 1760 --SEDAQNSRTEL------------EQKTD-----------------------ELKRYEA 1782

Query: 2065 VKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNH 2244
             KK+           + K++ +  E +         ++D+S+ N +LK  L+ H  K ++
Sbjct: 1783 EKKL----------TIGKLEKLLSEKERIIAKFEAEIADLSKSNKDLKTELEQHSKKLSN 1832

Query: 2245 Q---ELLNHHIDSTYENIEKKTNQF---VENFKMTLNDHLEENKKLIMQNMTNATSAV-- 2400
                E  N  + S  + ++K ++     +E  + ++N H EE ++L M+   +  S +  
Sbjct: 1833 SSSIEEKNQELKSELKTLKKDSDALKADLEEVRGSINKH-EEARRLSMEGKHSLESELEQ 1891

Query: 2401 ----IDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNE 2568
                +     L E ++ ++E     + K         + +    S+ KK     +N+ NE
Sbjct: 1892 AYKRLQSSNTLIEEKQKEFEEKEKRMKKESEQLKSELDKLRLEASEPKKENGKETNNTNE 1951

Query: 2569 SISVMKGQVEESENAIS-LLKNNTKFNDQFKQL 2664
              S    ++++    +S L + N K+  + K+L
Sbjct: 1952 GSS----EIDDLMLLVSDLDEKNAKYRAKLKEL 1980

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
            Anc_2.633 YKL079W
          Length = 693

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 83/331 (25%), Positives = 138/331 (41%), Gaps = 22/331 (6%)
 Frame = +1

Query: 1060 RSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINRS-------GALNQRAKEAGSIN 1215
            RS TI  I L +  +DE L   S +  VDLAGS+  ++         A ++  +   S+N
Sbjct: 265  RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 1216 QSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 1395
              + TL    +  +++S    +R S LTR+L D L GN KT LI + S  K    ET ST
Sbjct: 325  SMVYTLANSESISINKS---IYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFST 381

Query: 1396 LEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLN 1575
            L ++S A ++ N+                     KI    +    K  I        + N
Sbjct: 382  LGFSSYASSMSNQ--------------------IKINQTAIGGDKKRAILTD-----DWN 416

Query: 1576 SDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLD 1755
               E ++N ++  K E+  ++ +N ++     +  +T++    + E L+  +N L   + 
Sbjct: 417  LMEEYYRNRIELLKDELHEVSMQNVMMT----RGMQTLEQSERENEILRDQLNSLVQLIK 472

Query: 1756 KQHKAELEISGFNN--KLQKMTE------VMQ--VALQDYKK----RELDLNKKFETHIS 1893
              H     + G  N  + +K T+      VM+   A+ D +     +EL+     E+HI 
Sbjct: 473  TPH----SVKGSKNIAREKKFTDETIINSVMEQVAAIADLQSVNNDKELENINFTESHIM 528

Query: 1894 KEIKSLKTALFLQLDNMQQKNIFQETDIQPN 1986
            K     K     QL + + K     TD   N
Sbjct: 529  KISMKDKPNYVEQLHDTESKMYRALTDFSKN 559

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 26/71 (36%), Positives = 38/71 (53%)
 Frame = +1

Query: 214 VSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGM 393
           +++N++ + G     N  +Y  DK+F P    D I   ++     D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSN--QYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 394 TSTGKTYTMTG 426
           T TGKTYT+ G
Sbjct: 99  TGTGKTYTLYG 109

>Skud_4.548 Chr4 (974878..977511) [2634 bp, 877 aa] {ON} YDR285W
            (REAL)
          Length = 877

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 92/502 (18%), Positives = 205/502 (40%), Gaps = 28/502 (5%)
 Frame = +1

Query: 1558 HYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINH 1737
            H K  +++L     E++  KRE++  + +   L ++K+K+   +       E +  +I  
Sbjct: 289  HKKEADTELMKRGKEIEYLKRELDDCSGQ---LSEEKIKNCSLVHEIEKNREEMIKSIGE 345

Query: 1738 LKAQLDKQHKAELEISGFNNKL-----QKMTEVMQVALQDYKKRELDLNKKFETHISKEI 1902
              ++ DK H   L+ + F  K+     +K+ E + VA   +  R  D   +  +H    +
Sbjct: 346  FFSE-DKAHHL-LQFTRFEEKIHALFEEKLQEHLSVAGDTFNVRLKDTTVELSSHTETIL 403

Query: 1903 KSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILN 2082
            K             QQ   F+E ++Q  +   ++++   +  +  K + +     K+ L 
Sbjct: 404  K-------------QQYEQFKE-NLQLKMTSGEDKMTETLTELGIKQKELVAGVQKENLA 449

Query: 2083 ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH 2262
             S     V++ +I   + +  +     A+N   +    N LK+Y K    +++  E    
Sbjct: 450  SSKNIETVLMAEIKNTKQDLLDDSSQAAKNYLGLE---NLLKEY-KAEIIRSDEYEERIK 505

Query: 2263 HIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRA- 2439
            H++S    +  + NQ + +       + +  KKL  +N+    S +   E  L E     
Sbjct: 506  HLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEAKNI--EISQISGSEQSLIERNEGL 563

Query: 2440 -----KWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVM-----KG 2589
                 K ++  D IN  +      Y N  ++ ++I K + + ++++ + I  +       
Sbjct: 564  SDELKKAQDQLDKINNLNISTKSNYENKISSQNEIVKALTSENDTLKQRIHQLVEFKENA 623

Query: 2590 QVEESENAISLLKNN---TKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVD----DI 2748
            Q + S    +  KNN    K N +  QL +  + L++               V+    DI
Sbjct: 624  QRDHSTKLEAFQKNNEQLQKLNVEVVQLKAHELELEEQNRYLKSCLDKKEIGVEESLSDI 683

Query: 2749 YNTIEDIMTNHGNKENATKDEM-----IDNILKEIPNLSKRLPLRISNINGCSVQDIISP 2913
                + ++     K++ T +++     ++N+ +   NL +++ L+ S +    +++++  
Sbjct: 684  KTLKQQVIVLKSEKQDITAEKLELQDNLENLEELTKNLQQKVQLQKSELEE-KIKELVEV 742

Query: 2914 KKHTIEDENPSSENADSEGSRK 2979
            K H    +   S+  D++ S K
Sbjct: 743  KNH----KRVESKERDTQKSTK 760

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 76/343 (22%), Positives = 147/343 (42%), Gaps = 26/343 (7%)
 Frame = +1

Query: 1399 EYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNS 1578
            EY  + K+++++    +     I+    T E      DL+     + I +SQ       S
Sbjct: 499  EYEERIKHLESERSTLSSQKNQIISSLGTKEAQY--EDLVKKLEAKNIEISQISGSE-QS 555

Query: 1579 DLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQN-------SQMESLKATINH 1737
             +E ++    E K+  + L   N+L +  K      I SQN       S+ ++LK  I+ 
Sbjct: 556  LIERNEGLSDELKKAQDQLDKINNLNISTKSNYENKISSQNEIVKALTSENDTLKQRIHQ 615

Query: 1738 L---KAQLDKQHKAELEISGFNN-KLQKM-TEVMQVALQDYKKRELD------LNKKFET 1884
            L   K    + H  +LE    NN +LQK+  EV+Q+   + +  E +      L+KK E 
Sbjct: 616  LVEFKENAQRDHSTKLEAFQKNNEQLQKLNVEVVQLKAHELELEEQNRYLKSCLDKK-EI 674

Query: 1885 HISKEIKSLKT--ALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYK 2058
             + + +  +KT     + L + +Q    ++ ++Q NL+ ++     L + +Q+K +L   
Sbjct: 675  GVEESLSDIKTLKQQVIVLKSEKQDITAEKLELQDNLENLEE----LTKNLQQKVQLQKS 730

Query: 2059 DCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKN 2238
            +  +KI          +VE  +  R+E +      +    D  ++ +   +Y  N   K 
Sbjct: 731  ELEEKI--------KELVEVKNHKRVESKERDTQKSTKPLDSPKKGDARSEYFPNISAKV 782

Query: 2239 NHQELLNHHIDSTYENI----EKKTNQFVENFKMTL--NDHLE 2349
            N     +   D   +++     K+T++F + F ++   ND LE
Sbjct: 783  NPPATRHPRTDHIGKSVRTESSKETSKFNDEFDLSSSPNDDLE 825

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 95/490 (19%), Positives = 184/490 (37%), Gaps = 38/490 (7%)
 Frame = +1

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            E K+T  L +   G  +  L+A +    + S +   T+  A     IKN  Q       D
Sbjct: 422  EDKMTETLTEL--GIKQKELVAGVQKENLASSKNIETVLMAE----IKNTKQ-------D 468

Query: 1465 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 1644
            +L  +       +  + L  + K  I  S D Y+     LES ++ +   K +I S    
Sbjct: 469  LLDDSSQAAKNYLGLENLLKEYKAEIIRS-DEYEERIKHLESERSTLSSQKNQIISSLGT 527

Query: 1645 NSLLVKDKLKSRETIQSQNSQM-----------ESLKATINHLKAQLDKQHKAELEI-SG 1788
                 +D +K  E    + SQ+           E L   +   + QLDK +   +   S 
Sbjct: 528  KEAQYEDLVKKLEAKNIEISQISGSEQSLIERNEGLSDELKKAQDQLDKINNLNISTKSN 587

Query: 1789 FNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQE 1968
            + NK+    E+++    +        N   +  I + ++  + A   Q D+  +   FQ+
Sbjct: 588  YENKISSQNEIVKALTSE--------NDTLKQRIHQLVEFKENA---QRDHSTKLEAFQK 636

Query: 1969 TDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKI---LNESPKFFNVIVEKIDIIRIE 2139
             + Q     V+   L   E   E+     K C+ K    + ES      + +++ +++ E
Sbjct: 637  NNEQLQKLNVEVVQLKAHELELEEQNRYLKSCLDKKEIGVEESLSDIKTLKQQVIVLKSE 696

Query: 2140 FQNFYK---NIAENLSDISEENNNLKQ--YLKNHFFKNNHQELL---NH-HIDSTYENIE 2292
             Q+       + +NL ++ E   NL+Q   L+    +   +EL+   NH  ++S   + +
Sbjct: 697  KQDITAEKLELQDNLENLEELTKNLQQKVQLQKSELEEKIKELVEVKNHKRVESKERDTQ 756

Query: 2293 KKT------------NQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRR 2436
            K T            +++  N    +N     + +      +  T +             
Sbjct: 757  KSTKPLDSPKKGDARSEYFPNISAKVNPPATRHPRTDHIGKSVRTES---------SKET 807

Query: 2437 AKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKG--QVEESEN 2610
            +K+ + FDL +   + + E  N     +  I+  +   SN+M   IS  K    VE+ + 
Sbjct: 808  SKFNDEFDL-SSSPNDDLELTNPSPIQIKPIRGKIKKGSNNMRPPISSRKKLLLVEDEDQ 866

Query: 2611 AISLLKNNTK 2640
             + + K   +
Sbjct: 867  PLKISKKRRR 876

>YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON}
            CNM67Component of the spindle pole body outer plaque;
            required for spindle orientation and mitotic nuclear
            migration
          Length = 581

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 68/283 (24%), Positives = 137/283 (48%), Gaps = 17/283 (6%)
 Frame = +1

Query: 1501 IKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSR 1680
            IK  L +++ +E   +SQ  +KN  ++ E  +NE++  K EI+++  KN+ L+     + 
Sbjct: 303  IKGFLCASQQEELSRISQ-RFKNAKAEAEDLRNELENKKIEIQTMREKNNTLI----GTN 357

Query: 1681 ETIQSQNSQM--ESLKATINHLKAQLDKQHKAELEISGFNNKL---QKMTEVMQVALQDY 1845
            +T+  QN  +  +  K TI+  +       + ++++   N +L   +K  E  + +L+D 
Sbjct: 358  KTLSKQNKILCDKFDKLTIDEKEILKGCNEEIKIKLERLNERLGSWEKSKEKYETSLKDK 417

Query: 1846 KKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLME 2025
            +K   D  KK  T +SKE+ +L++  F  L+    + I  +  +Q   D+   E   LM 
Sbjct: 418  EKMLADAEKKTNT-LSKELDNLRSR-FGNLEGNTSERITIKNILQSRPDISAEECNFLMV 475

Query: 2026 TMQEKAEL-MYKDCVKKILNESPKFFNVIVEKIDI--IRIEFQN-FYKNIAENL-SDISE 2190
               + A L   ++ VK+I+      +  +  KI +  I+++++N    N A+ L   +  
Sbjct: 476  EQIDSANLTTLQNTVKEIVLAVGIPYPKLRRKIPLLAIKLKYENIMLSNFAQRLHRQVYS 535

Query: 2191 ENNNLKQYLKN---HFFKNNHQELLNHH----IDSTYENIEKK 2298
            +  NLK++       F      + ++HH    +D  Y++I +K
Sbjct: 536  QEMNLKKFTDQAYYDFMSTRRMDSIDHHLERCLDHLYDHILEK 578

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 116/519 (22%), Positives = 214/519 (41%), Gaps = 38/519 (7%)
 Frame = +1

Query: 1417 KNIKNKPQLGAFMMK--DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES 1590
            + + NK Q   F  K  D++V +    + K+KSDL   KS + I       K L+   E 
Sbjct: 201  QELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEILS-----KKLDETTEQ 255

Query: 1591 HKNEVQECKREIESLASKNS-----LLVKDKLKSRETIQSQNSQMESLKATINHL--KAQ 1749
             +N + E K   + LA +       L +KDKL     I+   +Q++SL++T+      A+
Sbjct: 256  LQNNLIENKDLKDVLAVEKQEFDKELSIKDKL-----IKLYENQIKSLESTLQQKFKTAE 310

Query: 1750 LDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFE---THISKEIKSLKTA 1920
             ++++ +E+  S     L++   + +  LQD +++ + L    +     +S + K  K  
Sbjct: 311  ANEENSSEVVKS-----LKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKRT 365

Query: 1921 LFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLM-ETMQEKAELMYKDCVKKILNESPKF 2097
                 ++     +    D   +L  ++ ++  L  + +QEK +       +K+ N+   F
Sbjct: 366  YSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQK------EKLQNQVESF 419

Query: 2098 FNVIVEKIDIIRIEFQNFYKNIAENLSDIS------EENNNLK----QYLKNHFFKNNHQ 2247
               +  KI +I   FQ     + + L+D +       + N LK    Q LK     +N Q
Sbjct: 420  VIELEHKIPVIN-SFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQ 478

Query: 2248 E--LLNHHIDSTYENIEKKTNQFVENFKMTLNDHL--EENKKLIMQ-----NM--TNATS 2394
               LL    D  ++      N  + N     NDHL  E+  K I       NM  TN + 
Sbjct: 479  LEILLRQRTDLAHQLQYLLINISIIND----NDHLLNEDEIKFIKNLVSNDNMASTNDSQ 534

Query: 2395 AVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESI 2574
             VI + +  F+  +   E + +L+    ++  +   N     S    TVD  +    E+ 
Sbjct: 535  KVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAK 594

Query: 2575 SVMKGQVEESENAISLLKNNTKFNDQFKQLIS----KHIILKDNIEXXXXXXXXXXXNVD 2742
              +    + +EN    L+  TK  D FK L+S    ++    +++             V 
Sbjct: 595  EAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVK 654

Query: 2743 DIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRL 2859
            D+ N +   +TN  N  +    E ++ + KEI  L+ ++
Sbjct: 655  DLENRLTQ-LTNDSNAHSKALTEELNLLHKEISQLNVQI 692

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 118/624 (18%), Positives = 233/624 (37%), Gaps = 39/624 (6%)
 Frame = +1

Query: 946  IQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT-----LYKKHQDE 1110
            + N    H     E LNLL + +    V   K     S +     IT     L  K  ++
Sbjct: 663  LTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQ 722

Query: 1111 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRES 1290
            L RI    L D    ++       +    EA S N SL T  R +   V     +  RE 
Sbjct: 723  L-RIRSSRLEDSLLQQDKETQKTFSSYV-EAISKNSSLETSVRNLETEVTL---LKDREI 777

Query: 1291 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDIL 1470
             L   L ++    TK  ++ T   +  +  ET      +   K I     +   + K + 
Sbjct: 778  SLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLS 837

Query: 1471 VKNITMELAKIKSDLLSTKSKEGIY-MSQDHYKNLNSDLESHKNEVQECKREIESLASKN 1647
             +    E+ KI+      K +   Y   Q      +   +  + ++Q    E+E L  +N
Sbjct: 838  ER--VHEIDKIE------KERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQN 889

Query: 1648 SLLVKD------KLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 1809
              L K+      ++ + ETI   NS+ +     I  L+    +   A  ++  F N  Q 
Sbjct: 890  KTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQN 949

Query: 1810 MTEVMQVALQDYKKRELDLNKKFETHISK--EIKSLKTALFLQLDNMQQKNIFQETDIQP 1983
              + ++     +  ++ D     +T   +  EI+     L  QL+N++ +   Q  + + 
Sbjct: 950  SEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAES 1009

Query: 1984 NLDMVKNEVLTLMETMQ--EKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYK 2157
                +   +  L    Q  E+ + M+++ ++K+ N+                +E Q  Y 
Sbjct: 1010 ERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLEND----------------LEEQTVYA 1053

Query: 2158 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLN 2337
            N A+                     KN  QEL  H   S   +  ++ NQ ++N   +L 
Sbjct: 1054 NNAQ---------------------KNYEQELQRHADVSKTISELREQNQRLKNDTKSLT 1092

Query: 2338 DHLEENKKLIMQNMTNATSA---------VIDQEMDLFEPRRAKWENSFDLINKCDSMN- 2487
              L+  +  + QN  +  S          +  Q +D    +     N  DL+N+ +S+N 
Sbjct: 1093 AELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNE 1152

Query: 2488 ---NEFYNNMAATLSQIKK----------TVDTSSNSMNESISVMKGQVEESENAISLLK 2628
               ++  N   A +  +++           ++T  NS+ + +  ++ ++E ++ + +LL+
Sbjct: 1153 NSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLE 1212

Query: 2629 NNTKFNDQFKQLISKHIILKDNIE 2700
            +      +   LI+ +  ++ ++E
Sbjct: 1213 SE---YSEHSDLINNYQTIRGDLE 1233

 Score = 37.7 bits (86), Expect = 0.21
 Identities = 111/562 (19%), Positives = 204/562 (36%), Gaps = 6/562 (1%)
 Frame = +1

Query: 982  LEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAG-SE 1158
            LE  N L   +K + +     ND S R  T     + +KHQ       K+N+ D     E
Sbjct: 1277 LESANNL---IKEKDLKIASANDESQRWKTRLE-EMIEKHQ-------KVNVDDYTKLEE 1325

Query: 1159 NINRSGAL-NQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTK 1335
             +N +  L + + +E   +N     L +  +  ++ S           + LQ SL     
Sbjct: 1326 TLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTS-----------KELQSSLQEQIS 1374

Query: 1336 TALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDL 1515
              +       K    +T    E  S+  N + K Q     +++ L K I+      KS+ 
Sbjct: 1375 NLISEKDDIRKQLDVKTEENSELLSELNNFREK-QNDLETLREELNKEIS------KSEE 1427

Query: 1516 LSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQS 1695
            L  K +  I  S    +N N ++E  +  + + K ++ +              S +  + 
Sbjct: 1428 LEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAA-------------NSTDADEQ 1474

Query: 1696 QNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKK 1875
             N  +E++K    + K +   +   E     FN +L + TE +        + E   N+K
Sbjct: 1475 TNRNVEAIKREFENQKTKFIAEKTEE-----FNKRLIEETEKI--------RNEFQENEK 1521

Query: 1876 FETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMY 2055
             +T ++ ++++L+       + + QK I +  D                           
Sbjct: 1522 PDTELNVDVEALRKQWEEDSEELIQKRIAEAED--------------------------- 1554

Query: 2056 KDCVKKILNESPKFFNVIVEK-IDIIRIEFQNFYKNIAENL--SDISEE-NNNLKQYLKN 2223
             +  K+I   S +  N I+EK    +  EF    ++ A +L  +D S E NN LK+ L+ 
Sbjct: 1555 -NLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSNEFNNELKEALEK 1613

Query: 2224 HFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVI 2403
               +    EL      +  E  ++ T       K T          L+ + +    S + 
Sbjct: 1614 ELKERFEDELQAARKKAFEEGKQQAT------MKTT----------LLERKIQKLESQIQ 1657

Query: 2404 DQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVM 2583
            ++E D  E +  K E                  N   ++ +I +T+++S  S   S +V 
Sbjct: 1658 EKEKDSEETQDVKPE-----------------ENSTPSVKKIPETLNSSDTSFGNSNNVK 1700

Query: 2584 KGQVEESENAISLLKNNTKFND 2649
              +      A S   N   FN+
Sbjct: 1701 VLKPSSPFGATSAFNNPFTFNN 1722

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 61/268 (22%), Positives = 137/268 (51%), Gaps = 19/268 (7%)
 Frame = +1

Query: 1489 ELAKIKSDLLSTKSKEGIYMSQ--DHYKNLNSDLESHKNE-------VQECKREIESLAS 1641
            E++ I+ D+    + +G  +++  +  K+L  +LE  ++E        Q  + E E L+S
Sbjct: 774  EVSSIEKDMKEYDNDKGSKLNELKNELKSLAKNLEEQESESEGKYDLFQNLELETEQLSS 833

Query: 1642 K---NSLLVKDKLKSRETIQSQNSQME----SLKATINHLKAQLDKQHKAELEISGFNNK 1800
            +   N  L+++ LKS E+++S+N+++E    S++  +  ++A+L+++ K  ++I   +++
Sbjct: 834  ELDSNKTLLQNYLKSIESLKSENTELEEKIRSIEDNLATIQAKLNEEKKRLMDI---DDE 890

Query: 1801 LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ 1980
            L ++  +M+   +  K  EL+L K    H   + KS    +  +++ ++QK+ F E D  
Sbjct: 891  LTELETLMKKKQEKKKSSELELQKLI--HDLNKYKSNTDNIEKKIEELRQKHEFLE-DFD 947

Query: 1981 PNLDMVKNEVLTLMETMQEKAELM---YKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF 2151
                +VK      +ET +E+++ +   +++  KK+   +P   N+I E ++      +  
Sbjct: 948  LVTSIVKQNEGINLETYRERSKQLNDKFQELRKKV---NPNIMNMI-ENVEKKEAALKTM 1003

Query: 2152 YKNIAENLSDISEENNNLKQYLKNHFFK 2235
             K I ++   I E  + L +Y +    K
Sbjct: 1004 IKTIEKDKMKIQETISKLNEYKRETLIK 1031

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 71/380 (18%), Positives = 154/380 (40%), Gaps = 19/380 (5%)
 Frame = +1

Query: 1705 QMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFET 1884
            ++E ++A +NH+  +L KQ+    +     N L      + +A     KR L++N     
Sbjct: 689  KIEIIQADLNHVTEELQKQYTTSQKTKTIQNDLNASLHKLDLA-----KRNLEVNP---- 739

Query: 1885 HISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDC 2064
              S +I +    +  ++   + +   ++ D    L+  + EV ++ + M+E     Y + 
Sbjct: 740  --SSQIMARNEEILREIGECENEIKIRQMD----LERCRQEVSSIEKDMKE-----YDND 788

Query: 2065 VKKILNESPKFFNVIVEKIDIIRIE-------FQNFYKNIAENLSDISEENNNLKQYLKN 2223
                LNE       + + ++    E       FQN      +  S++      L+ YLK+
Sbjct: 789  KGSKLNELKNELKSLAKNLEEQESESEGKYDLFQNLELETEQLSSELDSNKTLLQNYLKS 848

Query: 2224 -HFFKNNHQELLN--HHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATS 2394
                K+ + EL      I+     I+ K N+  +   M ++D L E + L+ +      S
Sbjct: 849  IESLKSENTELEEKIRSIEDNLATIQAKLNEEKKRL-MDIDDELTELETLMKKKQEKKKS 907

Query: 2395 AVIDQEMDLFEPRRAKWENSFDLINKCDSM--NNEFYNNMAATLSQIK-------KTVDT 2547
            + ++ +  + +  + K  N+ ++  K + +   +EF  +     S +K       +T   
Sbjct: 908  SELELQKLIHDLNKYK-SNTDNIEKKIEELRQKHEFLEDFDLVTSIVKQNEGINLETYRE 966

Query: 2548 SSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXX 2727
             S  +N+    ++ +V  + N +++++N  K     K +I    I KD ++         
Sbjct: 967  RSKQLNDKFQELRKKV--NPNIMNMIENVEKKEAALKTMIK--TIEKDKMKIQETISKLN 1022

Query: 2728 XXNVDDIYNTIEDIMTNHGN 2787
                + +  T E +  + GN
Sbjct: 1023 EYKRETLIKTWEKVTLDFGN 1042

 Score = 38.9 bits (89), Expect = 0.088
 Identities = 35/143 (24%), Positives = 69/143 (48%), Gaps = 9/143 (6%)
 Frame = +1

Query: 1522 TKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLA-SKNSLLVKD----KLKSRE- 1683
            T  +E +   + H K LN  +E    E++    +++ +   K   L KD    KL+++E 
Sbjct: 247  TSIRETLENGEAHMKELNEFIEKTAQEIESLNEDVKEIKLQKQKELHKDSEISKLETQES 306

Query: 1684 TIQSQNSQME-SLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKREL 1860
            T+ ++ S+++ SL      +    +K    ELEI+  + +L +         +DYK  + 
Sbjct: 307  TLLNEISRLKTSLSIKAESVNDTTEKLKALELEIANSSARLNEKKIEYTKTEEDYKTVQE 366

Query: 1861 DLNKKFETHISKE--IKSLKTAL 1923
            +L+K+ E +  KE  + +L T +
Sbjct: 367  ELSKQRELYKKKEELVSTLTTGI 389

 Score = 38.5 bits (88), Expect = 0.12
 Identities = 59/327 (18%), Positives = 135/327 (41%), Gaps = 14/327 (4%)
 Frame = +1

Query: 1942 MQQKNIFQETDIQPNLDMVKNEVLTLME-----TMQEKAELMYKDCVKKILNESPKFFNV 2106
            +Q+       +I+P L+ ++NE    +E     T  EK E +   C    +         
Sbjct: 192  LQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLEKTERIVASCDYYNIKHKHTSIRE 251

Query: 2107 IVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEN 2286
             +E  +    E   F +  A+ +  ++E+   +K   +    K++    L    +ST  N
Sbjct: 252  TLENGEAHMKELNEFIEKTAQEIESLNEDVKEIKLQKQKELHKDSEISKLETQ-ESTLLN 310

Query: 2287 IEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLI 2466
               +    +     ++ND  E+ K L ++ + N+++ + +++++       K E  +  +
Sbjct: 311  EISRLKTSLSIKAESVNDTTEKLKALELE-IANSSARLNEKKIEY-----TKTEEDYKTV 364

Query: 2467 NKCDSMNNEFYNNMAATLSQIKKTV-DTSSNSMNESISVMKGQVEESENAISLLKNNTKF 2643
             +  S   E Y      +S +   +  T +     +  ++K +   S+ ++++ K+  K 
Sbjct: 365  QEELSKQRELYKKKEELVSTLTTGISSTGAADGGYNAQLIKAKAGLSDVSLAIKKSTMKM 424

Query: 2644 NDQFKQLISKHIILKDNIEXXXXXXXXXXXNV---DDIYNTIEDIMTNHGNKENATKD-E 2811
             D  K+ +S   +++  +            +V    D  N ++  +T +G   +  KD +
Sbjct: 425  -DLLKRELS---VIEPKLTQATKDNELNIKHVKECQDNCNKLQAQLTEYGFDPSRIKDLK 480

Query: 2812 MIDNILK----EIPNLSKRLPLRISNI 2880
              +N LK    +I N S+ L  R++N+
Sbjct: 481  QKENELKSQYYQISNDSEYLKRRVANL 507

>CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [2463 bp,
            820 aa] {ON} similar to uniprot|P31111 Saccharomyces
            cerevisiae YDR285w ZIP1
          Length = 820

 Score = 61.6 bits (148), Expect = 9e-09
 Identities = 87/448 (19%), Positives = 189/448 (42%), Gaps = 15/448 (3%)
 Frame = +1

Query: 1585 ESHKNEVQECKREIESLA-SKNSLLVKDKLKSRETIQSQNSQMESLKAT---INHLKAQL 1752
            +SH    QE +     +  SKN  +++  +    T  S +  +E+   T    ++LK+QL
Sbjct: 104  QSHNQTQQELRPNFTQVKESKNENIMQPLI----TENSNDVLLEAFTNTQKICSNLKSQL 159

Query: 1753 DKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQ 1932
             K+ +    +    N  ++  +     + +YK     LN+K      ++I++ K+     
Sbjct: 160  LKEQRENERLKKMLNDFEETNQKTGKKINEYKSLFESLNEKLSVLSHQKIQNEKSLKEFV 219

Query: 1933 LDNMQQKNIFQETDIQ-PNLDMVKNEVLTLMETMQEKAELMYK----DCVKKILNESPKF 2097
                +QK+   ++ I+  +L    NE   +++ M  K +LM K    D +KK L+E    
Sbjct: 220  TFQEEQKSKLDKSQIEIESLKSKLNEGKNILDVM--KNDLMQKSSEIDFLKKELDECSGL 277

Query: 2098 FNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH---HI 2268
             +    K + I    +N   ++   L        NL   L      NN ++LL      +
Sbjct: 278  LSEEKIKSNKINQTIENKNNDLVHYLDKNITNQQNLMDELFKQVSTNNLKKLLQRLDIAL 337

Query: 2269 DSTYENIEKKTNQFVENFKMTL--NDHLEENKKLIMQNMTNATSAVIDQEMD-LFEPRRA 2439
                  +E K++  +   + +   N+ LE + +  + N+ N+ S+ I+   + + +   +
Sbjct: 338  TKMQSFVESKSSDILVKIQESYRNNNALELSLENNITNIFNSLSSFIENNANQINDIISS 397

Query: 2440 KWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAIS 2619
              +N+   I+  D   N F N++ +  SQ+ K ++    + +  +  +   ++E  + + 
Sbjct: 398  NSKNAIASIDNIDKRFNSFENSLKSENSQLLKLLEKHEQNFSSKLESIDSSLKEYCSEVD 457

Query: 2620 LLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENA 2799
            + K   K  D+   L   +I L++++E            +    N IE +       E  
Sbjct: 458  VTK---KLKDKILALEKYNIKLENDVENNQHSEKRLEQLLTSQRNEIESLKV-----ELK 509

Query: 2800 TKDEMIDNILKEIPNLSKRLPLRISNIN 2883
            +K+E + N   ++  L + L ++++ I+
Sbjct: 510  SKNETLKNSTADVFKLKEELSVKVAEIS 537

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 78/434 (17%), Positives = 178/434 (41%), Gaps = 12/434 (2%)
 Frame = +1

Query: 1306 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNIT 1485
            + D +  N+K A IA+I       ++  ++ E + K++N     QL   + K    +N +
Sbjct: 391  INDIISSNSKNA-IASID----NIDKRFNSFENSLKSEN----SQLLKLLEKH--EQNFS 439

Query: 1486 MELAKIKSDL--------LSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 1641
             +L  I S L        ++ K K+ I   + +   L +D+E++++  +  ++ + S  +
Sbjct: 440  SKLESIDSSLKEYCSEVDVTKKLKDKILALEKYNIKLENDVENNQHSEKRLEQLLTSQRN 499

Query: 1642 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKA-ELEISGFNNKLQKMTE 1818
            +   L  +     ET+++  + +  LK  ++   A++ + ++   L+   + +KL   +E
Sbjct: 500  EIESLKVELKSKNETLKNSTADVFKLKEELSVKVAEISRLNEINNLQKVNYESKLGSQSE 559

Query: 1819 VMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMV 1998
            +++V +    K + +L  K ++ I  + K ++  L+ ++ N  +        I   L  V
Sbjct: 560  ILKVLI----KEKDELKTKIDS-IDDDRKRVEDELYKKVANFDK--------INKQLQSV 606

Query: 1999 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLS 2178
              E++ L     E  E      ++ +L ES K    I  ++ +++ E         + +S
Sbjct: 607  NVEMVQLAANKLELEEETRN--LRTVLKESEKCTTSIERELKVLKQERIQLKAENQDLVS 664

Query: 2179 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK 2358
            +  E    LK+        N  ++ +     +        +N    N +    D L + K
Sbjct: 665  EKLEIEGKLKEMASKCMVNNKEKKKVASADKNPINGYRNDSNSNARNLEEVKKDDLLQKK 724

Query: 2359 KLIMQNMTNATSAVIDQE---MDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQI 2529
                 ++    +   D E    D+F+   +   + F+ ++   +      N+     S +
Sbjct: 725  HQRPSSIIKENTHKQDDEDILDDVFDLSYSNSASDFESVSSI-AFPKLAANSKVKVNSNL 783

Query: 2530 KKTVDTSSNSMNES 2571
            +KT+    N  N S
Sbjct: 784  EKTIGDKQNGRNTS 797

>TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8.604
            YOR195W
          Length = 804

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 107/491 (21%), Positives = 192/491 (39%), Gaps = 91/491 (18%)
 Frame = +1

Query: 1477 NITMELAKIKSDLLSTKSKEGIYMSQDHYKN-------LNSDLESHKNEVQECKREIESL 1635
            N   ++ K K+D ++ K    I       +N       LN+ L+++K  + E + E++ L
Sbjct: 306  NYQYQIIKNKNDTINKKFDNKILQLNKEIENYKIKVEKLNNKLQTNKKRLLETRDEVKML 365

Query: 1636 ASKNSLLVK--DKLKSRETIQSQN--SQMESLKATI-NHLKAQLDKQHKAELEISGFNNK 1800
                S+L +  DK +S E ++ +N     E  K  + N LK + D+      EI+   + 
Sbjct: 366  NQNQSILQEKFDK-QSHEILELRNIDDSKEKYKFELENKLKVKDDENLSKTNEINLLTDD 424

Query: 1801 LQKMTEVMQVALQDYKKREL-----------------DLNKKFETHISKEIKSLKTALFL 1929
            LQK+ E + + L++     L                 ++N+K++  I+   +     L  
Sbjct: 425  LQKLQEQLDLKLKELSNNSLKLEELNDLIERKDLEIKEINEKYQGTINLN-EGKHDDLVK 483

Query: 1930 QLDNMQQKNIFQET-------DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNES 2088
            Q++ +  K I  ET       D +  ++ +K E L  ME  +   E    +  KKI    
Sbjct: 484  QVEELIMKRIELETQLDQQDKDTKEIIEQIKKE-LNKMEEDKNSKEYQIIEFEKKIDELQ 542

Query: 2089 PKFFNV------IVEKIDIIRIEFQNFYKN-----IAENLSDISEENNNLKQYLKNHFFK 2235
             K  N       + E  D I   F+   KN     + E + ++     NLK+ + N   +
Sbjct: 543  GKINNQNDELLKLKESYDKINDNFE--IKNAEVIQLNEEIKELRSNEINLKEKISND--E 598

Query: 2236 NNHQELLNHHIDSTYENIEKKTNQFVENFKMTLN----DHLEE-------------NKKL 2364
             N  +    +  S  EN EK   +  EN  M +N    DHL+E             + K 
Sbjct: 599  KNSNDWKAKYESSKIEN-EKILIEKSENHSMKINELNEDHLKELENIHETMKILQQDLKT 657

Query: 2365 IMQNMTNATSAVIDQEMDLFEPRR----------AKWENSFDLINKCDSMNNEFYNNMAA 2514
             ++ + N T+  ID E++  E ++           + E   +   K ++  N  Y     
Sbjct: 658  NIETLNNVTNIKIDLEVENLELKKKLKALEVGTETETETETETKTKIETKENLVYEESQE 717

Query: 2515 TLSQIKKTVD-----------------TSSNSMNESISVMKGQVEESENAISLLKNNTKF 2643
               ++K   D                   +  +NES+  ++   EES+N I L+      
Sbjct: 718  EKDKLKAKDDQIEQLKISFEEDQTKIKNLTQQLNESLEQIQKNKEESDNRIRLMA----- 772

Query: 2644 NDQFKQLISKH 2676
            +D + Q  +KH
Sbjct: 773  DDLYNQYAAKH 783

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309c IMH1
          Length = 867

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 88/441 (19%), Positives = 193/441 (43%), Gaps = 28/441 (6%)
 Frame = +1

Query: 1459 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLA 1638
            K+I ++ +   L ++ +DL+  +         D  KN NS+      EV+E K+E+++L 
Sbjct: 355  KNIEIEEVRDMLREVGNDLVDAR---------DQIKNANSNAGK---EVEEVKKELDNLR 402

Query: 1639 SKNSLLV----KDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQ 1806
            SKN+ ++    K +L+ +  I S N ++  +K     +  + +   K  +E      KL 
Sbjct: 403  SKNATMIETYEKTQLELKAKIASLNGEISEMKLNQTTILKEKEIASKDAIE------KLS 456

Query: 1807 KMTEVMQVALQDYKKRELDLNKKFET--HISKEIK------SLKTALFLQLDNMQQKNIF 1962
               + ++  L+D    +L L ++ +T  ++ +++K      ++  A   +L+   +    
Sbjct: 457  DENKTLKAQLKDINAIKLTLTQREKTIGYLEEQVKQYNEKNAVVQATIEKLEKELKSKES 516

Query: 1963 QETDIQPNLDMVKNE----VLTLMETMQEKAELMYK-DCVKKILNESPKFFNVIVEKIDI 2127
            Q T IQ   + +K E    V++L   ++E  +L  +   +++  + +    +   E++D 
Sbjct: 517  QLTTIQNENESLKKEAKTNVVSLENYLKENGKLSERLSILQEKYDTAQNLKSNSNEQVDS 576

Query: 2128 IRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQ 2307
            I+ +       + E+   I    + L +Y+     K+   + +   I S  +N E    Q
Sbjct: 577  IKRQCNELNVKLKESNKRIMSLEDELNEYMNTLQEKSRECDTMRRLI-SDQQNEESSGRQ 635

Query: 2308 FVENFKMTLNDHLEENK---KLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCD 2478
             +EN    L D  E NK   +L +Q  T+  +  I    ++ +  +++  N      K  
Sbjct: 636  EIENKLALLTD--ERNKMESELALQ--TSRKNREIQNWKNMNDDLKSQL-NQLQFREKQL 690

Query: 2479 SMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAIS--------LLKNN 2634
                E  NN++ TL +     +  S  + +    +K  +++++  IS        L+K N
Sbjct: 691  LSQIEDLNNISQTLKRSTNNDEDESGELKKVAGNLKEALQKADKRISELQESNEQLMKLN 750

Query: 2635 TKFNDQFKQLISKHIILKDNI 2697
            +  N ++++L + +  L   +
Sbjct: 751  SDANKKYERLSNNYRTLSSQL 771

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 107/563 (19%), Positives = 226/563 (40%), Gaps = 59/563 (10%)
 Frame = +1

Query: 1471 VKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE----CKREIESLA 1638
            +K +TME  K  +D  +  ++  I   ++  +  N + + + N++ E     + E +++ 
Sbjct: 118  IKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNRNSKENSNKLVEKVKLLEEEAQAMK 177

Query: 1639 SKNSLLVK-------------DKLK---------SRETIQSQNS---QMESLKATINHLK 1743
             +N  L K             D+LK         SRE  ++ N    + ESLK+TI+  +
Sbjct: 178  LENDKLTKSTETQLADKQKLIDQLKGQIQELEDKSREAFENSNDVTGETESLKSTIDEKQ 237

Query: 1744 AQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEI--KSLKT 1917
             ++D      LEIS    K Q  T ++        K +   NKK +  ++       ++T
Sbjct: 238  KEIDSLKAQILEIS---TKSQN-TSLISTTTASTGKGKKKKNKKSKGGVNNASLPAPIET 293

Query: 1918 A-LFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKK----ILN 2082
            A L + +D +Q     +  DI+   +  K     L  + +   E+  K+   +     + 
Sbjct: 294  ANLSVDMDGLQN----ELKDIKMKCEEWKARYEELQSSSKSTVEIETKNSALEEELVKVR 349

Query: 2083 ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH 2262
            +S K  N+ +E       E ++  + +  +L D  ++  N           N  +E+   
Sbjct: 350  DSLKQKNIEIE-------EVRDMLREVGNDLVDARDQIKNAN--------SNAGKEV--E 392

Query: 2263 HIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAK 2442
             +    +N+  K    +E ++ T    LE   K+   N       + + +++     + K
Sbjct: 393  EVKKELDNLRSKNATMIETYEKT---QLELKAKIASLN-----GEISEMKLNQTTILKEK 444

Query: 2443 WENSFDLINKCDSMNNEF------YNNMAATLSQIKKTV---DTSSNSMNESISVMKGQV 2595
               S D I K    N          N +  TL+Q +KT+   +      NE  +V++  +
Sbjct: 445  EIASKDAIEKLSDENKTLKAQLKDINAIKLTLTQREKTIGYLEEQVKQYNEKNAVVQATI 504

Query: 2596 EESENAI----SLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIE 2763
            E+ E  +    S L      N+  K+    +++  +N              + + Y+T +
Sbjct: 505  EKLEKELKSKESQLTTIQNENESLKKEAKTNVVSLENYLKENGKLSERLSILQEKYDTAQ 564

Query: 2764 DIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDEN- 2940
            ++ +N         +E +D+I ++   L+  + L+ SN    S++D ++   +T+++++ 
Sbjct: 565  NLKSN--------SNEQVDSIKRQCNELN--VKLKESNKRIMSLEDELNEYMNTLQEKSR 614

Query: 2941 ---------PSSENADSEGSRKI 2982
                        +N +S G ++I
Sbjct: 615  ECDTMRRLISDQQNEESSGRQEI 637

 Score = 40.8 bits (94), Expect = 0.022
 Identities = 42/159 (26%), Positives = 73/159 (45%)
 Frame = +1

Query: 1480 ITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLV 1659
            +T E  K++S+L    S++   +   ++KN+N DL+S  N++Q   RE + L+    L  
Sbjct: 644  LTDERNKMESELALQTSRKNREIQ--NWKNMNDDLKSQLNQLQ--FREKQLLSQIEDLNN 699

Query: 1660 KDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQ 1839
              +   R T   ++   E LK    +LK  L K  K   E+   N +L K+         
Sbjct: 700  ISQTLKRSTNNDEDESGE-LKKVAGNLKEALQKADKRISELQESNEQLMKLNS------- 751

Query: 1840 DYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKN 1956
                   D NKK+E  +S   ++L +    QL  +++K+
Sbjct: 752  -------DANKKYE-RLSNNYRTLSS----QLSTLREKS 778

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 104/519 (20%), Positives = 225/519 (43%), Gaps = 37/519 (7%)
 Frame = +1

Query: 1183 NQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1362
            +Q+ K    +   L T+   +NA  +       R+ +L +L+ +    +T  + I  +  
Sbjct: 1164 DQKEKVVTELRTKLETVCAELNASKED------RKEELVQLMSEI---DTFKSKILALEE 1214

Query: 1363 AKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGI 1542
             K + E +C +  Y ++ +N  N+ +L          K++  E+  ++  L S K++  +
Sbjct: 1215 EKSSIERSCDS--YRTQRQN--NEAEL----------KDLRSEMTTLRDSLSSAKNE--M 1258

Query: 1543 YMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLK 1722
              ++D   +L +D +   + + E + EIE+     S   K KL   +   +   +++SL 
Sbjct: 1259 NSAKDLSLHLQNDTKDLNDRILELEAEIENKNENISAYEKSKLAIEKEKSNLKIELQSL- 1317

Query: 1723 ATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEI 1902
                        ++K E E S   +++QK+ + M+  +QD++K    LN+   T I++  
Sbjct: 1318 ------------ENKFEKEASVLKSEIQKLKDEMKNKVQDFEKERKMLNEG-STSITQGY 1364

Query: 1903 KSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETM---QEKAELMYKDCVKK 2073
                TAL L+L N        E ++  N+  ++     L E +   +EK E    +    
Sbjct: 1365 SEKVTALELKLSN-------TEAELSANIKSLERTNADLDEKLRICEEKLEEKEVELCSL 1417

Query: 2074 ILNESPKFFNVIVEKIDIIRIEFQNFYKNIAEN--LSDISEENNNLKQYLKNHFFKNNHQ 2247
               ES    ++ +++ +I  ++     +  A N  + ++S + N  ++ LK+   KNN  
Sbjct: 1418 KEKESNVLSSLDLKESEINALKDSQTKEITALNNKIKELSGQINIKEEELKS---KNNDI 1474

Query: 2248 ELLN-----------------HHIDSTYENIEKKTNQFVENFKMTLN---DHLEENKKLI 2367
              LN                   + + Y ++E+ + + +++ K TL    ++ E  KK +
Sbjct: 1475 STLNMSAKANKESIDDLKKQLEELQARYSDLEETSTRELQSLKETLRLEYENKETQKKQL 1534

Query: 2368 MQ-----NMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNM-------A 2511
             +     N  + T   +  +    +  + K E +   + + +S +N + N++        
Sbjct: 1535 DEMKDSVNQKDETIESLTSKCSELKFEKEKSEKTSLELKELESKHNRYMNDLETCNKAKT 1594

Query: 2512 ATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLK 2628
            + L++I +T+    N+++E +  +K Q +  EN  SL K
Sbjct: 1595 SLLTEI-ETIRNQKNNLSEEL--LKNQKQYKENEDSLQK 1630

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 70/309 (22%), Positives = 150/309 (48%), Gaps = 34/309 (11%)
 Frame = +1

Query: 1366 KVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIY 1545
            KVT+ E   +   A  + NIK+  +  A + + + +    +E  ++  +L S K KE   
Sbjct: 1367 KVTALELKLSNTEAELSANIKSLERTNADLDEKLRICEEKLEEKEV--ELCSLKEKESNV 1424

Query: 1546 MSQDHYKN--LNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESL 1719
            +S    K   +N+  +S   E+     +I+ L+ + ++  ++       I + N   ++ 
Sbjct: 1425 LSSLDLKESEINALKDSQTKEITALNNKIKELSGQINIKEEELKSKNNDISTLNMSAKAN 1484

Query: 1720 KATINHLKAQLD--KQHKAELEISGFNNKLQKMTEVMQVALQ--DYKKRELD-----LNK 1872
            K +I+ LK QL+  +   ++LE +    +LQ + E +++  +  + +K++LD     +N+
Sbjct: 1485 KESIDDLKKQLEELQARYSDLEETS-TRELQSLKETLRLEYENKETQKKQLDEMKDSVNQ 1543

Query: 1873 KFETHIS----------KEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLM 2022
            K ET  S          ++ KS KT+  L+L  ++ K+     D++   +  K  +LT +
Sbjct: 1544 KDETIESLTSKCSELKFEKEKSEKTS--LELKELESKHNRYMNDLE-TCNKAKTSLLTEI 1600

Query: 2023 ETMQE----------KAELMYK---DCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNI 2163
            ET++           K +  YK   D ++KI +E+ +  N++ E++  ++ E    +K+ 
Sbjct: 1601 ETIRNQKNNLSEELLKNQKQYKENEDSLQKIADENARKINLLEEELANLK-EDAMLWKSK 1659

Query: 2164 AENLSDISE 2190
            AE+ S++ +
Sbjct: 1660 AEDRSEVDD 1668

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 92/479 (19%), Positives = 199/479 (41%), Gaps = 14/479 (2%)
 Frame = +1

Query: 1285 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 1464
            +S L R  +D   G     +   +       E+   TLE  SKA   + + +        
Sbjct: 682  QSALRRGPEDETSGKISFEIFDDLKQQYSALEKELKTLEGGSKATITELEEK-------- 733

Query: 1465 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 1644
              VKN+  +  ++++DL  + ++         +  LN   ES K +++    ++ +L ++
Sbjct: 734  --VKNLDKKCKELEADLNKSTTE---------HTQLNERYESVKKDLELTAEKVAALNNE 782

Query: 1645 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQL----DKQHKAELEISGFNNKLQKM 1812
               L+  K K  +T+    + +   K  I  LKA L     ++ KAE  I+  + +L  +
Sbjct: 783  KRDLLSLKEKYEDTLTDNEASLSKNKDLIQRLKADLGNMTSEKQKAEDGINKMSRELFTL 842

Query: 1813 TEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALF---LQLDNMQQKNIFQETDIQP 1983
            T+  Q    +  K   +  ++ +    K+ K L   L     ++  +Q+     +  IQ 
Sbjct: 843  TKEKQDLENEINKSGKENEQRLQ-KFKKDEKRLSEGLAQKDAEVKKLQEFVTRLQNQIQ- 900

Query: 1984 NLDMVKNEVLTLMETMQEKAELMYKDCVKKI---LNESPKFFNVIVEKIDIIRIEFQNFY 2154
             L+  KNE+ + + +++ + E  +   + K+   L    K F  + ++ ++I  E  +  
Sbjct: 901  ELETSKNELSSELNSLRPRFE-SHNALIPKLTEKLKSLAKNFKQLEQEKELISQELVSKG 959

Query: 2155 KNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTL 2334
            K   E +S +  E + L   ++    +    E    H+    + +  K  + +++ K+  
Sbjct: 960  KFNDEEISSLKSEISTLASEIETLVGQKEDFEKKVTHLG---QEVASKV-KLLQDSKIDH 1015

Query: 2335 NDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAA 2514
            +  +   +K I  +  NA    I +       RR + E       K  S++ EF   +  
Sbjct: 1016 DSEVSSLQKTI--DSLNAQVKTISESQLHHSSRREQAE------KKIASLDGEF-EKLEL 1066

Query: 2515 TLSQIKKTVDTSSNSMNESISVMKG-QVEESENAISLLKNNTKFND---QFKQLISKHI 2679
            +++++ K + +    +  +  V+ G + E   N + L +  TK ++   +F  L +KH+
Sbjct: 1067 SVTKLNKLLISKDEELQSTKVVISGIEGERDANQMLLSETKTKLDELQKKFDDLQTKHL 1125

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1794

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 146/733 (19%), Positives = 279/733 (38%), Gaps = 74/733 (10%)
 Frame = +1

Query: 1015 KHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRA 1194
            K ++ + T M + SS    +    L  K   E    S   ++D   SE  N    L +  
Sbjct: 917  KMKKNSDTFMKEKSSLQQNLHEAGLKIKKLSENLE-SANKVIDELNSEKRNTDKNLEEWK 975

Query: 1195 KEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1374
                S +  +  L   + +L +    +  +  K+T  LQ S   N+    ++T++     
Sbjct: 976  ARFQSHDALVPKLTEKLKSLANSFKDLQIQNEKITEELQASK--NSHNTEVSTLTSQVAL 1033

Query: 1375 SEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQ 1554
              E  STL      KN+ N              + I +E +  KS++LS ++ E      
Sbjct: 1034 LNEKISTL---ISEKNVLNS-------------QIIELEHSLSKSEILSKEALE------ 1071

Query: 1555 DHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQ-------------- 1692
                  +S +E   NE     ++I  L +  + L  DK K+ ET+               
Sbjct: 1072 ------SSLVEKEANE-----KQILELTTSINELSADKKKNIETLDNLRTELSSCQEDSK 1120

Query: 1693 ---------------------SQNSQMESLKATINHLKAQLDKQHKAELEISGFN----N 1797
                                 S  S++E L      L  Q D+  K + E+   N    +
Sbjct: 1121 TKDSTIINLNNTIKIAEDKLASSESRLEELIKQKGELAKQKDELAKQKDELHKLNVESKD 1180

Query: 1798 KLQKMTEVMQVALQDYKKRELD-------------LNKKFETHISKEIKSLKTALFLQLD 1938
            +LQK  + +     ++K+ +L+             L+K     + ++IKSL   L  + +
Sbjct: 1181 ELQKTNDKIAKLSGEHKELKLENTSLIKKSDDCKILHKTEVASLQEKIKSLDGELKRKDE 1240

Query: 1939 NM--QQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIV 2112
            N    ++ +  + DI  +    +  +L  +E+ +E  +   +  ++KI  +  +   +  
Sbjct: 1241 NFHESEEKLVHKNDIMKDKLSTQESLLKQLESDKESLKSNIESHLEKIEEQKQEILKLQD 1300

Query: 2113 E--KIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNH-----FFKNNHQE--LLNHH 2265
            E   ++   +      +N+   L + + +N NLK  L+         K+N  E  L +  
Sbjct: 1301 EYSSLESDSLNSSKEKENVTLLLDEANNKNENLKSELEKARADLIDLKSNLDETNLNSQR 1360

Query: 2266 IDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKW 2445
            I    EN+ KK  +F E+  +++    E +K+   + +     ++  +  +    R+   
Sbjct: 1361 ISEEKENLSKKIKKF-EDEILSIKKERETSKQKTQEQIMELQKSIKSRNEEFERERKLLN 1419

Query: 2446 ENSFDLINKCDSMNNEFYNNMAATLSQI---KKTVDTSSNSMNESISVMKGQVEESENAI 2616
            E S     +  +  +E  + + A  ++    K  + T+S+S+ ES   ++ Q+EE  N +
Sbjct: 1420 EGSNTATKEYSAKVSELEDKLDALKAEYSLEKDKLVTNSDSLRESNERLEDQLEEKSNEL 1479

Query: 2617 SLLKNNTKF-NDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKE 2793
             L K + K  N++ K           NIE                      + T   + E
Sbjct: 1480 HLAKEDAKIQNEKIK-----------NIEL--------------------KLKTQANSNE 1508

Query: 2794 NATKDEM--IDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDENPSSENA--- 2958
            +  KD M  ID++ KE+    K L +  S +   S   ++S K   I D     +N+   
Sbjct: 1509 SKLKDYMGNIDSLKKELLGKEKALGILQSQLE--SQLSVVSEKDTEIADIRKQLKNSNIK 1566

Query: 2959 --DSEGSRKIPKT 2991
              + E S K+ K+
Sbjct: 1567 LNEKEVSEKLAKS 1579

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 105/525 (20%), Positives = 195/525 (37%), Gaps = 17/525 (3%)
 Frame = +1

Query: 1459 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLA 1638
            K+ L  NI   L KI+      + K+ I   QD Y +L SD  +   E +     ++   
Sbjct: 1274 KESLKSNIESHLEKIE------EQKQEILKLQDEYSSLESDSLNSSKEKENVTLLLDEAN 1327

Query: 1639 SKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTE 1818
            +KN              ++  S++E  +A +  LK+ LD+ +     IS     L K   
Sbjct: 1328 NKN--------------ENLKSELEKARADLIDLKSNLDETNLNSQRISEEKENLSKKI- 1372

Query: 1819 VMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMV 1998
                             KKFE     EI S+K     + +  +QK   Q  ++Q ++   
Sbjct: 1373 -----------------KKFE----DEILSIKK----ERETSKQKTQEQIMELQKSIKSR 1407

Query: 1999 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLS 2178
              E     + + E +    K+   K+        + + +K+D ++ E+      +  N  
Sbjct: 1408 NEEFERERKLLNEGSNTATKEYSAKV--------SELEDKLDALKAEYSLEKDKLVTNSD 1459

Query: 2179 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENI--------------EKKTNQFVE 2316
             + E N  L+  L+    K+N   L         E I              E K   ++ 
Sbjct: 1460 SLRESNERLEDQLEE---KSNELHLAKEDAKIQNEKIKNIELKLKTQANSNESKLKDYMG 1516

Query: 2317 NFKMTLNDHLEENKKL-IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNE 2493
            N      + L + K L I+Q+   +  +V+ ++       R + +NS   +N+   ++ +
Sbjct: 1517 NIDSLKKELLGKEKALGILQSQLESQLSVVSEKDTEIADIRKQLKNSNIKLNE-KEVSEK 1575

Query: 2494 FYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISK 2673
               + A  L+ IK   ++  + + E +  ++   +     I+ L+       +FK L   
Sbjct: 1576 LAKSAAEDLAAIK---ESELSKIKEDMKTLRSDYDGKIKVITSLELKL---SEFKTLSED 1629

Query: 2674 HIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNK--ENATKDEMIDNILKEIPNL 2847
            +  LKD +               ++ N ++D   +   K  E A   + ++N+ KE   L
Sbjct: 1630 YSSLKDKL--------------GNLENDLKDSKASFQEKKTEAAEYKQTVENLAKEKEKL 1675

Query: 2848 SKRLPLRISNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKI 2982
            +  L      +N C    I    K  IE +N   E A S+    I
Sbjct: 1676 TNDLSNLTERVNSCETA-IQLKDKEAIEAKNRHEELAVSKDEELI 1719

>NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {ON}
            Anc_7.21 YAL047C
          Length = 856

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 90/442 (20%), Positives = 171/442 (38%), Gaps = 34/442 (7%)
 Frame = +1

Query: 1567 NLNSDLESHKNEVQECKREIESLASKNSLLVK---DKLKSRETIQSQ--NSQMESLKATI 1731
            N+ +   S+  E++  ++++ S   +   L +    +L    T  +   N   E+L + I
Sbjct: 287  NVMATSSSNVKEIEFLQKQLTSYKLQQKTLYEVIIHQLNQNNTDSNNGGNKLYENLLSNI 346

Query: 1732 NHLKAQLDKQHKA----ELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKE 1899
            +    Q++K  K     E ++   NN+L K+       L +Y    L  ++     I   
Sbjct: 347  SKNDEQVEKLKKIIKDKENQLENSNNELTKIKNEYSETL-NYANEYLQHSEIISQSIDDL 405

Query: 1900 IKSL-KTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLT-----LMETMQEKAELMYKD 2061
            +  + + A FLQ+D+ ++  + + T I     MVK   LT     L+    EK   + KD
Sbjct: 406  LNLIVENAEFLQIDDNEKNTLIKATQINSTFIMVKLNSLTSILKNLISNQLEKDASIVKD 465

Query: 2062 CVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNN 2241
                  N +      +   I+ +  ++  F   I   LS      N L + L N F   N
Sbjct: 466  QQTNNNNSNTTIDTKLEINIESLHKQYDKFLNGIKFKLSSSQAIENALYEKLSNQF---N 522

Query: 2242 HQELLNHHIDSTYENIEKKTNQFVENFK------MTLNDHLEENKKLIMQNMTNATSAVI 2403
                +  +I  +  +  +K +Q ++  K        LN+    N KL+     N    + 
Sbjct: 523  LLNQIQQYIQESNNDTGEKESQIIQLEKELNLLEKKLNNEKVNNTKLMNLKEENWQDLIG 582

Query: 2404 DQEMDLFEPRRAKWENSFDLINKCDSMN---------NEFYNNMAATLSQIKKTVDTSSN 2556
              E D+         N  DL +  D ++         N+  +++   L++ K+  D   +
Sbjct: 583  QLENDI----EYLTSNKDDLTSLIDELSKNIEHLRFENDDISSLVKQLTEEKRNKDNDFS 638

Query: 2557 SMNESISVMKGQVEESENAISLLKNNTKFNDQFKQL----ISKHIILKDNIEXXXXXXXX 2724
            ++   ++ MK Q    +N I  L +N    ++  +L    + +H++L  N          
Sbjct: 639  NLLVELNDMKLQNNNLQNIIENLHSNANITNEKNELEFDKLKQHLLLHLNKNFEIFERIL 698

Query: 2725 XXXNVDDIYNTIEDIMTNHGNK 2790
               ++D     IE I  N G K
Sbjct: 699  QKKSIDQSKKKIEFITKNTGLK 720

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 98/492 (19%), Positives = 199/492 (40%), Gaps = 17/492 (3%)
 Frame = +1

Query: 1345 IATISPAKVTSEETCSTLEYASKAKNIK----NKPQLGAF-MMKDILVKNITMELAKIKS 1509
            ++TIS  + T E      EY  K K +     N   L      K+ L + +  +LA  K 
Sbjct: 752  LSTISEKQQTLES-----EYEEKKKELAEITANNTSLEQLNTQKEKLTEELKKQLADTKE 806

Query: 1510 DLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETI 1689
             L  T+ ++ +    +H +     +     ++   +RE + L   N    KD  K++   
Sbjct: 807  KL--TQMEKQVKELSEHKEKNEQGINKMNRDLFSLQREKQKLEEDNKQSKKDLEKTKNDF 864

Query: 1690 QSQNSQM-ESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDL 1866
              Q +++ + +KA    +K   +K ++A  +   +++K+Q +T  M      YK  +   
Sbjct: 865  TKQETKLKDQIKAKEILIKETTEKLNEATTQSKEYHDKIQNITSEMNEWQAKYKSHD--- 921

Query: 1867 NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAE 2046
               F   +++++K+L T+                 ++Q   D +K+E+  +  T +    
Sbjct: 922  --TFVAKLTEKLKALATSF---------------KELQAERDTIKSELEKI--TQERDTN 962

Query: 2047 LMYKDCVKKILNESPKFF----NVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQY 2214
            +      KK L E  K      + +++KI  +    ++  K   +  S +  E   L   
Sbjct: 963  IAAITSEKKSLEELYKNMESEKDGLLKKITELETGIESDNKKFEDEKSALESETKRLT-- 1020

Query: 2215 LKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL--IMQNMTNA 2388
            L+   FK+N ++L     D+  E ++  T  + E      +   E+NK L  I Q +  +
Sbjct: 1021 LEIAEFKSNAEKL-----DTERERLQTLTESYKEKLNEANSSIDEKNKDLNNIQQQIEGS 1075

Query: 2389 TSAV--IDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSM 2562
             S +  +  E+   +    + +++   + K    N  +  +    L Q++K VD   +  
Sbjct: 1076 QSEISTLKAEITQLKTSLNEEKSTRKALEKLKEENETYIQSAQDELLQLQKEVDLLKSEN 1135

Query: 2563 NESI---SVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXX 2733
             +++   S +K + +E      L+K     N + KQL    + L   IE           
Sbjct: 1136 KDALDNNSSLKQKYDE------LVKELELKNLESKQLSDNSLNLNSKIE-------QLEG 1182

Query: 2734 NVDDIYNTIEDI 2769
            ++   YNTI+++
Sbjct: 1183 DIKSKYNTIKEL 1194

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 90/456 (19%), Positives = 203/456 (44%), Gaps = 29/456 (6%)
 Frame = +1

Query: 1366 KVTS-EETCSTL--EYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKE 1536
            K++S EE   T+  EY  +   +++K ++    + D   + I       + +  +T+ ++
Sbjct: 1465 KISSLEEKVETIKSEYDKEINILEDKKEVLESELSDKKQEIIDYNQKIKEQETKATEKEK 1524

Query: 1537 GIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMES 1716
             I ++++  KN     +  +N++   +  I ++  +N+ L ++     E+I    + +  
Sbjct: 1525 EIQVAKNALKNAEKKKKDIENDL---RTTIATVEKENTTLKRENQLKSESIDKHQNNIHL 1581

Query: 1717 LKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISK 1896
            L+  ++  K   DK+H    EI     KL+K    M   +   +K++ D N+K   +I K
Sbjct: 1582 LQEELSKQKELADKKHD---EI----RKLEKENSKMIDRIDKLEKQKADTNEKI-ANIEK 1633

Query: 1897 EIKSL---KTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDC- 2064
            E  SL   +  L  +++N Q +    ++ ++ N D + +    L +   E    + ++  
Sbjct: 1634 ENSSLISERKTLVEKVENFQDEITNLKSSLEKN-DSLSSSHDELKDKFNELETELKRNLT 1692

Query: 2065 -VKKILNESPKFFNVIV---EKIDIIRIEFQNFYKNIAEN---LSDISEENNNLKQYLKN 2223
             + K+ +E+ +  + ++   EK+ ++  E     K + E    ++ + + NN L + +  
Sbjct: 1693 ELNKLESENKQLSDKVIEHEEKVSMVEKELSTAQKTLKEREDVINKLKDSNNELNKTIDK 1752

Query: 2224 HFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIM---------QN 2376
            H     H E      DS    ++KK    +++ +  L++ LEE  K  M          +
Sbjct: 1753 HGATEKHYEESITKKDSDIAQLKKK----IKDIEDKLSNILEEKAKAAMLMTQLEKDKTD 1808

Query: 2377 MTNATSAVIDQEMDLFEPR----RAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 2544
            + N+ S  + QE++ +  +     +K +++ +     +  + E + +M+  L   K  + 
Sbjct: 1809 LKNSESE-LKQELEHYRSKYSSLESKLKSTEEAKKHVEEESREQHQSMSLDLKATKDKLK 1867

Query: 2545 TSSNSMNESISVMKGQVE--ESENAISLLKNNTKFN 2646
            ++  S++E +  +K QVE    EN     K+N   N
Sbjct: 1868 SAEISISE-MDAIKKQVELLTKENVDLKSKSNKADN 1902

>KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1755

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 92/465 (19%), Positives = 193/465 (41%), Gaps = 41/465 (8%)
 Frame = +1

Query: 1711 ESLKATINHLKAQLDKQH-KAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETH 1887
            E L    N  +A L+K   + E  I+  N+KL+K+++ ++    +    E +LN+  E H
Sbjct: 697  EKLYVKFNKTRADLEKSTIENENVINSLNSKLEKLSKSLEHLETEKVNAETELNQLNERH 756

Query: 1888 ISKEIKSLKTALFLQ--------LDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKA 2043
             + E++   T + L+        L+ ++QKN       Q  +D  K ++  L + ++E +
Sbjct: 757  SALEVELNDTKIALESVNNKSQKLEELKQKNTKAIAVNQEQIDKYKEKINGLQQKVKEIS 816

Query: 2044 ELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKN 2223
            E   K   +  +N+  +    + ++   ++ + ++  K +       S E  NL++ LK 
Sbjct: 817  ESKLK--AEDGINKMSRELFTLTKENGKLKEDLKSHSKKLEIQEKKYSSETANLEKQLKE 874

Query: 2224 HFFKNNHQELLNH------HIDSTYENIEKKTNQFVE-----NFKMTLNDHLEENKKLIM 2370
                   QEL          ID+  +N+   +NQ +E     + + +L   L E  K + 
Sbjct: 875  R--GTEVQELRERISEDIKRIDTLEKNVTILSNQKIELETKLSNQTSLIPKLTEKLKGLA 932

Query: 2371 QNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNN-------------EFYNNMA 2511
             N  +  +        + E   A      +L ++ +S+N              E++    
Sbjct: 933  NNYKDLENERDTLAKKILEKEEANKTIMQNLNSEIESLNKEREEMRLDLQYAAEYHQKEK 992

Query: 2512 ATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLK-NNTKFNDQFKQLISKHIILK 2688
                   + + + +NS +ESI  ++ +++E E  I   K  N +  +    L  K I L+
Sbjct: 993  ENFDAHTQKLTSENNSKSESIISLQTKLDECERQIKEYKTTNEELKNSLHALNVKCIELE 1052

Query: 2689 DNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMI---DNILKEIPNLSKRL 2859
             ++E            ++++ +++  I  +      A KDE++   + I +E+ N  + L
Sbjct: 1053 SSLESAKQSTDNSDETIEELNDSVIAI-NDELQSVLAEKDELLKQNNKINEELCNYQQEL 1111

Query: 2860 PLRISNINGCSVQDIISPKKHTI----EDENPSSENADSEGSRKI 2982
              +  +  G  +QD IS   + I    E+ N   +  ++    K+
Sbjct: 1112 QEKADSCQG--LQDKISSLNNEIMQISEESNDKIKLLEASNEEKV 1154

>Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON}
            similar to Ashbya gossypii AER045C
          Length = 1366

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 86/415 (20%), Positives = 171/415 (41%), Gaps = 19/415 (4%)
 Frame = +1

Query: 1462 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 1641
            D L KN    +   KS L   K +  I   +    ++  + +  +  + +  RE+ SL+ 
Sbjct: 779  DDLKKNHLKSIENNKSRLAEFKDR--IISLEKSLHSITEEKKKAEEGINKMSRELFSLSK 836

Query: 1642 KNSLL--VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMT 1815
            + SLL    DKLKS     + + +   L   +   +A + K      +I    N+L+   
Sbjct: 837  EKSLLSTEMDKLKS-----ASDKEKSKLSQVVGEREAHIAKMKTELADIFNQKNQLEISN 891

Query: 1816 EVMQVALQDYKKRELDLNKKFETHISKEIKSLKT-ALFLQLDNMQQKNIFQETDIQPNLD 1992
            E +   L D K R    ++     +++++KSL T    L++ N   K    E     +L+
Sbjct: 892  ESLSKELSDIKPR-FSSHEMLIPKLTEKLKSLATNCKELEIKNNSLKKQLDEARSTSSLE 950

Query: 1993 M--VKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIA 2166
            +  +K+E+ TL   + EK+ L  K       N        I  ++++ ++E ++    ++
Sbjct: 951  IASLKSEIETL---VAEKSILDQKS------NNLEVQLGKIQRELELAKVEVEDSKTKLS 1001

Query: 2167 ENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHL 2346
            +  S + E   NLK  L +   + + Q+L +  +      +  +  +   +++  +    
Sbjct: 1002 DENSRLHENLKNLKDQLSSITSERDQQKLKSESLAGDLTKVSAEIKKLQNDYESLIKKLK 1061

Query: 2347 EENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAA---T 2517
              N  L   N     S +    ++L E +    +NS +L  K + +  E  +N A+    
Sbjct: 1062 VTNSDLDSCNERLKQSQIERDTLEL-EFKTISTQNS-ELQKKIEDLTLENKSNTASLSED 1119

Query: 2518 LSQIKKTVD-----------TSSNSMNESISVMKGQVEESENAISLLKNNTKFND 2649
            + Q   TVD           T+  ++  +    K +V+E E  + +L   +K ND
Sbjct: 1120 IFQNDSTVDKSDEFELEELRTALKNVTANYDAAKAKVDELERNLRVLSEKSKNND 1174

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 113/581 (19%), Positives = 229/581 (39%), Gaps = 51/581 (8%)
 Frame = +1

Query: 979  ALEGLNLLQRGL----KHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDL 1146
            A EG+N + R L    K + + ST+M+   S S                    K  L  +
Sbjct: 820  AEEGINKMSRELFSLSKEKSLLSTEMDKLKSASDK-----------------EKSKLSQV 862

Query: 1147 AGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQD--SL 1320
             G    + +    + A      NQ  ++   +   L D        E  + +L +   SL
Sbjct: 863  VGEREAHIAKMKTELADIFNQKNQLEISNESLSKELSDIKPRFSSHEMLIPKLTEKLKSL 922

Query: 1321 GGNTKTALIATISPAKVTSE-ETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELA 1497
              N K   I   S  K   E  + S+LE AS    I+      + +  D    N+ ++L 
Sbjct: 923  ATNCKELEIKNNSLKKQLDEARSTSSLEIASLKSEIETLVAEKSIL--DQKSNNLEVQLG 980

Query: 1498 KIKSDL---------LSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNS 1650
            KI+ +L           TK  +      ++ KNL   L S  +E  + K + ESLA    
Sbjct: 981  KIQRELELAKVEVEDSKTKLSDENSRLHENLKNLKDQLSSITSERDQQKLKSESLAGD-- 1038

Query: 1651 LLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELE----------ISGFNNK 1800
             L K   + ++      S ++ LK T + L +  ++  ++++E          IS  N++
Sbjct: 1039 -LTKVSAEIKKLQNDYESLIKKLKVTNSDLDSCNERLKQSQIERDTLELEFKTISTQNSE 1097

Query: 1801 LQKMTEVMQV--------ALQDYKKRELDLNKKFETHISKEIKSLKT------ALFLQLD 1938
            LQK  E + +          +D  + +  ++K  E  + +   +LK       A   ++D
Sbjct: 1098 LQKKIEDLTLENKSNTASLSEDIFQNDSTVDKSDEFELEELRTALKNVTANYDAAKAKVD 1157

Query: 1939 NMQQKNIFQETDIQPNLDMVKNEVLTLMETM-------QEKAELMYKDCVKKILNESPKF 2097
             + ++N+   ++   N D   N  L  +++            E  Y D +KK   E  K 
Sbjct: 1158 EL-ERNLRVLSEKSKNNDYNDNSELKKLQSQIADYKGKLSNTETNYTD-LKKAYEELEKT 1215

Query: 2098 FNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDST 2277
              + +++ +    +     K+    +SD+S +  N K    ++  ++N ++     +++ 
Sbjct: 1216 HRLTLKEAE----KSSTNSKSQVGQVSDLSSDVENSKGGKDDYIVESNSEKA---QLETE 1268

Query: 2278 YENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSF 2457
             EN++ +    ++  +M   ++L +  KL    + +  S  +  +++ F+ + A  E+  
Sbjct: 1269 LENLKNQLQ--IQRDEMAAKNNLLDT-KLAELAVIHEESNDLRSKLEQFQKKAANSESER 1325

Query: 2458 D----LINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNE 2568
            D    L+++ D  N ++   +      +    DT + + +E
Sbjct: 1326 DDLILLVSELDEKNQKYRAKLQTLGHPVSSDEDTDAENEDE 1366

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 90/455 (19%), Positives = 182/455 (40%), Gaps = 16/455 (3%)
 Frame = +1

Query: 1504 KSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE--------CKREIESLASKNSLLV 1659
            K   +  +    +    D+ +N   DLE+  NE +E         + EIE L       V
Sbjct: 1120 KKTTILDEEANSLKTKNDNLQNAKEDLETKLNEAKERFEKEFSSTQSEIEDLKGNLQTKV 1179

Query: 1660 KDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQ 1839
            KD  ++ E  +   +++   ++ I+ LK  L+ +   E  I     K+ +  E  Q AL 
Sbjct: 1180 KDIQRANERKEELENKLTLAQSKISELKKDLEMK---ETHI----QKMYETKEKCQNALN 1232

Query: 1840 DYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTL 2019
              +    +L K  ET   KE K  K     +    + +   QE+  +  +D +K E ++ 
Sbjct: 1233 SSQSEVEELKKNLET---KETKIQKATEACESLRSELETSVQES--KRGMDELK-EKISA 1286

Query: 2020 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD---ISE 2190
            +ET++ +AE    + +KK L +  K    +    D I  +      N++ +  D   + +
Sbjct: 1287 LETLKREAE-KDSETMKKELEDKEKNLATLQSAFDDISKQLSLLENNLSSSHDDTKKLRD 1345

Query: 2191 ENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIM 2370
            EN  L++ L          +  ++ ++ +   +E  T +  +N     +  L E K  + 
Sbjct: 1346 ENEELQKQLGK---LRADFDTKSNELEESLVKLEGVTKEKTKN-----SSELTEAKSSLQ 1397

Query: 2371 QNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTS 2550
            +        V D +  L E  +A +E    L+N+  S   + Y+     L   ++ + +S
Sbjct: 1398 KVKLELERNVTDLKKQLNEKTQA-FERERKLLNEGSSSITKEYSEKVTAL---EEKLTSS 1453

Query: 2551 SNSMNESISVMKGQVEESEN-----AISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXX 2715
             N   E +  ++ +  E ++       +L + NT+      +L  K I L+         
Sbjct: 1454 KNDFEEKVRELESKQTEMDSLKLDLEATLEQKNTEIKKLSSELSEKEIQLEKGSSEISEI 1513

Query: 2716 XXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMID 2820
                   + ++   + ++     +K+ A KDE ++
Sbjct: 1514 SKKNEITIKELEKQLSEL-----HKQLAEKDEKLE 1543

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 66/338 (19%), Positives = 149/338 (44%), Gaps = 12/338 (3%)
 Frame = +1

Query: 1342 LIATISPAKVTSEETCSTLEYASKAKNIKNKP---QLGAFMMKDILVKNITMELAKIKSD 1512
            L + +S  ++  E+  S +   SK   I  K    QL   + K +  K+  +E  K  ++
Sbjct: 1492 LSSELSEKEIQLEKGSSEISEISKKNEITIKELEKQLSE-LHKQLAEKDEKLETCKGDNE 1550

Query: 1513 LLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQ 1692
               TK K     ++D  K  N      + E ++ ++++E    +NS   K   + +ET+ 
Sbjct: 1551 KKITKLKHSFDETEDKLKESNMQTSKLEKENKDLRQKLEESLKRNSQEYKSLEQLQETLV 1610

Query: 1693 SQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM---QVALQDYKKRELD 1863
             +  ++E    ++N  K QL+++ K   +      KLQ+    +   + A+QD++  +  
Sbjct: 1611 KEKQELEK---SLNDSKIQLNEKEKVIKDFEVTKEKLQETENALSEKEKAMQDFEATKEK 1667

Query: 1864 LNKKFETHISKEIKSLKTALFLQLDNMQ-QKNIFQETDIQPNLDMVKNEVLTLMETMQEK 2040
            L ++ E  +S++ K+ +     +   ++ +K + ++     +L++  N++      + EK
Sbjct: 1668 L-QETENALSEKEKAAQDFEITKKKLVETEKALSEKGKAVEDLEITTNKLKESEIELTEK 1726

Query: 2041 AELM--YKD---CVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNL 2205
             + +  +K+     +K L E+      + EK  ++  E  +   ++ E  S I ++   +
Sbjct: 1727 GKKLEHFKETSATFEKELQEAIAGKKSLEEKASLLESELLDLKNSLEEKDSVIQKKEQLI 1786

Query: 2206 KQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVEN 2319
             Q  +    KNN + +    +    E   KK ++ V +
Sbjct: 1787 SQSQQ----KNNSELMELRDLLKKLEEENKKLSEQVSD 1820

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 81/430 (18%), Positives = 181/430 (42%), Gaps = 35/430 (8%)
 Frame = +1

Query: 1462 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDL--ESHKNEVQECKRE-IES 1632
            DI VK +   L  I  +     SK+  Y  +D+Y  +   L  +++++ +++ K   + +
Sbjct: 599  DITVKCLVTMLLGISYEF---SSKDSPYPRKDYYNFITKRLGQDNYQSRIKQFKENSLFA 655

Query: 1633 LASKNSLLVKDKLK---------SRETIQSQNSQMESLKATINHLKAQLDKQHKAELEIS 1785
             A++N  ++   L          S   I+  +     +++ ++H     D++  +++   
Sbjct: 656  KANENFDILNPGLDETGLPNLYFSPHFIELIDENFYRIRSALSHSP---DEEPYSKISFE 712

Query: 1786 GFNNKLQKMTEVMQVALQ---DYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKN 1956
             F     +   + +  +Q   D K    DLN K ++ +S E KS+ +  + +L N  +  
Sbjct: 713  EFEELQGRCANLKKELVQLELDNKALSDDLNAKLDS-LSTEYKSV-SGNYERLKNDYEFL 770

Query: 1957 IFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRI 2136
              +   ++ +L+ V      L+E  ++K  L   +  KKI       F    +KI+    
Sbjct: 771  EGKHKKVEKSLENVSTR---LIEITKDKENLTAAN--KKITET----FASNKKKIEA--- 818

Query: 2137 EFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVE 2316
             +++    +   L DI+ +    ++ +     +  + E     I+S  + +EK+ N+ +E
Sbjct: 819  -YESKINTLESKLRDITSKKEQAEEGINKMSRELFNLEKNKEDIESAKKKVEKELNKELE 877

Query: 2317 NFK---MTLNDHLEENKKLIMQ-----NMTNATSAVIDQEMDLFEPRRAKWENSFD---- 2460
            N K     L++ L + +K +              ++++ + D       +W++ F     
Sbjct: 878  NMKNENKKLDNTLAKKEKELQSLDEELQKLRKMQSLLETDKDQSARELTEWKSKFQGHDE 937

Query: 2461 ----LINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVE----ESENAI 2616
                L +K  S+ N F N  +   +  K  ++ + N+  + +  ++ Q+E    E +NAI
Sbjct: 938  LVTRLTDKLKSLANSFKNIQSERDTLQKHLMEITDNNKLD-VQNLESQIEALSTERDNAI 996

Query: 2617 SLLKNNTKFN 2646
              L+ N   N
Sbjct: 997  --LERNDLLN 1004

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 127/637 (19%), Positives = 248/637 (38%), Gaps = 71/637 (11%)
 Frame = +1

Query: 1297 TRLLQDSLGGNTKTA---LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDI 1467
            TRL   S    TK++    + TI        +T  T++   K    ++KP        DI
Sbjct: 1344 TRLASSSFELQTKSSQLNTLKTIVSGLNLPHDTMMTIDRELK----ESKPS-------DI 1392

Query: 1468 LVKNITMELAKIKSDL-LSTKSK----EGIYMSQDHYKNL---NSDLESHKNEVQECKRE 1623
             V+ I +E+  +K  L + TK+K      +    D +K +   +S  E +K + +    +
Sbjct: 1393 NVEKILLEIEHLKRQLEIETKAKIDAENSVAALHDKFKRIQRSDSSSEIYKLKYEASAEK 1452

Query: 1624 IESLASK---------NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAEL 1776
            I +L SK         +++   D    RE+I   +  + + +  I +LK  +    K   
Sbjct: 1453 IRTLESKLSREPLKPLSNVSSNDLFNKRESISKYDEDLRAYRLEILNLKEIMKNSDKG-- 1510

Query: 1777 EISGFNNKLQKMTEVMQVALQDYK--KRELDLNKKFETHISKEIKSLKTALFLQLDNMQQ 1950
             ++    +L++ +    + L   K  +++LD  +     +SK + S K  +   L+ + Q
Sbjct: 1511 -VATLQKRLEEKSLNENLLLDRIKILEKDLDTTEHQNELLSKTLTSQKQQIENNLNEIHQ 1569

Query: 1951 KNIF----------QETDIQPNL-------DMVKNEVLTLMETMQEKAELMYKDCVKKIL 2079
              +            + DIQ  +       D +K+    L +   EK  L+ +      L
Sbjct: 1570 YELQLKDYAYALKQSDEDIQQMVSNINFLKDQIKDNEQALFDHENEKNSLIME------L 1623

Query: 2080 NESPKFFNVIVEKIDIIRIEFQNFYKNIAE------NLSDISEENNNLKQYLKNHFFKNN 2241
            N++        + I +   E  +  + I +         +I +  + LKQY+K     N 
Sbjct: 1624 NDTSLELKKSQDAIKLYTSEISHLKERIVDAQDRTKEYEEIDQLRSQLKQYMKIESELNK 1683

Query: 2242 HQELLNHHI-----DSTY--ENIEKKTNQFVE-----NFKMTLNDHLEENKKLIMQNMTN 2385
               +LN  +     DS Y  E + K+TN + E       +  + D   +N K + +N++ 
Sbjct: 1684 EISVLNFKLNTLTKDSEYKIEELLKQTNHYTELVEKLGSERDMLDSTGQNLKQLYENVST 1743

Query: 2386 ATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNS-- 2559
              S + D    L        EN+  L  + + + N    +    L++IK   + S NS  
Sbjct: 1744 EASTLSDNMKSLIN------ENTM-LSGEVERLEN-LLEDKNKLLNEIKYENNDSKNSIK 1795

Query: 2560 -MNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXN 2736
             + E++ +   Q E +E  +  L++     D+FK+  ++        E            
Sbjct: 1796 YLQETLELRNKQTERNEELLKSLQDQL---DEFKENYNEEKQNALEFEEEYRSVDKLNHQ 1852

Query: 2737 VDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNI-NGCSVQDII-- 2907
            +   YNT+ D +      +   +D+ +  I +    +S+   L+   I     ++ II  
Sbjct: 1853 LTLKYNTLRDRL-----NDTRERDQWLAKIHELETKISEETELKYEEIKKNKKLEHIIGD 1907

Query: 2908 --------SPKKHTIEDENPSSENADSEGSRKIPKTE 2994
                    S     +EDE  + E++ S+ +  I + E
Sbjct: 1908 LQRENLMSSSIADKVEDERKNFESSASQYANHIDELE 1944

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 74/413 (17%), Positives = 163/413 (39%), Gaps = 24/413 (5%)
 Frame = +1

Query: 1507 SDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRET 1686
            ++L+S+     +Y+      N   ++   K   ++ K     +   N  L+K +   +E 
Sbjct: 838  NNLMSSDDWYNLYIKLKPLLNSTKEINKSKKFSEKIKSLELQIKDLNEKLIKSETTDKEN 897

Query: 1687 IQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDL 1866
            +   N  M+ + +  NH+  + D+  K +LE      K + + E      +D K     +
Sbjct: 898  VLKLNQSMDEINSLKNHILEKNDELDKIKLESDATLKKWESLNETNNTLTKDLK----SM 953

Query: 1867 NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLME--TMQEK 2040
              K ET   KEI++LK     ++D +      Q  + +  +     E++TL    +  +K
Sbjct: 954  TDKMETR-EKEIETLKNDT-TKIDEINT----QLKEAKEKILQKDKEIITLKNDTSAADK 1007

Query: 2041 AELMYKDCVKKILNESPK---------FFNVIVEKIDIIRIEFQNFYKNIAENLSDISEE 2193
             E   KD    ++++  K           N  + K++    +       +  N     + 
Sbjct: 1008 LESQLKDLQANLISKDKKSKDDKSLIDSLNTKITKLEESLTKRDKEIITLKTNTKTNDDL 1067

Query: 2194 NNNLKQYLKNHFFKNNHQELL---NHHIDSTYENIEK---KTNQFVENFKMTLN---DHL 2346
             N LK+       K    +LL   N  +++   +I+K     +  ++N   TL+   ++L
Sbjct: 1068 TNKLKKLETELSTKEKSYKLLFDSNKSLETEIHSIKKVVASKDSQIKNLNDTLSKKENNL 1127

Query: 2347 EENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQ 2526
            +    L+ +   +A + +    +D      +K +N  + + + ++   +  +     L  
Sbjct: 1128 DGKLSLLEKECHSALTKMKTLLLD-----NSKLKNQIEQLTESNNSLEKKLSKKDDELEN 1182

Query: 2527 IKKTVDTSSNSMNESISVMKGQVEESENAISLLKNN----TKFNDQFKQLISK 2673
            +K      S+ +    +     +EE+E  I+ LK++    ++ N  F +L  K
Sbjct: 1183 LKGISKIHSDELTTITNERDSFIEENEKLITELKSSRASYSELNKNFNKLSEK 1235

>TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {ON}
            Anc_5.296 YDR285W
          Length = 881

 Score = 58.9 bits (141), Expect = 6e-08
 Identities = 90/457 (19%), Positives = 180/457 (39%), Gaps = 25/457 (5%)
 Frame = +1

Query: 1564 KNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLK 1743
            +N   D +  KN++Q    E   LASK +   K      + I+  + Q        NH  
Sbjct: 200  QNAQQDNKKLKNKIQATDEETNKLASKFAEYKKKICDLEQKIKWFDEQK-------NHND 252

Query: 1744 AQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKK----RELDLNKKFETHISKEIKSL 1911
             +L    K    +    N L+   E + V + + K+     E +LNKK     +KEI+ L
Sbjct: 253  NKLHDLKKTNQLVVAKINDLKTNYESIGVTVSNLKRSKMMTETELNKK-----NKEIEYL 307

Query: 1912 KTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESP 2091
            +  L              +   Q + + ++N  L L     +       + +KK  NE  
Sbjct: 308  QKEL-------------DDCSGQLSEEKIRNNNLILEFNTIKTQNTEINESMKKNFNEFD 354

Query: 2092 KFFNVIVEK--IDIIRIEFQNFYKNIAENLS-DISEENNNLKQ------YLKNHFFKNNH 2244
                  + +  I+ ++ E  N  + I +     + E  NN+KQ       +   F K  +
Sbjct: 355  SMLKTFINERFINCLKDESSNTKEEILKTFEIKLKENENNIKQNYQDDVVILKEFCKTEN 414

Query: 2245 QELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLF 2424
              ++N  I+S++ N    ++  +E    ++  ++      +++N  N  + + + ++ L 
Sbjct: 415  NNIIN-SINSSFSNTVSDSSSTLEK---SIMQNIHNGNDKVIENSNNMKNCIDEVKIQLV 470

Query: 2425 EPRRAKWENSFDL-INKCDSMNNEF--YNNMAATLSQIKKTVDTSSNSMNESISVMKGQV 2595
            E R     N  +  I+K  S+ +E+  +     T+SQ    +      +  SI   + Q 
Sbjct: 471  EDR-----NQINAEISKFSSLMSEYKEFEKKLETVSQENTELKIQKTQLLTSIGTKEAQY 525

Query: 2596 EESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMT 2775
            EE  N +  LK +T   ++ ++       LKD  E           +++ + N   +   
Sbjct: 526  EELLNQVGNLKLSTTTLEENEK------CLKDQTEKLLEKVSEYEKSIERLKNLESNSSA 579

Query: 2776 NHGNK---------ENATKDEMIDNILKEIPNLSKRL 2859
            N+ NK            ++++M+ N++K +    ++L
Sbjct: 580  NYENKLASQVTISNTLTSENDMLKNMVKRLEESKEQL 616

 Score = 36.2 bits (82), Expect = 0.56
 Identities = 59/269 (21%), Positives = 103/269 (38%), Gaps = 26/269 (9%)
 Frame = +1

Query: 1570 LNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQ 1749
            L S+ +  KN V+  +   E L+ +N+   ++  K  + +   N ++  LKA    LK +
Sbjct: 595  LTSENDMLKNMVKRLEESKEQLSHENNKKFENHQKLLDQVSELNIELVHLKAGELELKEE 654

Query: 1750 -------LDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKS 1908
                   ++       E S    + Q+    ++   Q+Y   +LDL  K E   ++ +K 
Sbjct: 655  NYTLKKTIENNKSNFEENSSSVKRFQQKIIELESDKQEYMSEKLDLLDKIEEKENRILKL 714

Query: 1909 LKTALFLQLDNMQQKNI--FQETDIQPNLDMVKNEVLTLMETMQ---EKAELMYKDC--- 2064
                  L+ +  Q KN    Q    +PN    K   +   +T     EK  L+       
Sbjct: 715  ANEVKVLEKETNQLKNYKNAQSNMSRPNATTSKPNNIQKRDTKTLEGEKDSLLLSQLENT 774

Query: 2065 -----------VKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQ 2211
                        K I+ E PK  N+I          + NF  +++ +L+D  E     + 
Sbjct: 775  TNKKRKKTIAKEKLIIQEEPKEDNIIK--------SYDNF--DLSSSLNDDLEMIFPSQV 824

Query: 2212 YLKNHFFKNNHQELLNHHIDSTYENIEKK 2298
             LK +  K  +Q   +H+    Y N  KK
Sbjct: 825  ELKIN--KKPNQRNNSHYTHDPYPNTRKK 851

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 115/622 (18%), Positives = 266/622 (42%), Gaps = 52/622 (8%)
 Frame = +1

Query: 1135 LVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQD 1314
            L++    EN+++S  L ++  E  ++  S+ +L      L  +  ++          L  
Sbjct: 383  LLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQN-NETLGS 441

Query: 1315 SLGGNTKTAL--IATISPAKVTSEETCSTLEYASKAKNIK---NKPQLGAFMMKDILVKN 1479
            SLG      L      + A+  S+     LE  ++ KN+K   N+      + +++  K 
Sbjct: 442  SLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKA 501

Query: 1480 ITMELAKIKS-----DLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKRE------- 1623
              +E   +K      D     +KE I + Q++ + L S ++   +E+   K+E       
Sbjct: 502  EKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDELAVQKKEKTEKESI 561

Query: 1624 -----IESLASKNSLLVKDKLK-----SRETIQSQNSQMESLKATINHLKAQLDKQHKA- 1770
                 IE  AS +++ +  +L      S++ I + NS++E+L      +   LDK+  A 
Sbjct: 562  SAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSAR 621

Query: 1771 ELEISGFN------NKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALF-- 1926
            +L    +N      + L+   E +Q  +   ++  LD  K+F ++ S++  S K+ L   
Sbjct: 622  KLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQF-SYSSRDYISCKSKLSTA 680

Query: 1927 -LQLDNMQQKN---IFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPK 2094
              ++ +++ +N   I  +T ++   + + NE   L  T+ +   L   + ++ +L E+  
Sbjct: 681  EAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSL--NNELQTLLKETKS 738

Query: 2095 FFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNN-LKQY------LKNHFFKNNHQEL 2253
             ++  ++   +   +  N  + + + +S++  +N++ +K Y      LK + F+      
Sbjct: 739  GYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYKATIDDLKANVFE------ 792

Query: 2254 LNHHIDSTYENIEK--KTNQFVENFKMTL--NDHLEENKKLIMQNMTNATSAVIDQEMDL 2421
            LN  +    E IE+  KT + V+N ++TL  +  + E K+ + + ++   S +    +++
Sbjct: 793  LNEELKQKEEKIEEFSKTLENVQN-ELTLANSKDVSEEKRALEKELSEVKSQLEKSNLEV 851

Query: 2422 FEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEE 2601
             E     +EN      +     +  Y +    L+    +      ++ E++S ++ ++  
Sbjct: 852  KE-----YENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLSTLQARMVV 906

Query: 2602 SENAISLLKNN-TKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTN 2778
             ++ ++   N  ++    +  L+ +    KD              N D +  + E IM  
Sbjct: 907  QQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIM-- 964

Query: 2779 HGNKENATKDEMIDNILKEIPN 2844
               +EN+   ++++ + +E+ N
Sbjct: 965  ---QENSELSKVVELLREEVKN 983

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 61/274 (22%), Positives = 123/274 (44%), Gaps = 9/274 (3%)
 Frame = +1

Query: 1459 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY---KNLNSDLESHKNEVQECKREIE 1629
            KD L  N  ME    + + ++T+++E I   ++     KNL +    H + VQE K   E
Sbjct: 1141 KDALGTNKYME----QPNKVTTEAQEKIQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFE 1196

Query: 1630 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 1809
                K+SLL + + +  +   ++    E  +  I    +Q ++  K  + +     K+  
Sbjct: 1197 K--EKSSLLSQQEQEIEKLTDNERKLREFYEEEIQKKVSQAEENLKKRIRLPT-EEKING 1253

Query: 1810 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNL 1989
            + E          KR+ +L   FE  I +E KSL     L  D+ + K I++E + +   
Sbjct: 1254 IIE----------KRKSELESSFEQKIKEEAKSL----LLHSDDDKIKKIYKEIE-ESGR 1298

Query: 1990 DMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDII------RIEFQNF 2151
            + ++ E    +  +++KA   +++  + +L +S      +  KI ++      + +  N 
Sbjct: 1299 ETLQQEFDEQLNIVRKKA---FEEGKQHVLMKSA----FLERKISMLEGQLKEKNKLNNN 1351

Query: 2152 YKNIAENLSDISEENNNLKQYLKNHFFKNNHQEL 2253
             KN+ EN+S   E N++++    N FF    +++
Sbjct: 1352 SKNLKENVSSTDEHNSSIQ---GNPFFNLGKEQM 1382

 Score = 40.8 bits (94), Expect = 0.023
 Identities = 66/277 (23%), Positives = 119/277 (42%), Gaps = 17/277 (6%)
 Frame = +1

Query: 1585 ESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQME-SLKATINHLKAQLDKQ 1761
            +  +  V+   RE E   S+N+  +K K+KS+    S   Q E  +   + HLK Q +++
Sbjct: 1081 QKEERSVRHKLRETEHALSENAFELK-KIKSQIFELSSLPQNEHDILRHLVHLKEQREEK 1139

Query: 1762 HKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDN 1941
            +K  L  + +  +  K+T   Q  +QD ++ +L+  K  ET  S E  SL   +    DN
Sbjct: 1140 NKDALGTNKYMEQPNKVTTEAQEKIQDLEE-QLNGAKNLET-TSLEHDSLVQEM---KDN 1194

Query: 1942 MQQKNIF----QETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVI 2109
             +++       QE +I+   D  +       E +Q+K     ++  K+I   + +  N I
Sbjct: 1195 FEKEKSSLLSQQEQEIEKLTDNERKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGI 1254

Query: 2110 VEK-IDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEN 2286
            +EK    +   F+   K  A++L   S+++   K Y +    + + +E L    D     
Sbjct: 1255 IEKRKSELESSFEQKIKEEAKSLLLHSDDDKIKKIYKE---IEESGRETLQQEFDEQLNI 1311

Query: 2287 IEKKT-----------NQFVENFKMTLNDHLEENKKL 2364
            + KK            + F+E     L   L+E  KL
Sbjct: 1312 VRKKAFEEGKQHVLMKSAFLERKISMLEGQLKEKNKL 1348

 Score = 39.3 bits (90), Expect = 0.069
 Identities = 71/329 (21%), Positives = 136/329 (41%), Gaps = 27/329 (8%)
 Frame = +1

Query: 1489 ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDK 1668
            +++K+ +D++   SK+      + Y +L        + + E  + ++          K+K
Sbjct: 23   QISKLDTDVIDALSKKS-----EEYNSLKESSLGLSSSISELSKTLQ----------KEK 67

Query: 1669 LKSRET-------IQSQNSQMESLKATINHL----KAQLDKQHKAELEI-SGFNNKLQKM 1812
            L S+ET       ++ + +Q+++LKA +N +    K   +  HK   EI +  + KL   
Sbjct: 68   LASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLR 127

Query: 1813 TEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLD 1992
            T++ +V         L L  K + H   E  S +       ++ + +   +  ++  NL 
Sbjct: 128  TQLDKVTF------TLSLTMKQKQHTESEYLSKEK----HFESYKDRKELEYQNVMENLT 177

Query: 1993 MVKNEVLTLMETMQEKAEL------MYKDCVKKI-----LNESPKFFN--VIVEK--IDI 2127
             + NE   L  T  + AEL      + KD   KI     L  S K  N   + EK   D 
Sbjct: 178  AIDNE---LRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQ 234

Query: 2128 IRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQ 2307
            +    QN  K + E L  +S+E           F     Q+L  H +    +N+ +K  +
Sbjct: 235  LINALQNQIKTLQEQLESLSDEK----------FDDPGTQKLDKHELLRQIKNLNEKL-E 283

Query: 2308 FVENFKMTLNDHLEENKKLIMQNMTNATS 2394
              E  +++L   +EE + +  +  ++ +S
Sbjct: 284  ISERERLSLVHSMEEFQNIPEEESSSVSS 312

>KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {ON}
            Anc_8.604 YOR195W
          Length = 756

 Score = 58.5 bits (140), Expect = 7e-08
 Identities = 78/444 (17%), Positives = 195/444 (43%), Gaps = 11/444 (2%)
 Frame = +1

Query: 1366 KVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIY 1545
            K+  ++  S ++   K KN  +    GA  ++D   +++   + ++K++L    S + + 
Sbjct: 281  KMEVKQLISKVDSLVKEKNKLSTDAEGATKLRDEN-ESLKTSIGELKTELSMLDSNQTLL 339

Query: 1546 MSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKA 1725
              Q+ Y  + S+ E  ++     K+EIESL       ++D     E +   + ++ES  +
Sbjct: 340  --QEKYDQIYSEYEKSQSTTDFMKKEIESLQKS----LEDSANILEELSEHSKELESKLS 393

Query: 1726 TINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIK 1905
            T+   K  ++++            KL K  + +   L       + L  K +  ++ E +
Sbjct: 394  TVEQEKKNMEEE----------KLKLLKENKHVMNQLSGKDNEIVSLEGKIKDLVNSE-R 442

Query: 1906 SLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEK-AELM-YKDCVKKIL 2079
            +   +L  Q+  +  + +  E  ++ + +  ++E+  L +T++EK +EL+     +    
Sbjct: 443  NHSKSLIDQIAVLTNEKMSLEEQVKKSENQFQSEISELQDTLKEKESELLDTTRALNDAK 502

Query: 2080 NESPKFFNVIVEK---IDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQE 2250
             ++ K  N ++++   +  ++  ++    + +   ++++E NN ++   ++         
Sbjct: 503  EDNTKLINEMMDRTKEVQSLKKTYEEANDHASVRTAEVTELNNQIETLKES--------- 553

Query: 2251 LLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEP 2430
                H+++T + +++K    +  +K    D +E+ ++L ++ +    + V D+E      
Sbjct: 554  --QRHLETTIDLLQEK----IGTWKSKYEDQIEKERELNLE-IETLNARVKDEE----HS 602

Query: 2431 RRAKWENSFDLINKCDSMNNEFYNNMAATLSQIK-KTVDTSSNSMNESISVMKGQVEESE 2607
                  NS +L ++      E    ++ ++ +I+  T +TS  S NE     K  +   +
Sbjct: 603  STGDAPNSAEL-HQMRKEKEELQKKLSDSVKRIELMTAETSKTSPNEDSDESKQMIASLK 661

Query: 2608 NAISLLKNNT-----KFNDQFKQL 2664
               S LK  +     +FN + K+L
Sbjct: 662  AQFSALKRRSESREVEFNKKLKKL 685

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 96/454 (21%), Positives = 195/454 (42%), Gaps = 23/454 (5%)
 Frame = +1

Query: 1354 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKN--ITMELAKIKSDLLSTK 1527
            I+      +E    LE    AK+ +NK Q     M +   K   I  E+ ++++ L   +
Sbjct: 79   IALTNAKDKERLLLLEEVVGAKSFENKLQASLLKMDETEQKRFQINKEMKELENKLNEME 138

Query: 1528 SKEGIYMSQDHYKNLNSD-----LESHKNEVQECKREIESLASK-NSLLVKDKLKSRETI 1689
             ++   +  + Y NL  +        +  E+ +   +IE L  + NS+L+  + K  + +
Sbjct: 139  QEK---IELEKYNNLEKNKKVIQFNLYDRELNDIINQIEKLDIEYNSILISSE-KYLQEL 194

Query: 1690 QSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLN 1869
              +   +E LK  +NH++ +L  ++++E E      +L    + +   + +Y+ +  +  
Sbjct: 195  DKRELIIEQLKMKLNHIEDELKIKNQSEFE------ELNNTKDAISQKITNYQIKIKEFE 248

Query: 1870 KKFETHISK-EIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAE 2046
             K +T+ S+ +I +    L  +L N +Q  +    +I+P  + + N             +
Sbjct: 249  NKIKTNKSQLKINNQNLKLLDELINEKQLEL---NEIKPQYEELNNV----------NQD 295

Query: 2047 LMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNH 2226
            L ++  + K+ ++         EKI II+    + + NI E    I EE NNL   L   
Sbjct: 296  LKFE--INKLKDQ---------EKILIIKNNKYSQFANIEERNEWIQEEINNLNLNLTT- 343

Query: 2227 FFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLN------DHLEENKKLIMQNMTNA 2388
               N  + L +  +D T E  E   NQ +++   ++N      D +E   K + +  T  
Sbjct: 344  -LNNTCKGLEDEEMDLTREFDE--INQKIQDLNTSINESTITIDEIEHEIKDLNEMYTKE 400

Query: 2389 TSAVIDQEMDLFEPRR---AKWENSFDLINKCD-SMNNEFYNNMAATLSQIKKTVDTSSN 2556
                ID+  +L+          E + D IN+ + S+N     +++  +S +K+ V+   N
Sbjct: 401  ----IDKRKELWREENKLDTVLETNLDSINRIERSINENIDYSLSQGISNVKEIVN-KLN 455

Query: 2557 SMNESISVMKGQV----EESENAISLLKNNTKFN 2646
                SI    G++    E+ +  + ++  N+ FN
Sbjct: 456  IPETSIYGTLGELIKVSEKYKRCVEIIAGNSLFN 489

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 77/400 (19%), Positives = 156/400 (39%), Gaps = 61/400 (15%)
 Frame = +1

Query: 1657 VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISG---------------- 1788
            +K+  +SR   ++   ++  +K  I+ +  ++DK +    E+SG                
Sbjct: 611  LKELQRSRNVYKNTMKELAQIKDEISQIDDEIDKINAEIREVSGKRERVMIKNEDGRLKL 670

Query: 1789 ----------------FNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTA 1920
                              NK ++M + + +     K+ EL++NK+F      E+      
Sbjct: 671  NQSKTQLYNLEETMVNVKNKREQMEKNVLLNEAKLKEYELEMNKEFVNGNDGELGDGDDE 730

Query: 1921 L---FLQLDNMQQKNIFQETD---IQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILN 2082
            L    LQL + ++K + Q      +Q  +D +K E+ + +   +++ EL    C  + + 
Sbjct: 731  LRDISLQLKSKEEKMLQQNESLMALQIQMDELKAELESKLIRQRDEVELKILQCDNEGME 790

Query: 2083 ESPKFFNVIVEKID------IIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNH 2244
            E  K  N+  +++D       I  +    YK++ E      +EN  L +        N+ 
Sbjct: 791  EELK--NLQYQEMDETKAMETIENDIDKMYKDLKELKERKGKENEVLNK-------ANSQ 841

Query: 2245 QELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLF 2424
            Q LL   ++   +++EK     +   + TLN      +K+ ++        + +  +  +
Sbjct: 842  QMLLVETLEKYKQDVEK-----IMIKRSTLN-----KRKVEVETQIREVGLISEDALTKY 891

Query: 2425 EPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEES 2604
               ++  E   + +N C+    EF N     L   KK      +   E +     ++EES
Sbjct: 892  TDIQS--EELVEQLNDCNDQMKEFSNVNKRALENFKK-----FHGKREELMGRSHELEES 944

Query: 2605 ENAISLLKNNTK-----------------FNDQFKQLISK 2673
            E +I  L +N K                 F+D F+QL+ +
Sbjct: 945  EESIKELIDNLKEQKVNAVERTFNQVSENFSDIFEQLVPR 984

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 92/470 (19%), Positives = 195/470 (41%), Gaps = 40/470 (8%)
 Frame = +1

Query: 1384 TCSTLEYASKAKNIKNKPQLGAFMM----KDILVKNITMELAKIKSDLLSTKSKEGI--- 1542
            T + +++    K IK +P+    +     K I+VK +   L   K   L+  + +G    
Sbjct: 608  TTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKELGQGLKLAKKHKLNAITLDGDRAD 667

Query: 1543 --------YMSQ------DHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSR 1680
                    Y+ Q      D  KNLN     HK  + E +     L + ++++ +     R
Sbjct: 668  KRGLLTGGYLDQHKRTRLDSLKNLNESRNQHKKLIGELEVVKNELNNVDAIIDQVNGNIR 727

Query: 1681 ETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKREL 1860
                 + S + +++     L  + +++   E  ++    KL++    + +A +     + 
Sbjct: 728  RVSNDRESVLTNIEICRTSLNTKKNEKLILEETLNATVLKLERQKTNLSLAQEKLNTYKN 787

Query: 1861 DLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPN-LDMVKNEVLTLMETMQE 2037
            DL + F++ +S+E K    +L  +++ +  K      D+  + L+ + + + +L   ++ 
Sbjct: 788  DLLQDFDSELSREEKERLESLTKEINILHNK-----LDVTSDALEGITSTIDSLNAELES 842

Query: 2038 KAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF---YKNIAENLSD--------I 2184
            K      D   K+      F   + +++  +++E ++    +++ A  LS         I
Sbjct: 843  KLIPQENDLEAKMAEVGDAFILGLQDELKELQLEMESAEKQHEDAALELSTVQGEIETLI 902

Query: 2185 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 2364
            +EE NN K   K     NN Q LL   +D+  +++EK   +     K TL    EE ++ 
Sbjct: 903  AEETNNKKLLEK----ANNQQRLLLKKLDNFQKSVEKTMIK-----KTTLVSRREELQQR 953

Query: 2365 IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDL-------INKCDSMNNEFYNNMAATLS 2523
            I +       A+I+   D+   +  +  N  +        +NK    N + +N     LS
Sbjct: 954  IREIGLLPEDALINDFSDITSDQLLQKLNDMNTEISGLKNVNKRAFENFKKFNEKRKDLS 1013

Query: 2524 QIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISK 2673
            +    +D S NS+ + I  +K Q   + ++ +  K +  F   F++L+ +
Sbjct: 1014 ERASELDESKNSIQDLIVRLKQQKVSAVDS-TFQKVSENFETVFERLVPR 1062

>Ecym_1108 Chr1 (226176..230072) [3897 bp, 1298 aa] {ON} similar to
            Ashbya gossypii AFR637W
          Length = 1298

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 107/545 (19%), Positives = 211/545 (38%), Gaps = 61/545 (11%)
 Frame = +1

Query: 1426 KNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEV 1605
            K K QL A  ++   ++    +L   K DL   KS    +    +++  N D+++  +E+
Sbjct: 438  KLKEQLDALNVRLTSIEQTESDLKVSKEDLEKYKSLVDTWRQDKNFEQFNKDIKAKNDEM 497

Query: 1606 QECKREIES-------------LASKNSLL---VKDKLKSRETI--------QSQNSQME 1713
               + E+E+             L +K S+L   ++DK K  ++          SQ   ME
Sbjct: 498  LILEHEVENVQNQISKTNQHSDLLAKYSMLKSSIQDKKKELDSSILKIEGDKSSQLLGME 557

Query: 1714 -------SLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNK 1872
                    LK    +L+ Q+    ++  E S    + Q      +  L    K+ LDL +
Sbjct: 558  VTDDFELDLKKNYINLQKQIASSSRSNREASAKCTEFQIELRSAEKELNQLNKKVLDLRE 617

Query: 1873 KFETHISKE---------IKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN------- 2004
            K    + ++         +   + +  + L+N++      E +++  L++ +N       
Sbjct: 618  KLANELPEDCSIDEYDEVLLESEESYRVSLENLKMHRTTLEFNLKA-LEIAENDHCCYLC 676

Query: 2005 --------EVLTLMETMQEKAELMYKD-CVKKILNESPKFFNVIVEKIDIIRIEFQNFYK 2157
                    E   L+E +  K +  ++   +K++ ++   +F++   + DII +       
Sbjct: 677  QRKFQNDVEKANLLEELHSKTKSDFEQTLIKEVQDQKEYYFSLRKLEKDIIALR------ 730

Query: 2158 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHI-DSTYENIEKKTNQFVENFKMTL 2334
               E  S +     N+ Q+   H     H   LN  + DS +  +++  + F    K  +
Sbjct: 731  ---EVESKVKLAQENVSQWKVVH-----HNSKLNMELADSEHNRLKEAQDHFERTLKPIV 782

Query: 2335 NDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAA 2514
            ND +   K+L   N + A  + I++E+ ++    ++  N    I++           +  
Sbjct: 783  NDVIRLRKEL---NQSEADCSRIEEELSIY----SEHSNGVQTIDEFQLKQKNINGRLRL 835

Query: 2515 TLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNT-KFNDQFKQLISKHIILKD 2691
               +I K  +   NS             E  N ++L++  T K N   K+L  K  I KD
Sbjct: 836  LRKEIGKLQEEKENSST-----------EYNNLLNLVREKTFKVNYIEKKLEEKRHIQKD 884

Query: 2692 NIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKD--EMIDNILKEIPNLSKRL-P 2862
                                  I+DI + +GN ++   +  ++ID +  EI  L K L  
Sbjct: 885  ----------------------IDDIASKYGNVDSVVLEIQKIIDGLNSEIGVLEKSLEE 922

Query: 2863 LRISN 2877
            +RI N
Sbjct: 923  VRIEN 927

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 60/293 (20%), Positives = 119/293 (40%), Gaps = 19/293 (6%)
 Frame = +1

Query: 1375 SEETCSTLE-----YASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEG 1539
            SE  CS +E     Y+  +  ++    +  F +K    KNI   L  ++ ++   K +E 
Sbjct: 795  SEADCSRIEEELSIYSEHSNGVQT---IDEFQLKQ---KNINGRLRLLRKEI--GKLQEE 846

Query: 1540 IYMSQDHYKNLNS----------DLESHKNEVQECKREIESLASKNSLLVKDKLKSRETI 1689
               S   Y NL +           +E    E +  +++I+ +ASK   +    L+ ++ I
Sbjct: 847  KENSSTEYNNLLNLVREKTFKVNYIEKKLEEKRHIQKDIDDIASKYGNVDSVVLEIQKII 906

Query: 1690 QSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLN 1869
               NS++  L+ ++  ++ +              N KL++         QD    EL  N
Sbjct: 907  DGLNSEIGVLEKSLEEVRIE--------------NRKLEQQ--------QDLNLTELKSN 944

Query: 1870 KKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAEL 2049
                  I +EIK+       ++D +++       D++ +L     E+ TL   + E  + 
Sbjct: 945  FGVFNSIVEEIKA------FEIDGIKKLE-----DVESSLQDCNEEIDTLSHKVNELNQ- 992

Query: 2050 MYKDCVKKILNESPKFFNVIVE----KIDIIRIEFQNFYKNIAENLSDISEEN 2196
                   KI++ES K  +   E    K++I  I+ +     I E++ ++  +N
Sbjct: 993  -------KIISESQKLKDSTSEQKNMKLNIDLIDLKGRLAQIGEHILNLDSQN 1038

>Suva_16.53 Chr16 complement(80323..81798) [1476 bp, 491 aa] {ON}
            YPL253C (REAL)
          Length = 491

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 69/304 (22%), Positives = 123/304 (40%), Gaps = 6/304 (1%)
 Frame = +1

Query: 1489 ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDK 1668
            +L+K K +L   KSK   Y+ Q   K L   L S  NE     ++ +S  S   + +   
Sbjct: 113  DLSKFKFELYKKKSKHAKYLKQ--IKELTQILNSKDNERDSLIKKNKSDLSSLQIDLDHN 170

Query: 1669 LKS-RETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDY 1845
            L S R+  +    Q  +L      +    +  H+   EIS     LQ++ E  +      
Sbjct: 171  LSSKRQEFRESYDQKLTLWENELQVMENFEPDHEITKEISHLKRVLQELDENWE----SL 226

Query: 1846 KKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKN--IFQETDIQPNLDMVKNEVLTL 2019
            +K+ L+     E  + KE  + K A    +DN+  KN  +  +  I  +     NE +T 
Sbjct: 227  QKQNLERQANHELQLKKEFDAFKEAKLKSIDNLTNKNLELLSQVTILQSQTTKLNEEITQ 286

Query: 2020 METMQEKAELMYKDCVKKILN---ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISE 2190
            ++T  + ++  +    K + +   E+    N  +E      +E +N  + + ENL +I+ 
Sbjct: 287  IDTQTQDSQHQFSQINKSLAHLEAENNPLLNQSLEN----SLELENLQQQM-ENLKEIAS 341

Query: 2191 ENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIM 2370
            +    K Y  N  +    +ELL        EN   + N  +  +   +  +L EN     
Sbjct: 342  QQE--KSY--NDTYSTVERELLR---SRKLENSIIELNGTMRCYAYVMEQNLPENLLFDY 394

Query: 2371 QNMT 2382
            +N T
Sbjct: 395  ENGT 398

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 61/307 (19%), Positives = 121/307 (39%), Gaps = 25/307 (8%)
 Frame = +1

Query: 1954 NIFQETDIQPNLDMVKNEVLTL----METMQEKAELMYKDCVK------KILNESPKFFN 2103
            NI +  D++   D ++ +  TL    +E  +E   + ++D  K      K  ++  K+  
Sbjct: 74   NINKIKDLKIRQDKIRTQRHTLRTQLIECEREIKTIKFRDLSKFKFELYKKKSKHAKYLK 133

Query: 2104 VIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYL--KNHFFKNNHQELLN--HHID 2271
             I E   I+  +       I +N SD+S    +L   L  K   F+ ++ + L    +  
Sbjct: 134  QIKELTQILNSKDNERDSLIKKNKSDLSSLQIDLDHNLSSKRQEFRESYDQKLTLWENEL 193

Query: 2272 STYENIEK--KTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKW 2445
               EN E   +  + + + K  L +  E  + L  QN+    +  +  + +    + AK 
Sbjct: 194  QVMENFEPDHEITKEISHLKRVLQELDENWESLQKQNLERQANHELQLKKEFDAFKEAKL 253

Query: 2446 ENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLL 2625
            ++  +L NK    N E  + +    SQ  K        +NE I+ +  Q ++S++  S +
Sbjct: 254  KSIDNLTNK----NLELLSQVTILQSQTTK--------LNEEITQIDTQTQDSQHQFSQI 301

Query: 2626 ---------KNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTN 2778
                     +NN   N   +  +     L+  +E           + +D Y+T+E  +  
Sbjct: 302  NKSLAHLEAENNPLLNQSLENSLELE-NLQQQMENLKEIASQQEKSYNDTYSTVERELLR 360

Query: 2779 HGNKENA 2799
                EN+
Sbjct: 361  SRKLENS 367

>Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {ON}
            YOR216C (REAL)
          Length = 485

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 84/401 (20%), Positives = 174/401 (43%), Gaps = 22/401 (5%)
 Frame = +1

Query: 1525 KSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNS 1704
            K+ + I + ++  K LN +L++ K+E    +   + LA  N +  +D+ K+         
Sbjct: 88   KADDEIKVLKEEIKRLNLELDAKKSEETFNEGPKDELA--NVIKERDEFKT--------- 136

Query: 1705 QMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFET 1884
            Q ++L + I+ +K+  +K  +A           QK  E +Q  L +Y+ + L L KK E 
Sbjct: 137  QYDTLLSKISSMKSIFNKMKEA-----------QKQLEEVQEQLTEYESQNLKLKKKLEA 185

Query: 1885 HISK--EIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYK 2058
              ++  E++S    L  ++++++ +        Q N + V  E  + +E +Q +      
Sbjct: 186  TKTENSELQSAIVTLNKEIEHLENE--------QENAEDVFLEYESSVEALQGEKH---- 233

Query: 2059 DCVKKILNESPKFFNVIVEKIDIIRIEFQNFY---KNIAENLSDISEENNNLKQYLKNHF 2229
                 I+    K  N   ++ D + ++ Q      +N  +++SD+  E + LKQ L++H 
Sbjct: 234  ----DIIEAHNKELNTYRKEKDQLSVQIQELMIILENNKQDISDLRTERDELKQALESHE 289

Query: 2230 FKN-------NHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNA 2388
             +        N  EL     DS  +   ++ +  V+  +  L+  LE +   I Q + N 
Sbjct: 290  SEKAVLQNSVNDLELKIEETDSKRQEEGREKDLEVKALRSQLDTELEAHNNDI-QILENL 348

Query: 2389 TSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNE---FYNNMAATLSQIKKTVDTS--- 2550
               + D   D+    + + E S   I +   + +E      ++   L+ +KK+ D+    
Sbjct: 349  KKQIEDMREDVSMKEKYE-EESKQHILQIGKLRHEAIILNEHLTKALAMLKKSSDSESVD 407

Query: 2551 ----SNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQ 2661
                SN +   +S+++    + E  + LL N   +++  KQ
Sbjct: 408  KELISNLLISFVSILRADPRKFE-VLELLSNFLNWDEDKKQ 447

>KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some
            similarities with uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 768

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 101/456 (22%), Positives = 186/456 (40%), Gaps = 6/456 (1%)
 Frame = +1

Query: 1222 LLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 1401
            LLT  +   A +  +  I   E +  R +   +G +   A     S    ++E     L+
Sbjct: 288  LLTSTKADLAKLKETIKIKDEELESVRDMLKDVGNDLVAAQDQLKSKNDASAEVNNLKLQ 347

Query: 1402 YASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEG--IYMSQDHYKNLN 1575
              S   N  N   L ++ +K   + N    L K +S L  T +++   I   ++  K  +
Sbjct: 348  LESLRSN--NADNLKSYELKQNELNNEIASLKKNESSLRQTVAQKEKIIDYLENQVKEYS 405

Query: 1576 SDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLD 1755
            S    +KNE++  K+E  +   +   L K+  K +   Q  N  +ES      ++K    
Sbjct: 406  SKESEYKNEIELQKKENSAFVKRIENLNKETAKWKNESQKNNGNLES------YIKE--- 456

Query: 1756 KQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQL 1935
                        N KL +  EV+Q  L+  +  + + N + ET I K+ + L      +L
Sbjct: 457  ------------NGKLSERLEVLQEKLETLQNLKSNSNDQVET-IRKQCEELS----FKL 499

Query: 1936 DNMQQKNIFQETDIQPNLDMV--KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVI 2109
             +  +K +  E ++  N +++  +N   T M  M  + +    + VK++  ES   F   
Sbjct: 500  KDANKKILSLEDELNENANILQERNRETTTMRKMLNELQTDKSNRVKEL--ESRLHF--A 555

Query: 2110 VEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENI 2289
            VE+   I  E Q      +++L  + ++N  L+          NH +L+   I+     I
Sbjct: 556  VEEKSKIENELQMELTRKSQDLKQLKQKNTQLQSV--------NHDQLIK--IEQYSAEI 605

Query: 2290 EKKTNQFVENFKMTLNDHLEENKKL--IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDL 2463
            E+  + F E  K + N   E+  +L  I++++  A      ++ ++        E + DL
Sbjct: 606  EELKSTF-ERMKRSNNVSQEDTSELDSIVKSLKEALVKSEKKQREIMNTNVELKELNNDL 664

Query: 2464 INKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNES 2571
              K D ++   Y N++    QI KT D    S   S
Sbjct: 665  NKKFDRLSKN-YKNLSL---QISKTKDLEPKSARSS 696

 Score = 35.8 bits (81), Expect = 0.72
 Identities = 102/534 (19%), Positives = 211/534 (39%), Gaps = 45/534 (8%)
 Frame = +1

Query: 1474 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES--HKNEVQECKREIESLASKN 1647
            KN+T ELAK  ++ L+  + + +  +   Y +L SD++    K +  E K  +   A KN
Sbjct: 10   KNLTDELAKGLNEELNGINPDQLDKTGP-YADLPSDVQVKLRKFDKYEQKYPLLLQAYKN 68

Query: 1648 SLLVKDKLKSRETIQSQN------SQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 1809
              L  +K++  + + S+       S ++SLK+  + +  + D  +     ++  N +L +
Sbjct: 69   EKLKTEKVEQFQKVLSECTPVSDISDVDSLKSYFSTVNQKTDMLNNEVKRLTLENTQLSQ 128

Query: 1810 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFL--QLDNMQQKNIFQETDIQP 1983
              E +     +  K ELD +     ++ KE+ SLK  +    QL +  +  I + T    
Sbjct: 129  ELEKVDTHELEQVKGELDKSTTSVENLEKEVVSLKQEISTKDQLIDSFKNKIEELTSTPS 188

Query: 1984 NLDMVKNEVLTLMETMQEKAELMYKDCVK-KILNESPKFFNVIVEKIDIIRIEFQNFYKN 2160
            ++D   +   +  ET +  A    +     K  N+  K             ++  N    
Sbjct: 189  SVD--SSSATSAQETTENTASSTAQPTASGKKKNQKKKKGKANNNN----NLQNNNANAG 242

Query: 2161 IAEN--LSDISEENNNLKQY------------LKNHFFK-NNHQELLNH------HIDST 2277
             AE    +  +E N   K              L+  + K N   ELL         +  T
Sbjct: 243  AAETAAAAPATEPNQKAKDITEAITLRVKLDTLQADYDKLNKEYELLTSTKADLAKLKET 302

Query: 2278 YENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSF 2457
             +  +++     +  K   ND +    +L  +N  +A    +  +++      A    S+
Sbjct: 303  IKIKDEELESVRDMLKDVGNDLVAAQDQLKSKNDASAEVNNLKLQLESLRSNNADNLKSY 362

Query: 2458 DLINKCDSMNNEF------YNNMAATLSQIKKTVDTSSNSMNE---SISVMKGQVE---- 2598
            +L  K + +NNE        +++  T++Q +K +D   N + E     S  K ++E    
Sbjct: 363  EL--KQNELNNEIASLKKNESSLRQTVAQKEKIIDYLENQVKEYSSKESEYKNEIELQKK 420

Query: 2599 ESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTN 2778
            E+   +  ++N  K   ++K    K+     N+E            ++ +   +E +   
Sbjct: 421  ENSAFVKRIENLNKETAKWKNESQKN---NGNLESYIKENGKLSERLEVLQEKLETLQNL 477

Query: 2779 HGNKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDEN 2940
              N      ++ ++ I K+   LS    L+ +N    S++D ++   + +++ N
Sbjct: 478  KSN-----SNDQVETIRKQCEELS--FKLKDANKKILSLEDELNENANILQERN 524

>YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}
            ZIP1Transverse filament protein of the synaptonemal
            complex; required for normal levels of meiotic
            recombination and pairing between homologous chromosome
            during meiosis; potential Cdc28p substrate
          Length = 875

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 84/456 (18%), Positives = 189/456 (41%), Gaps = 25/456 (5%)
 Frame = +1

Query: 1567 NLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKA 1746
            NL  +L+  + +  + K  ++S AS +  + +   K +  +++   ++ +L +  N+ + 
Sbjct: 193  NLKQELQKQQQDNAKLKVRLQSYASNSDKINEKVGKYKSCLETLQERIATLTSHKNNQET 252

Query: 1747 QL-DKQHKAEL---EISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLK 1914
            +L D +   +L    ISGF   ++ + + +    ++ K+ + +L KK      KEI+ LK
Sbjct: 253  KLKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADAELMKK-----GKEIEYLK 307

Query: 1915 TALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPK 2094
              L              +   Q + + +KN   +L++ M +  E M K  ++   +E   
Sbjct: 308  REL-------------DDCSGQLSEEKIKNS--SLIQEMGKNREEMIKS-IENFFSEDKA 351

Query: 2095 F----FNVIVEKI-DIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN 2259
                 FN   E++ D+   + Q  + ++A++  ++   N  ++         +N + +L 
Sbjct: 352  HHLLQFNKFEERVHDLFEKKLQKHF-DVAKDTLNVGLRNTTVE-------LSSNTETMLK 403

Query: 2260 HHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIM-------QNMTNATSAVIDQ--- 2409
               +   EN+E+K +   +    T+N+     K LIM        +  N  +A++ +   
Sbjct: 404  QQYEDIKENLEQKMSSSKDEMAKTINELSVTQKGLIMGVQEELLTSSGNIQTALVSEMNN 463

Query: 2410 -EMDLFEPRRAKWENSFDLIN-----KCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNES 2571
               +L +      +N   L N     K + + +  Y      L   + T+ +  N +  S
Sbjct: 464  TRQELLDDASQTAKNYASLENLVKAYKAEIVQSNEYEERIKHLESERSTLSSQKNQIISS 523

Query: 2572 ISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIY 2751
            +   + Q E+      L+K     N +  Q+  K   L +  E            ++ + 
Sbjct: 524  LGTKEAQYED------LVKKLEAKNIEISQISGKEQSLTEKNENLSNELKKVQDQLEKLN 577

Query: 2752 NTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRL 2859
            N      +N+ NK  ++++E++  ++ E   L +R+
Sbjct: 578  NLNITTKSNYENK-ISSQNEIVKALVSENDTLKQRI 612

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 111/483 (22%), Positives = 202/483 (41%), Gaps = 38/483 (7%)
 Frame = +1

Query: 1015 KHRQVASTKMNDFSSRSHTIF----TITLYKKHQDELFRISKMNLVDLAGSENINRSGAL 1182
            KH  VA   +N    R+ T+     T T+ K+  +++    K NL     S     +  +
Sbjct: 374  KHFDVAKDTLN-VGLRNTTVELSSNTETMLKQQYEDI----KENLEQKMSSSKDEMAKTI 428

Query: 1183 NQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR-ESKLTRLLQDSLGGNTKTA--LIAT 1353
            N+      S+ Q  L +G V   L+  SG+I     S++    Q+ L   ++TA    + 
Sbjct: 429  NEL-----SVTQKGLIMG-VQEELLTSSGNIQTALVSEMNNTRQELLDDASQTAKNYASL 482

Query: 1354 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSK 1533
             +  K    E   + EY  + K+++++    +     I+    T E      DL+     
Sbjct: 483  ENLVKAYKAEIVQSNEYEERIKHLESERSTLSSQKNQIISSLGTKEAQY--EDLVKKLEA 540

Query: 1534 EGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQN---- 1701
            + I +SQ   K   S  E ++N   E K+  + L   N+L +  K      I SQN    
Sbjct: 541  KNIEISQISGKE-QSLTEKNENLSNELKKVQDQLEKLNNLNITTKSNYENKISSQNEIVK 599

Query: 1702 ---SQMESLKATINHL---KAQLDKQHKAELEISGFNN-KLQKM-TEVMQVALQDYKKRE 1857
               S+ ++LK  I  L   K    K H  +LE    NN +LQK+  EV+Q+   + +  E
Sbjct: 600  ALVSENDTLKQRIQQLVEIKENEQKDHTTKLEAFQKNNEQLQKLNVEVVQLKAHELELEE 659

Query: 1858 LDLN-----KKFETHISKEIKSLKT--ALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLT 2016
             + +     +K ET + + +  +KT     + L + +Q    ++ ++Q NL+ ++     
Sbjct: 660  QNRHLKNCLEKKETGVEESLSDVKTLKQQVIVLKSEKQDITAEKLELQDNLESLEEVTKN 719

Query: 2017 LMETMQ-EKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF-YKNIAENLSDISE 2190
            L + +Q +K EL  K                 +++++ I+   +N   K   +N +  S+
Sbjct: 720  LQQKVQSQKRELEQK-----------------IKELEEIKNHKRNEPSKKGTQNFTKPSD 762

Query: 2191 ENNNLKQYLKNHFFKNNHQELLN--------HHIDSTYENIEKKTNQFVENFKM--TLND 2340
                 K    ++ F NN   + +         HI  +  N  K+T++F + F +  + ND
Sbjct: 763  SPK--KNATTSNLFPNNSAAIHSPMKKCPKVDHISKSRINSSKETSKFNDEFDLSSSSND 820

Query: 2341 HLE 2349
             LE
Sbjct: 821  DLE 823

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 95/456 (20%), Positives = 187/456 (41%), Gaps = 10/456 (2%)
 Frame = +1

Query: 1318 LGGNTKTALIATISPAKVTSEETCSTL-EYASKAKNIKNKPQLGAFM--MKDILVKNITM 1488
            L  NT+T L       K   E+  S+  +  +K  N  +  Q G  M   +++L  +  +
Sbjct: 394  LSSNTETMLKQQYEDIKENLEQKMSSSKDEMAKTINELSVTQKGLIMGVQEELLTSSGNI 453

Query: 1489 ELAKIKSDLLSTKSK--EGIYMSQDHYKNLNSDLESHKNEV---QECKREIESLASKNSL 1653
            + A + S++ +T+ +  +    +  +Y +L + ++++K E+    E +  I+ L S+ S 
Sbjct: 454  QTALV-SEMNNTRQELLDDASQTAKNYASLENLVKAYKAEIVQSNEYEERIKHLESERST 512

Query: 1654 LVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVA 1833
            L   K +   ++ ++ +Q E L   +     ++ +    E  ++  N  L    + +Q  
Sbjct: 513  LSSQKNQIISSLGTKEAQYEDLVKKLEAKNIEISQISGKEQSLTEKNENLSNELKKVQDQ 572

Query: 1834 LQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVL 2013
            L+      +     +E  IS + + +K AL  + D ++Q+ I Q  +I+ N    + +  
Sbjct: 573  LEKLNNLNITTKSNYENKISSQNEIVK-ALVSENDTLKQR-IQQLVEIKEN---EQKDHT 627

Query: 2014 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFY-KNIAENLSDISE 2190
            T +E  Q+  E + K  V+           V+  K   + +E QN + KN  E      E
Sbjct: 628  TKLEAFQKNNEQLQKLNVE-----------VVQLKAHELELEEQNRHLKNCLEKKETGVE 676

Query: 2191 ENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTN-QFVENFKMTLNDHLEENKKLI 2367
            E+ +  + LK          L +   D T E +E + N + +E     L   ++  K+ +
Sbjct: 677  ESLSDVKTLKQQVIV-----LKSEKQDITAEKLELQDNLESLEEVTKNLQQKVQSQKREL 731

Query: 2368 MQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDT 2547
             Q +         +  +  +     +    D   K  + +N F NN AA  S +KK    
Sbjct: 732  EQKIKELEEIKNHKRNEPSKKGTQNFTKPSDSPKKNATTSNLFPNNSAAIHSPMKKCPKV 791

Query: 2548 SSNSMNESISVMKGQVEESENAISLLKNNTKFNDQF 2655
                      + K ++  S       K  +KFND+F
Sbjct: 792  DH--------ISKSRINSS-------KETSKFNDEF 812

>NCAS0F03220 Chr6 (653886..656774) [2889 bp, 962 aa] {ON} Anc_5.414
            YDR356W
          Length = 962

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 105/557 (18%), Positives = 235/557 (42%), Gaps = 42/557 (7%)
 Frame = +1

Query: 1156 ENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQD-SLGGNT 1332
            E  +   ++ +R      +N++ L L R+ + L   +     +E +  +LL+      NT
Sbjct: 207  EEESHESSIQEREALREELNETKLELKRIHDHLETLTKERSEKEVEWNQLLRGYESEKNT 266

Query: 1333 KTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAF--MMKDILVKNITMELAKIK 1506
              + +  +    +T E T + L+   +  ++ ++  +G    +  D  + ++ ++  + +
Sbjct: 267  MHSEMDKLQSLLITKETTLNELK--KQIDSLLSELNVGGETKLAYDDKISSLRIDTERQE 324

Query: 1507 SDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRET 1686
             ++   K+K         ++ LN+DLE     + +  R+IE    ++   + +KL SRE 
Sbjct: 325  KEIKELKNK------CSEWEKLNTDLEMKSKNLNDDLRDIEMQLEQSKKEMHEKLSSRER 378

Query: 1687 IQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKK----- 1851
             Q QN   ++L+  IN  K Q+        ++S   + + ++ +  + +L +Y+K     
Sbjct: 379  -QFQNEHDDNLE-LINLQKKQIIDLETKLTKLSEDASNVDELEKTTKESLNEYRKKYEEE 436

Query: 1852 --RELDLNKKFETHISKEIK--SLKTAL-FLQLDNMQQKNIFQETDIQPNLDMVK----- 2001
              +  DL  + +   ++E K  + KT    +Q DN+  ++  +  ++  N D+ K     
Sbjct: 437  RSKNRDLTNRLDLMEAREAKGSNWKTQYEHIQKDNLDLQSSLKTLNVL-NTDLTKKLRDL 495

Query: 2002 ----NEVLTLMETMQEKAELMYKDCVKKILN---ESPKFFNVIVEKIDII----RIEFQN 2148
                NE+  + + + E+   +  D V  + N   ES      + E++D I    + E   
Sbjct: 496  SKRLNELEIVNDRLTEERNKL-SDTVTSLNNKSEESELQITKLEEELDSIKNDHKEEILK 554

Query: 2149 FYKNIAENLSDISEENNNLKQYLKNHF--FKNNHQELLNHH-IDSTYENIEKKTNQFVEN 2319
            F + + +  S++++  N +K   K  F   KN+ +   +   +   Y+ I KK    +++
Sbjct: 555  FNEQLEQKTSELTKATNQIKTLQKQLFDNIKNSTESKTSEDALQKRYKQI-KKLQTELDD 613

Query: 2320 FKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEP-RRAKWENSF---------DLIN 2469
              + L    E ++K++   +    +    Q  DL +  R  K E SF         + +N
Sbjct: 614  VTLKLQLEEENHRKILNSKIRELDNKYSTQTEDLNDQVRLLKKERSFLQAELQKGKEELN 673

Query: 2470 KCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFND 2649
               +   +  N+     + +     +  N  N S   ++ Q+      +  L+ N     
Sbjct: 674  ALKATQGKEVNDWIKKYNALNAENSSLLNEQNSSTRSLRNQL------LGSLEENKDLLG 727

Query: 2650 QFKQLISKHIILKDNIE 2700
            + + L S+ + L+D +E
Sbjct: 728  RIEILQSEKLSLQDQVE 744

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1080

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 66/324 (20%), Positives = 145/324 (44%), Gaps = 9/324 (2%)
 Frame = +1

Query: 1489 ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDK 1668
            ++  ++S++  TK      +SQD    +N++++S K +  +C R +E+L+S      K+ 
Sbjct: 620  QIFTVESNISPTKFYRSNIISQDVKDKVNAEIDSLKQKKSQCLRRLETLSSN-----KND 674

Query: 1669 LKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYK 1848
            LK R +      ++++L+     L  Q  K    +  I     +L+   +    A +D  
Sbjct: 675  LKERRS--DLRRELDTLRDKAYRLNEQRKKHSMTKSNIESLQQRLETYKD---EARKDVS 729

Query: 1849 KRELDLNKKFETHISKEIKSL-------KTALFLQLDNMQQK-NIFQETDIQPNLDMVKN 2004
            ++  D+  K    +  + K L       K+   ++ D M+ K  +F++ ++Q +L    N
Sbjct: 730  QKVKDVEGKISEQLISQAKLLTDMTNVMKSVNSVERDVMEMKIKVFEQQNLQTSL----N 785

Query: 2005 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 2184
            EV+ +      + EL  +   KK + +  K  N   + +D IR   ++  + + E     
Sbjct: 786  EVVGIFN--NREVELQEEYNTKKEIIKRMKNTNEFKDWMDQIRTYGEDDREALNELAESY 843

Query: 2185 SEENNNLKQYLKNHFFK-NNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 2361
               +     Y+K++  K  +   ++NH  D++   I K+    + + + TL   ++E K+
Sbjct: 844  ERGDKFNSSYIKDYIEKLESELSMMNH--DTSSVTILKQVESELNHLRETLPTQVKELKE 901

Query: 2362 LIMQNMTNATSAVIDQEMDLFEPR 2433
            + ++         + ++ DL EP+
Sbjct: 902  IKLE---------MRKKHDLLEPQ 916

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 79/354 (22%), Positives = 144/354 (40%), Gaps = 37/354 (10%)
 Frame = +1

Query: 1390 STLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLL--STKSKEGI----YMS 1551
            S LE     K ++ K  + +   +D+ +KN  ++  + K D L  S KS E       + 
Sbjct: 192  SLLETLEDLKQLQTKEIVSS---QDVELKNKKLKELEDKKDKLEVSVKSLEDFENKKIVL 248

Query: 1552 QDHYKNLNSD-LESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKAT 1728
              H K L    ++ HK +++  K + E   +    L+KDK   +    SQ S  E+L+ T
Sbjct: 249  DKHNKLLPYVYIKEHKEKLKAYKNDYEIAKNNLKSLIKDK---KPFHSSQVSVHETLEET 305

Query: 1729 INHLKAQLDKQHKAELEISGFNNKLQKM---TEVMQVALQDYKKRELDL------NKKFE 1881
             N          K  L+IS  N  +Q++   TE + +  +D  K+   +      N+K +
Sbjct: 306  KN----------KHTLKISERNELVQRLNQTTEKLNLVREDILKKNSQIDYYKNRNEKIK 355

Query: 1882 THI---SKEIKSLKTALF---------LQLDNMQQKNIFQE--------TDIQPNLDMVK 2001
              I    +EI++ +  L          ++  + QQ  + +E        TDI    + V 
Sbjct: 356  NSIKLTEQEIETNQNVLSQIQLPDPKDIEQISSQQNTLIEEEGRIHTSITDIDNTANTVN 415

Query: 2002 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAE-NLS 2178
             E+  +    ++K  L+  +    IL+    F +V    + I   E ++    I E  + 
Sbjct: 416  YEITHIARQAEQKQRLLTGNDRIGILDSRGDFKDVKNAILFIRTHEDEDLKSKILEPPIM 475

Query: 2179 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND 2340
             I+ ++     YL       N  + L      T+ N     +Q ++NFK+ L +
Sbjct: 476  SIATKDPGFAPYLA-QCIDYNTSKALTIVDQQTFNNY---GDQILKNFKVNLRE 525

>ABL193C Chr2 complement(44011..46599) [2589 bp, 862 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL225C (CNM67) and
            YDL239C (ADY3)
          Length = 862

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 110/607 (18%), Positives = 248/607 (40%), Gaps = 46/607 (7%)
 Frame = +1

Query: 1183 NQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1362
            N++ K+ G I+Q   TL      L +    +   ESK   ++   L          T+  
Sbjct: 212  NRQLKKDGEISQLNRTLNDKDMQLAELKKQL---ESKTGEVISQELKAANAHQRAKTLEN 268

Query: 1363 AKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGI 1542
                 +     LE A +   ++ + +    + KD+    +  +  K+++ L S ++   +
Sbjct: 269  ELEQQKNKVRVLEKAMETTAMEVEAERTR-LNKDLEQVTLEYKKYKVETGLRSNETSNTL 327

Query: 1543 YMSQDHYKNLNSDLESHKNEVQECKREI----------ESLASKNSLLVKDKLKSRETI- 1689
               +   K L  DLE   NEV E +  I          ++L +   +LV +    + T+ 
Sbjct: 328  QQIKGKNKILKDDLEKKTNEVNELRDNISTKEKEVSNLKNLLADLKVLVNELRADKSTVD 387

Query: 1690 ---QSQNSQMESLKATINHLKAQLDK-QHKAELEISGFNNKLQKMTEVMQVALQDYKKRE 1857
                 Q  ++E+  + +N L+ + D+ +++ + EI+     ++   +  QV L++ + + 
Sbjct: 388  VQLDIQKKELEAASSKLNSLRVEFDQLKNEKDTEINTLKADIENNWKKKQVRLEEVEAKC 447

Query: 1858 LD----LNKKFETH--ISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTL 2019
             D    L K +ET+  +S ++K   T +    D +++  + +++           + L  
Sbjct: 448  NDLTALLQKSYETNKELSVQLKRKDTEIGKINDQLKRTTVEKDS---------LRDFLEK 498

Query: 2020 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEF---QNFYKNIAENLSDISE 2190
             +  +     +  D  KK    +  +  ++ EK +I+            N+ + +  +  
Sbjct: 499  AKWFEIPVGTILLDLFKKQRRPANGYKTILSEKYEIVGFRLTSDDELLNNLRQKVGSLEN 558

Query: 2191 ENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKM-----TLNDHLEEN 2355
             NN L++ L++     N QE+      S   +I K +        M     ++ D L+++
Sbjct: 559  SNNLLQEELESKI--KNTQEMFGSQEASMKNDIIKLSEDLKARSAMIDKLQSVIDSLQKD 616

Query: 2356 KKLIMQNMTNATSAVID--QEMDLFEPRRAKWENS--FDLINKCDSM---NNEFYNNMAA 2514
               +++    + +  I+  Q +   +  + + +N+   +L  K   +   N+E    M  
Sbjct: 617  AAALLKEKDESVNKNIELSQHIAQLQEDQLQRDNTTFLELCQKNQEILQYNHEMMEKMHV 676

Query: 2515 TLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDN 2694
              ++++  V  +SN +  SIS  +  ++E +  I+ L+ N    +Q ++ + K   LK N
Sbjct: 677  MEAELRSVV-KASNDLQFSISEKEAVLKEKQQIITDLQMNI---NQLRKNLEK---LKGN 729

Query: 2695 IEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMID--NILKEI--------PN 2844
                         +   IY+ ++  M N    +   + ++++  N++K I          
Sbjct: 730  -----PADMISFESAQRIYHNLDRKMYNTLMVDQVNQLDLVELQNVVKNIILLLETPFSK 784

Query: 2845 LSKRLPL 2865
            LSK++PL
Sbjct: 785  LSKKMPL 791

>Ecym_8231 Chr8 complement(471639..477203) [5565 bp, 1854 aa] {ON}
            similar to Ashbya gossypii ACR068W
          Length = 1854

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 98/462 (21%), Positives = 188/462 (40%), Gaps = 61/462 (13%)
 Frame = +1

Query: 1489 ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDK 1668
            + ++++ DLLST+ ++ +         L S ++ H+N+ + C  ++ +  ++   LV   
Sbjct: 1384 QCSQLEQDLLSTEKQKQL---------LQSSVKHHQNQYENCINDLHATEAQMRDLVHSL 1434

Query: 1669 LKSRETIQ----------SQNSQME----SLKATINHLKAQLDKQHKAELEISGFNNKLQ 1806
             +S E IQ          SQN Q E     L+  + HL+ QL +++    +++  N  L 
Sbjct: 1435 KQSEEDIQTMTDLIQKLRSQNKQKEVLIWDLEKALGHLEGQLGERNIELQKLNSLNQVLS 1494

Query: 1807 ----------KMTEVMQVALQDYK--KRELDLNKKFETHISKEIKSL-------KTALFL 1929
                      K+TE     L +    K ELD + + ET + KEI +L       +     
Sbjct: 1495 DDLNHFKDRIKVTEDNSKYLAEIGRLKTELDASLRTETELKKEISNLTYHRNAFQADSES 1554

Query: 1930 QLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELM------YKDCVKKILNESP 2091
            ++ N+ Q+N   E  +Q +L   K+    +   +Q K + +        D +  +  E  
Sbjct: 1555 KIVNLVQQNSHYEKFLQ-DLGAQKDASEQVQNALQAKVKSLGLKVDRLNDDLNVLTQEKE 1613

Query: 2092 KF---FNVIVEKIDIIRIEFQ---NFYKNIAENLSDISEE-NNNLKQYLKNHFFKNNHQE 2250
            K     N +  K+    ++F+   N   NI   L  + E      +Q  +N  F    QE
Sbjct: 1614 KLEQERNYLKAKLQDSNVDFEKSVNDRDNIFNELEFLRESLALQQQQTERNEAFVEKLQE 1673

Query: 2251 LLNHHIDSTYENIEKKTNQFVEN-----FKMTLNDHLEENKKLIMQNMTNATSAVIDQEM 2415
             +    D+  +  EK    F EN       + L  H+E+ +  +    T+  +A +D+  
Sbjct: 1674 EIQLAKDAFTQEKEKNIELFEENQSLGKSNLQLRQHVEKLEHDLSD--TSEKNAWVDRIH 1731

Query: 2416 DLFEPRRAKWENSFDLINKCDSMNN--EFYNNMAATLSQIKKTVDTSSNSMNESISVMKG 2589
            +L    + + E  F+ + K  ++    E  N+ A   ++          S+ + +  + G
Sbjct: 1732 ELESKLKEESELKFEEMKKSQTLYRTLEELNSAADNQNKAISIAAKDRESVEKQLFEVGG 1791

Query: 2590 QVEESENAI--------SLLKNNTKFNDQFKQLISKHIILKD 2691
            +VE  E  I         L K N  + D+  +L  +  + K+
Sbjct: 1792 RVEGMEKHILQQDATIKRLEKENIYYKDRVAELEQETYLWKE 1833

>TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa] {ON}
            Anc_8.636 YOR216C
          Length = 476

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 85/393 (21%), Positives = 161/393 (40%), Gaps = 24/393 (6%)
 Frame = +1

Query: 1594 KNEVQECKREIESLASKNSLLVKD----KLKSRETIQSQNSQMESLKATINHLKAQLDKQ 1761
            KN+ +  K++  S  +  S    D      +  + ++ QN Q       + +L   +DKQ
Sbjct: 3    KNKKKGAKKQQNSATAAPSSQAADINEQPHEKEQPVELQNDQQ------LENLSGDMDKQ 56

Query: 1762 HKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDN 1941
            +    E    NN+  +  E +Q  ++  K  +L++ KK E  + KE+   +T      + 
Sbjct: 57   NGTTAEPLKVNNEANEQIEKLQEEIRTLKS-QLEIQKK-EQEVQKEVPQQETPDV--TET 112

Query: 1942 MQQKNIFQETDIQPN-----LDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNV 2106
               K++  E D   N     L+ + + + T+   M+E  E +  + VK+ L+E       
Sbjct: 113  QAYKDLKSERDEYENQYNNLLNRI-SSMKTVFSKMKESQEEL--ETVKEQLSEYESQNIR 169

Query: 2107 IVEKIDII---RIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDST 2277
            +  K D++   R EF+     + E  S++ EE  NL+   K +                 
Sbjct: 170  LKSKADLLSKERTEFEKTILTLNEEFSNLDEERENLQIECKKY----------------- 212

Query: 2278 YENIEKKTNQFVE---NFKMTLNDHLEENKKLIMQ---------NMTNATSAVIDQEMDL 2421
             E ++K TNQ  E   N    LN H E N +L  Q         N     S + +++ DL
Sbjct: 213  KEELDKLTNQLEEASDNHLRELNIHREANAQLEAQLQELVVTLGNNKQDLSILNEEKKDL 272

Query: 2422 FEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEE 2601
                 +      + I K DS+     N + A L +     +      +  I+ ++ Q+++
Sbjct: 273  ISTLES------NAIEK-DSLQKTI-NELEAELEKATAQFEEEKQQKHMEINALRAQLDK 324

Query: 2602 SENAISLLKNNTKFNDQFKQLISKHIILKDNIE 2700
            SE++ S L    + + +  Q + + + +K  +E
Sbjct: 325  SEDSNSELTKTIEQHKEEIQSMREDVDMKKRLE 357

>KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {ON}
            Anc_4.364 YJR134C
          Length = 616

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 86/416 (20%), Positives = 183/416 (43%), Gaps = 26/416 (6%)
 Frame = +1

Query: 1474 KNITMELAKIKSDL--LSTKSKEG------IYMSQDHYKNLNSDLESHKNEVQECKREIE 1629
            K  T+++ ++K +L  L+  +KEG      +   ++ +KN+ + LES +  ++E    I+
Sbjct: 164  KKNTVKIDQLKKELAALNKINKEGESNFKELTKREEDWKNIETKLESKERTIEELNATIQ 223

Query: 1630 SLASKNSLLVKD-KLKSRETIQSQNSQMESLKATINHLKAQLD-KQHKAELEISGFNN-- 1797
            +L + +     D + K +  I+S N  + SL++++  L+ QL   +  A+ +  G  N  
Sbjct: 224  ALEASSKQEKNDHEEKVKRLIESNNEHIISLESSLEQLRIQLSGSESTADDKEGGAINTE 283

Query: 1798 KLQKMTEVMQVALQDYKKRELDLNKK---FETHISKEIKSLKTALFLQLDNMQQKNIFQE 1968
                + E +  + ++++  E  LN K    ET + ++ K L T L  ++ N++ +N    
Sbjct: 284  SYSLLQEQLTSSKKNWESIEFQLNLKMTNLETSLGEKEK-LITGLNTEIQNLKVENSRLV 342

Query: 1969 TDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQN 2148
            T+I+   +  K   L   ET  + + L      +  LN     +N++  K  I + + +N
Sbjct: 343  TEIEAKKEESKTLRLQFKETSNKTSIL------EMSLNNLKDDYNLLESKYMIQKSQLEN 396

Query: 2149 FYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKM 2328
              K           E+++  + +K HF   +H++      +S+  +IE+K     +N   
Sbjct: 397  NIK-----------EDHSANEIIK-HFENGSHEDWF-LQAESSLLSIEEKPQDERKNTVT 443

Query: 2329 TLNDHLE-------ENKKLIMQNMTNATSAVIDQEMDLF-EPRRAKWENSFDLINKCDSM 2484
              N +L+       +    + Q+  N  S + +    LF +P      NS    N  DS 
Sbjct: 444  DDNSNLQIDINEIPDEAATMTQHAYNDDSFMRNSSASLFRKPSTNIQSNS----NNIDSG 499

Query: 2485 NNEFYNNMAATLSQIK---KTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKF 2643
              +    + A + +++   K++    N+++   S        +E  + L+  N ++
Sbjct: 500  TTQIVTRLGAEIRRLEGELKSIQDRYNNLSHEKS------NANEEILRLMNENGQY 549

>Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON}
            YOR216C (REAL)
          Length = 485

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 92/465 (19%), Positives = 204/465 (43%), Gaps = 29/465 (6%)
 Frame = +1

Query: 1354 ISPAK--VTSE--ETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLS 1521
            I+PAK   T+E  +    LE   KA+  K +        +++    +T ++  ++     
Sbjct: 32   INPAKDNATTETPKAIDALEVLEKAE-AKEEEHSEEINQQEVCADMVTEKVIPLED---- 86

Query: 1522 TKSKEGIYMSQDHYKNLNSDLESHKNEV---QECKREIESLASKNSLLVKDKLKSRETIQ 1692
             K+ E I   ++  + LN +L + K+E    ++ K ++E++       +K++ + +    
Sbjct: 87   RKTDEEIKALKEEIERLNLELNAKKDEEAHNEDAKHQLENV-------IKERDEFKTQYN 139

Query: 1693 SQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNK 1872
            +  S++ S+K+  N +K                    QK  E +Q  L +Y+ + L L K
Sbjct: 140  TLLSKISSMKSIFNKMKES------------------QKQLEEVQEQLTEYESQNLKLKK 181

Query: 1873 KFE-THI-SKEIKSLKTALFLQLDNMQQKNIFQET---DIQPNLDMVKNEVLTLMETMQE 2037
            K E T I + E++S    +  +L+N++++    E    + +  ++ +++E   ++ET  +
Sbjct: 182  KLEATKIENSELQSTIVTINKELENLEKEQESAEDIFLEYESKIEALQDEQRNMIETHSK 241

Query: 2038 KAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYL 2217
            + +   KD  +          +V V+++ II        +N+ ++ SD+ +E ++LKQ L
Sbjct: 242  ELKASRKDKDQ---------LSVQVQELMII-------LENLKQDKSDLKDERDDLKQAL 285

Query: 2218 KNHFFKN-------NHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQN 2376
            + H  +        N  EL    + S  E   ++ +  V+  +  L+  LE +   I   
Sbjct: 286  ELHESEKTALQNSVNDLELKIEELVSKREEESREKDLEVKALRSQLDTELEAHNNDI-TI 344

Query: 2377 MTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNE---FYNNMAATLSQIKKTVDT 2547
            + N    + D + D+    + + E S   + +   + +E      ++   L+ +KK+ D+
Sbjct: 345  LENLKKEIEDMKEDVSMKEKYE-EESKQHVLQIGKLRHEAIILNEHLTKALAMLKKSSDS 403

Query: 2548 S-------SNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQ 2661
                    SN +   +++ +    + E  + LL N   +++  KQ
Sbjct: 404  ESVDKELISNLLISFVAIPRADPRKFE-VLELLSNFLNWDEDKKQ 447

>Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON}
            (76145..79804) [3660 nt, 1220 aa]
          Length = 1219

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 74/339 (21%), Positives = 139/339 (41%), Gaps = 63/339 (18%)
 Frame = +1

Query: 1717 LKATINHLKAQLDKQHKAELE--ISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHI 1890
            L + +N+   +L   +   ++  + G N+    + ++++     Y+  E+++N+KF  + 
Sbjct: 77   LFSLVNNPDNELSSDYLTNIKNLLKGINHPTNNLNQLVKPVNSPYE--EVEINEKFLNYH 134

Query: 1891 SKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVK 2070
            +  I SL T     L  ++    + +  I   LD +KN ++  ++  Q   EL   D V+
Sbjct: 135  T--ITSLITTNLGWLSALEIDMHYFQIQISDTLDYIKN-IIESLKICQNYLELYCYD-VE 190

Query: 2071 KILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDIS--------------------E 2190
             + N + KF N +    +I++  + N+Y NI   LSDI+                    E
Sbjct: 191  NLYNSNVKFLNQLANN-EILK-NWLNYYDNILTKLSDINGNKLSSYLNKNELVSISSKIE 248

Query: 2191 E-----NNNLKQYL----KNHFFKNNHQELLNHHIDSTYENI------------------ 2289
            E     N+NLK++     KN   +NN    +N  I S  E I                  
Sbjct: 249  ELDQRVNSNLKKFKIVIDKNIDLRNN----INKEISSLSEKITPSSEKYKLEETMLEKFT 304

Query: 2290 --------------EKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFE 2427
                          EK  N+F +N+   L   LE++KK+ + N+   + A+  Q  D+ E
Sbjct: 305  ELVKNLRNDSKVILEKDENEFDKNYMQNLAKSLEKDKKVTVTNLLTISKALYSQANDISE 364

Query: 2428 PRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 2544
             +     +S  L  +   +  E  N     L+++ K ++
Sbjct: 365  IKSKLQVDSIKLFGQISFIQIETLNIKKLLLNELNKDLE 403

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 108/591 (18%), Positives = 236/591 (39%), Gaps = 16/591 (2%)
 Frame = +1

Query: 1213 NQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCS 1392
            NQ L+   + + ++ DR      ++S+    + + +  N+K A++ T      T +E   
Sbjct: 723  NQQLVKRSQNLQSIFDR------QDSRTAETVNELIACNSKLAVLETKVANLETEKELLQ 776

Query: 1393 TLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNL 1572
            + E  S+   +K   +  +  +    ++ +  E  K   ++ +T            YK  
Sbjct: 777  SSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTT------------YKE- 823

Query: 1573 NSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQL 1752
              +L+S + E  + +  +++   +   +   K   R  IQ    +++S+ A   HLK +L
Sbjct: 824  --NLDSLEQEKADARARLDAKTKEAEDMENSK---RTQIQWYQDKLDSVVAESQHLKQEL 878

Query: 1753 DKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRE-LDLNKKFETHISKEIKSLKTAL-- 1923
              +     ++     KL+K  E  +  +Q Y+     ++    E+ + KE++  K  L  
Sbjct: 879  QTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSD 938

Query: 1924 -FLQLDNMQQKNIFQETD-----IQPNLDMVKNEVLTLMETMQ-EKAELMYKDCVKKILN 2082
             + ++D  Q KN+   T+     +  +    K E+   +ET+Q EK++L  +D V K LN
Sbjct: 939  TYAEID--QYKNLLSTTEESLSQLTQDYASGKQELQLQVETLQNEKSQL--QDVVAK-LN 993

Query: 2083 ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH 2262
            ES       V K++              E+L D ++   N K  L+        +   +H
Sbjct: 994  ES-------VTKLE--------------ESLQDANKAAENEKNTLQKKIATLETESKGSH 1032

Query: 2263 HIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRA- 2439
             +   Y+    K  + +E  + +  +  + N +  +Q  +N +  + +      + R A 
Sbjct: 1033 QLKEEYDAQILKLQRDLEQ-QASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAI 1091

Query: 2440 -KWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVE--ESEN 2610
             + +NS + + +    N + ++       +  +T       ++   S++  Q+E    +N
Sbjct: 1092 TRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDN 1151

Query: 2611 AISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDI--MTNHG 2784
            +  +     +  +    L  +  IL   +            ++  + N ++      +  
Sbjct: 1152 SDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQF 1211

Query: 2785 NKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDE 2937
             KE  T  E+I    K I  L++   LR SNI   +  +  + K   +++E
Sbjct: 1212 QKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEE 1262

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 58/323 (17%), Positives = 156/323 (48%), Gaps = 18/323 (5%)
 Frame = +1

Query: 1468 LVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESH-KNEVQECKREIESLASK 1644
            +++N  ++  ++KS  L       + ++ D  K ++S  E   KNE++   ++ +S+  +
Sbjct: 47   ILENKVLDFNELKSQNLR------LNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLE 100

Query: 1645 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLD--KQHKAELEISGFNNKLQKMTE 1818
             S   ++  +S    Q   +++ESL+  ++ L  + +  KQ K E+ ++    K++++  
Sbjct: 101  RSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKREV-VAVLEEKIKELE- 158

Query: 1819 VMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ---PNL 1989
                + +   ++ LD +K+    + +++  L+T     + N++ K +  +++IQ     L
Sbjct: 159  ----SFRTESRKSLDDSKR----LRQQVLELETT----VQNLKSKELRDQSEIQTITQRL 206

Query: 1990 DMVKNEVLTLMETMQEKAELMYK------DCVKKILNESPKFFNVI-VEKI--DIIRIEF 2142
             +++     L E +  K E +        D + ++ +ES    N + +EK    +I  + 
Sbjct: 207  TILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKN 266

Query: 2143 QNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENF 2322
            +   K++ E L ++ + +++L +  +    + + ++ L   +++  ++++ + N  ++  
Sbjct: 267  EELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKD 326

Query: 2323 KMTL---NDHLEENKKLIMQNMT 2382
             + L    +   EN+KLI + +T
Sbjct: 327  NVELLASGERNTENEKLIQELIT 349

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 92/436 (21%), Positives = 186/436 (42%), Gaps = 14/436 (3%)
 Frame = +1

Query: 1399 EYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNS 1578
            E  SK  N++N  ++     ++  VKN  +  A+ +++ L T+    I   +    NLN 
Sbjct: 335  ELISKNSNLEN--EITRIKEENDNVKN-EISAARQENENLKTE----ISTLKTDTDNLNG 387

Query: 1579 DLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDK 1758
             ++S KN+  + + EI+ +  +NS       K    +++  ++ + L + +N +K +L +
Sbjct: 388  HIQSIKNDNNKLENEIQLVKKENS-------KLETEVKTSKNETDKLSSQLNQVKNKLIQ 440

Query: 1759 QHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLD 1938
            + K  + +     ++++  E      Q+  K+ +DL K+    +S  I  LK       +
Sbjct: 441  KEKTVIYL---EKQIKEYAE-----NQEPVKQAMDLLKRENKQLSNRIDLLKNENESLNN 492

Query: 1939 NMQQKNIFQETDIQPN------LDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFF 2100
            ++++ +   E  ++ N      +D+++ +  TL       ++ M  D +KK   E     
Sbjct: 493  DLKKNSSTYEDYLKENGKLTERIDILQEKYDTLQNLKNNSSDHM--DSIKKQCEELNVKL 550

Query: 2101 NVIVEKIDIIRIEFQNFYKNIAENLSD-------ISEENNNLKQYLKNHFFKNNHQELLN 2259
                +KI  +  E  ++   I +   +       +SE NN+ K  L     K N     N
Sbjct: 551  REANKKIISLEDELSDYTSIIQDKAREADTMRRLLSESNNDEKNKLDEMETKLNSMIDEN 610

Query: 2260 HHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRA 2439
            +++ S   N++   N+       +LND  +   K +  N     S  I+    L E  + 
Sbjct: 611  NNLKSEL-NLQSSRNKIELQNLQSLNDQSQNEIKSLQLNKLQLLSE-IETLNKLNENFKK 668

Query: 2440 KWENSFDLINKCDSMN-NEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAI 2616
              +N F+     DS N  +  NN+  +LS+ +  + T   S N+ +  +   + +  + I
Sbjct: 669  HKDNDFN-----DSHNLQKTINNLKDSLSRSESKI-TELQSANDELMSLNNDINKKFDRI 722

Query: 2617 SLLKNNTKFNDQFKQL 2664
            S  KN    + QF  L
Sbjct: 723  S--KNYKSLSLQFNTL 736

>SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {ON}
            weakly similar to uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
            component of the FEAR regulatory network which promotes
            Cdc14p release from the nucleolus during anaphase
            potential Cdc28p substrate
          Length = 816

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 83/449 (18%), Positives = 178/449 (39%), Gaps = 41/449 (9%)
 Frame = +1

Query: 1477 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLL 1656
            N T+   K   +L   + ++ I    D  + LN ++     +     +E++S   K + L
Sbjct: 267  NSTLHQLKADFNLELKQYEKDIAQKNDKIRQLNQNIVKLTQDYDSVTQELDSTRIKYTTL 326

Query: 1657 VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQ---KMTEVMQ 1827
              D    + +  + N Q+E  K T++ +K   +K  +   ++   NN+ +   KM     
Sbjct: 327  QADYKVYKVSQNNVNDQLEEQKETLDLMKQDKEKLEERIAKLKSRNNEFKNEVKMLNQNA 386

Query: 1828 VALQDYKKRELDLN----------------------------KKFETHISKEIKSLKTAL 1923
              LQ+  + ++D N                            K +ETH  +  +  K + 
Sbjct: 387  QILQEKFQLQIDENVQLAKLNQQLSESKVQAEEQLRQLNEETKNYETHAMRLQEEAKRSK 446

Query: 1924 FLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN 2103
             L+ +  +++ +++       L+    E   L+E  Q K +   +   K+  +E  +  +
Sbjct: 447  LLEQEFNKKEAVYEAK--FKELEAAVGEKNLLLEEFQSKLKDSQQK-RKESQSELEQQID 503

Query: 2104 VIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYE 2283
             +  + D +R E   F   +     +  E+   LKQY+  +       + LN+ ++   E
Sbjct: 504  ELSRERDGLREELSLFKDGVCRESEEAQEK---LKQYMSENDQLAKDLKQLNYELEELKE 560

Query: 2284 NIEKKTNQFVE-NFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAK------ 2442
            N E+   Q  +   ++ L     E K   +   T     +   +M L E  +A+      
Sbjct: 561  NSERDKEQMYQLKTQLDLATDQLEVKTAEVTEFTQDIDEIKQSKMLLEESIKAREDTIQE 620

Query: 2443 WENSF-DLINKCDSMNNEF-YNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEE-SENA 2613
            W++ F +   +C+ ++ E   NN  +   + +   D     ++E ++ ++  ++E SE  
Sbjct: 621  WKDKFEEKAKECEKLSIELESNNFKSGNLEAEHLADL--EDLHEKLTSLQATLKENSEEV 678

Query: 2614 ISLLKNNTKFNDQFKQLISKHIILKDNIE 2700
              L   NT    Q ++  SK+  L + ++
Sbjct: 679  GQLGAENTTLKSQLEEFKSKNCDLNEKVQ 707

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 73/350 (20%), Positives = 151/350 (43%), Gaps = 14/350 (4%)
 Frame = +1

Query: 1666 KLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDY 1845
            +L S   ++S   + +  K+ +  +K   +K H  + EI   N+K++K     ++ L   
Sbjct: 677  RLDSMRDLKSLKKEQQGNKSQLEEVK---EKLHSIDQEIDELNDKIKKSMSRREMILTQV 733

Query: 1846 KKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEV----- 2010
            +   + L K      +K  + L     +QL + ++K    +  +Q  LDM   ++     
Sbjct: 734  EAVNIKLEK------AKRERFLLEETMVQLISKEEKAKINQKLLQDKLDMYTEDLSRDFD 787

Query: 2011 --LTLMETMQEKAELMYK-DCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 2181
              LTL E  +E  E+  K   ++ +LN +    + +V KID ++ E  +  K  A+ L D
Sbjct: 788  TELTLTER-EELDEIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSKLKPQAKELED 846

Query: 2182 ISEE--NNNLKQYLKNHF--FKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLE 2349
               E  +    Q L+ H    ++  + LL     ST +N  +K ++ ++    TL    E
Sbjct: 847  QPNEIMSTTAIQNLQEHIDAVEDERKTLLER--KSTVDNEVQKISEIID----TLKSRQE 900

Query: 2350 ENKKLIMQNMTNATSAVIDQEMDLFEPRRAK-WENSFDLINKCDSMNNEFYNNMAATLSQ 2526
            E +K +     N+    + +++D ++    K       L  + D +  +  +        
Sbjct: 901  EEEKSL--EKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPDDS 958

Query: 2527 IKKTVDTSSNSMNESISVMKGQVEESENAIS-LLKNNTKFNDQFKQLISK 2673
              K  + SS+ + + +S +  ++ +  N     L+N  KF+D+ K ++ +
Sbjct: 959  ADKYHNMSSSELLKELSSINDKISKMTNVNKRALENFKKFDDKQKDVMKR 1008

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 72/322 (22%), Positives = 141/322 (43%), Gaps = 62/322 (19%)
 Frame = +1

Query: 1180 LNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF-----------RESKLT---RLLQDS 1317
            LN + K++ S  + +LT    +N  ++++    F           +E K     +LLQD 
Sbjct: 715  LNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDK 774

Query: 1318 LGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVK--NITME 1491
            L   T+   ++     ++T  E     E A K  +++N        +  ++VK  ++  E
Sbjct: 775  LDMYTED--LSRDFDTELTLTEREELDEIAKKLPDLENLLNTTTDALSSVVVKIDSLKAE 832

Query: 1492 L-AKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNE---VQECKREIESLASKNSLLV 1659
            L +K+K      + +    MS    +NL   +++ ++E   + E K  +++   K S ++
Sbjct: 833  LDSKLKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEII 892

Query: 1660 KDKLKSRE-----TIQSQNSQMESL-----------------KATINHLKAQL------- 1752
             D LKSR+     +++  NSQ  +L                 K T++  + +L       
Sbjct: 893  -DTLKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDI 951

Query: 1753 --------DKQHK---AEL--EISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHIS 1893
                    DK H    +EL  E+S  N+K+ KMT V + AL+++KK   D  +K     +
Sbjct: 952  GLLPDDSADKYHNMSSSELLKELSSINDKISKMTNVNKRALENFKK--FDDKQKDVMKRA 1009

Query: 1894 KEIKSLKTALFLQLDNMQQKNI 1959
            KE+   K ++   +D ++++ +
Sbjct: 1010 KELDESKESIEKLIDKLKKQKV 1031

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 53/256 (20%), Positives = 112/256 (43%)
 Frame = +1

Query: 1618 REIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNN 1797
            ++I SL ++   +++   + R+     +S+ ES++    HL  +L+   +   ++S    
Sbjct: 76   KKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKK 135

Query: 1798 KLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDI 1977
            ++Q  ++   + + D + +EL++ K    H   E K L++ + L+L+  QQ  I  + + 
Sbjct: 136  EIQS-SQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTI-LELETKQQTYISNDLNS 193

Query: 1978 QPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYK 2157
            +  L+    E+  L            KD ++K L+   + +    +K + I  E +N   
Sbjct: 194  KSQLERRTQELNLLQSN---------KDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLN 244

Query: 2158 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLN 2337
             I  +   + + NN++ +   N   K+  ++LL     S   N EK+        K  L 
Sbjct: 245  RIRNDFQ-LEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLI 303

Query: 2338 DHLEENKKLIMQNMTN 2385
            D LE     + + + N
Sbjct: 304  DLLESQLNAVKEELNN 319

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 103/591 (17%), Positives = 227/591 (38%), Gaps = 36/591 (6%)
 Frame = +1

Query: 1237 RVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 1416
            RV   L D+      +     + +++      K A++ T+   KV  E     LE   + 
Sbjct: 551  RVTRNLADKLESNENKSKNYLKNIENETINEAKEAIL-TLQSQKVQLESKIHELE--KER 607

Query: 1417 KNIKNKPQLGAFMMKDILVKNITMELAKIKSDL--LSTKSKEGIYMSQDHYKNLNSDLES 1590
            +  KN          + +++ +T    +++S    L  +  +    S ++   LN +L+ 
Sbjct: 608  EKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLLNKELQD 667

Query: 1591 HKNEVQECKREIESLASKNSLLVKDKLK----SRETIQSQNSQMESLKATINHLKAQLDK 1758
              +       E+    S   +L +++ K    + +  +++N Q+   K +IN   A   +
Sbjct: 668  LYDSKSSLSIELGREKSSR-ILAEERFKLLSNTLDLAKAENDQLR--KRSINLQNAISKQ 724

Query: 1759 QHKAELEISGFNNKLQKM----TEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALF 1926
              K +  ++ + +   K+    TE+  + L+   K EL+ N K E     E+ S KT+L 
Sbjct: 725  DSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQEL---SELSSEKTSLH 781

Query: 1927 LQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQE-KAELMYKD-CVKKILNESPKFF 2100
            + +  +Q     +E  +       +N++  L     E K E + KD  +K++  ++    
Sbjct: 782  IMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKI 841

Query: 2101 NVIVEKIDIIRIEFQNFYKNIAENLSDISE------------ENNNLKQYLKNHFFKNNH 2244
                 KI+ +R + ++   ++ E   ++              E N ++ +  N   ++ +
Sbjct: 842  EWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESIN 901

Query: 2245 QELLNHHIDSTYENIEKKTNQFVENFKM---------TLNDHLEENKKLIMQNMTNATS- 2394
             + L   ++ +  N+    +Q  E  K+          ++  L+E+ K     + N T  
Sbjct: 902  DDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDE 961

Query: 2395 -AVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNES 2571
               ++ ++ L   + +   N  DL N+        +    + L    K ++         
Sbjct: 962  KTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYESK 1021

Query: 2572 ISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIY 2751
            +S ++  +++     +  +NN      ++Q + KH  +   I             +    
Sbjct: 1022 LSKIQKDLDQQTIYANTAQNN------YEQELQKHADVSKTIS-------ELREQLHTYK 1068

Query: 2752 NTIEDIMTNHGNKENATKDEMID-NILKEIPNLSKRLPLRISNINGCSVQD 2901
              +E +    G  E A K+   + N  KE  +L ++L L  S I   S Q+
Sbjct: 1069 GQVETLNLARGQFEKALKENETNWNSQKE--SLLEQLDLSNSRIEDLSSQN 1117

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 123/587 (20%), Positives = 222/587 (37%), Gaps = 16/587 (2%)
 Frame = +1

Query: 982  LEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSEN 1161
            +E LNL  RG   + +   + N  S +   +  + L     ++L   S  N +     E 
Sbjct: 1071 VETLNLA-RGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDL---SSQNKLLYDQIEL 1126

Query: 1162 INRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTA 1341
               +G     AK    +N  +L   R    ++D    +  R++K+ R     +    + A
Sbjct: 1127 YTTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEA 1186

Query: 1342 LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLS 1521
                +  +KV +E+    ++   +     N+  L       +   N T+      S+  +
Sbjct: 1187 R-TKLCNSKVENEKRSFIIQQHDEVMEKLNQLNL-------LRESNTTLRNELDSSNSKN 1238

Query: 1522 TKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQN 1701
             + +  +   + +   + S+L + K  +QE ++EI     +     K      E  Q  +
Sbjct: 1239 KELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLS 1298

Query: 1702 S-QMESLKATINHLKAQLD--KQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNK 1872
            S   E L+  I  LKAQL+   Q  A+ E        +K   + + A +  K  +L  + 
Sbjct: 1299 STDYEKLETEIESLKAQLEDKTQQGADSE--------EKFNRLRRQAQEKLKASKLSQDS 1350

Query: 1873 KFETHISKEIKSLKTALFLQLDN----MQQKNIFQETDIQPNLDMVK------NEVLTLM 2022
              E     E+K  K AL   L+N    +Q+    +  + +  L M+K       E    +
Sbjct: 1351 FIEQ--LNELKDAKLALEKSLNNANARIQELEDAKVAENRNQLSMIKKLQEDTEENSKEL 1408

Query: 2023 ETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNN 2202
            ET  E+  + Y   VKK LNE        +EK   I+ +FQ       ++LS + E    
Sbjct: 1409 ETKLEENAISYDSTVKK-LNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMKR 1467

Query: 2203 LKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMT 2382
              +  K  F +   +E +N  I    E  E +     E      N +++E KK       
Sbjct: 1468 SFEEDKIKFIEEKTRE-VNQKIREFQEAQEAE-----ETGLKPSNINIDEIKKQWEAEHN 1521

Query: 2383 NATSAVIDQEMDLFEPR-RAKWENSFDLI--NKCDSMNNEFYNNMAATLSQIKKTVDTSS 2553
               S  I +  +  + R R   E     I   K + +  EF   +   L  I ++     
Sbjct: 1522 EEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKMED 1581

Query: 2554 NSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDN 2694
                +  S ++ + +E EN     + N K  ++ ++L S  II  D+
Sbjct: 1582 IFQKQLESRIQEKQKELEN-----EYNKKLQEKLRELPSSDIISSDD 1623

>Smik_4.534 Chr4 (963951..966581) [2631 bp, 876 aa] {ON} YDR285W
            (REAL)
          Length = 876

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 86/458 (18%), Positives = 190/458 (41%), Gaps = 27/458 (5%)
 Frame = +1

Query: 1579 DLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDK 1758
            ++E  K E+ +C  ++     KNS L+++  KSR          E +  TI    ++   
Sbjct: 302  EIEYLKRELDDCSGQLSEEKIKNSSLIQEIGKSR----------EQMTKTIEGFFSEDKT 351

Query: 1759 QHKAELEISGFNNKLQKMTEVMQVALQDYKKRELD-LN---KKFETHISKEIKSLKTALF 1926
            QH        FN   +K+ ++++  LQ +     D LN   K+  T +S   +++    +
Sbjct: 352  QHTMH-----FNKLEEKVHDLLEEKLQKHFNTAKDTLNIGLKEAGTELSSHTETILKQQY 406

Query: 1927 LQL-DNMQQKNIFQE---TDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPK 2094
            ++  +N+Q++    E   T+    LDM + E++T ++              K++L  S  
Sbjct: 407  VEFKENLQRRISSSENKITETLTELDMNQKELVTGVQ--------------KELLASSGN 452

Query: 2095 FFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDS 2274
               V++ +I+ I+ +  +     A+N   +    N LK Y K    +++  E    H++S
Sbjct: 453  SQTVLLTEINNIKHDLLDDSSKAAKNYLGL---ENLLKTY-KAEIIQSSEYEERIKHLES 508

Query: 2275 TYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRA----- 2439
                +  + NQ + +       + +  KK+  +N+    S +  +E  L E   +     
Sbjct: 509  ERSTLSSQKNQIISSLGTKEAQYEDLVKKIEAKNI--EISQISGKEQSLTEKNESLSNEL 566

Query: 2440 -KWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVM-----KGQVEE 2601
               +   D IN  +      Y N  ++ ++I K + + + ++ + I  +       Q + 
Sbjct: 567  KTVQGQLDKINNLNITTKSNYENKISSQNEIVKALTSENETLKQRIQQLVEFKENAQKDH 626

Query: 2602 SENAISLLKNN---TKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVD----DIYNTI 2760
            S    +  KNN    K N +  QL +  + L++               V+    D+    
Sbjct: 627  STKLEAFQKNNEQLQKLNVEVVQLKAHELELEEQNRHLKNCLERKEIGVEESLSDVKTLK 686

Query: 2761 EDIMTNHGNKENATKDEM-IDNILKEIPNLSKRLPLRI 2871
            + ++     K++ T +++ + + L+ + +++K L  ++
Sbjct: 687  QQMIVLKSEKQDITAEKLELQDSLENLEDVTKNLQQKV 724

>YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON}
            IMH1Protein involved in vesicular transport, mediates
            transport between an endosomal compartment and the Golgi,
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 911

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 116/574 (20%), Positives = 241/574 (41%), Gaps = 81/574 (14%)
 Frame = +1

Query: 1459 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESL- 1635
            K+ L+ +    L K  S++  + S E +   ++ +       +++KN++ + K+++E+L 
Sbjct: 108  KNNLLNDEIKRLTKQNSEIPESASSETLKDKEEEFLKKE---QNYKNDIDDLKKKMEALN 164

Query: 1636 -------ASKNSLL--VKDKLKSRETI--QSQNSQMESLKATINHLKAQLD-KQHKAE-- 1773
                     KN  +  +++K+ + E I  + + ++ +  + +I+ LK +L  K H  E  
Sbjct: 165  IELDTVQKEKNDTVSGLREKIVALENILKEEREAKKQKEEVSISELKEELAIKNHSLEDS 224

Query: 1774 -LEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFE--THISKEIKSLKTALFLQ---L 1935
             ++I+     L   + +M+    +  +  + L +K    + + K++K L  A+  Q    
Sbjct: 225  RMKITELEQNLSSKSTIMEEKSSELAELNITLKEKERKLSELEKKMKELPKAISHQNVGN 284

Query: 1936 DNMQQKN---------------IFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVK 2070
            +N ++KN               I +E  +  +++    E   L E +QE  E  YKDC  
Sbjct: 285  NNRRKKNRNKGKKNKGGITTGDISEEETVDNSIN--TEEYDKLKENLQELQE-KYKDCE- 340

Query: 2071 KILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQE 2250
               +   K+ ++  E  D   +E     K+ A+ L  ++ E  + K+ LK    KN+  E
Sbjct: 341  ---DWKQKYEDIEAELKDAKELENSQLEKS-AKELETLNTELIDTKKSLKE---KNSELE 393

Query: 2251 LL--------NHHIDSTYENIE--KKTNQFVENFKMTLNDHLEENKKLI---------MQ 2373
             +        N  +D+  E  E   K N+ V+  K+ L+D   +N  +I         ++
Sbjct: 394  EVRDMLRTVGNELVDAKDEIKESSSKQNEEVKTVKLELDDLRHKNATMIEAYEAKNTELR 453

Query: 2374 NMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKK---TVD 2544
            +     S  ++   +L   +  +   S + + K     NE  + +    S I K   ++ 
Sbjct: 454  SKIELLSKKVEHLKNLCTEKEKEQTTSQNKVAKL----NEEISQLTYEKSNITKELTSLR 509

Query: 2545 TSSNSMNESISVMKGQVEE---------------------SENAISLLK--NNTKFNDQF 2655
            TS     +++S ++ QV++                       N + LLK  N T  ND  
Sbjct: 510  TSYKQKEKTVSYLEEQVKQFSEQKDVAEKSTEQLRKDHAKISNRLDLLKKENETLHNDIA 569

Query: 2656 KQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKE 2835
            K   S    LK+N +            + + YNT++++ +N         +E ID+I ++
Sbjct: 570  KNSNSYEEYLKENGKLSERLNI-----LQEKYNTLQNVKSN--------SNEHIDSIKRQ 616

Query: 2836 IPNLSKRLPLRISNINGCSVQDIISPKKHTIEDE 2937
               L+ +L      I   S++D ++   + ++D+
Sbjct: 617  CEELNVKLKESTKKI--LSLEDELNEYANIVQDK 648

>KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {ON}
            Anc_4.46 YLR309C
          Length = 964

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 99/422 (23%), Positives = 175/422 (41%), Gaps = 29/422 (6%)
 Frame = +1

Query: 1462 DILVKNITMELA-------KIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKR 1620
            D+L K  T+E         K+K   L T S+      +   ++L   LE  K E  E +R
Sbjct: 372  DLLNKYNTLETLHGNCEDWKVKYTKLETDSESKCKEIELQLESLQKALELIKEEKVEARR 431

Query: 1621 EIESLASKNSLLVKDKLKS--RETIQSQNSQMES---------LKATINHLKAQLDKQHK 1767
            E+E   +K    V+D LK+   E +++++S  E+         L+A I  LK ++    +
Sbjct: 432  ELE-FKNKELEEVRDMLKTVGNELVEARDSIKEAGVNSTDKLKLEAEITALKEKISMYEE 490

Query: 1768 AELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLD--N 1941
             E +++    KL++  E ++    D +K  L+ N KF T   +E K     L  QL   N
Sbjct: 491  KEPKLNETIKKLRQTEEDLKRKHND-EKAALESNVKFLTSTLEEKKKENDILSTQLKDYN 549

Query: 1942 MQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKI 2121
              + ++ Q+      L+    E  T  E ++ K E + KD  K            +  +I
Sbjct: 550  SLKSSLLQKEKTVVYLEKQVREFTTNDEAVKRKLETLKKDNEK------------LNNRI 597

Query: 2122 DIIRIEFQNFYKNIAENLSDIS---EENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIE 2292
            ++++ E ++    + +N        +EN  L + L      N  QE  N     T +N++
Sbjct: 598  ELLKKENESLTAEVKKNSGSYEGYLKENGKLCERL------NVLQEKYN-----TLQNLK 646

Query: 2293 KKTNQFVENFKM---TLNDHLEENKKLI--MQNMTNATSAVI-DQEMDLFEPRRAKWENS 2454
              +N+   + K     LN  L+E  K I  M++  N  S +I D+  +    RR   E+ 
Sbjct: 647  SNSNEQTNSIKRQCEELNLKLKEANKRIMSMEDELNEYSTIIHDKTREADTMRRLLSESQ 706

Query: 2455 FDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNN 2634
             +  +K +S+  +    +             SS  + E+  + + Q  E E  +  LK  
Sbjct: 707  NEGTDKQESLQTKLSFALEEKAKLESDMALQSSRQIRETQELKRSQ-NELETEMHKLKMK 765

Query: 2635 TK 2640
             K
Sbjct: 766  EK 767

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 82/445 (18%), Positives = 164/445 (36%), Gaps = 35/445 (7%)
 Frame = +1

Query: 1108 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRE 1287
            EL   S    ++L   E +     L  + KE   +   L T+G   N LV+    I    
Sbjct: 409  ELQLESLQKALELIKEEKVEARRELEFKNKELEEVRDMLKTVG---NELVEARDSIKEAG 465

Query: 1288 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDI 1467
               T  L+           I+     +    ET   L    +    K+  +  A +  ++
Sbjct: 466  VNSTDKLKLEAEITALKEKISMYEEKEPKLNETIKKLRQTEEDLKRKHNDEKAA-LESNV 524

Query: 1468 LVKNITMELAKIKSDLLST--------------KSKEGIYMSQDHYKNLNSD------LE 1587
                 T+E  K ++D+LST              K K  +Y+ +   +   +D      LE
Sbjct: 525  KFLTSTLEEKKKENDILSTQLKDYNSLKSSLLQKEKTVVYLEKQVREFTTNDEAVKRKLE 584

Query: 1588 SHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHK 1767
            + K + ++    IE L  +N  L  +  K+  + +    +   L   +N L+ + +    
Sbjct: 585  TLKKDNEKLNNRIELLKKENESLTAEVKKNSGSYEGYLKENGKLCERLNVLQEKYNTLQN 644

Query: 1768 AELEISGFNNKLQKMTEVMQVALQDYKKRELDLN---KKFETHISKEIKSLKTALFLQLD 1938
             +   +   N +++  E + + L++  KR + +     ++ T I  + +   T   L L 
Sbjct: 645  LKSNSNEQTNSIKRQCEELNLKLKEANKRIMSMEDELNEYSTIIHDKTREADTMRRL-LS 703

Query: 1939 NMQQKNIFQETDIQPNLDMVKNEVLTLMETM--QEKAELMYKDCVKKILNESPKFFNVIV 2112
              Q +   ++  +Q  L     E   L   M  Q   ++     +K+  NE     + + 
Sbjct: 704  ESQNEGTDKQESLQTKLSFALEEKAKLESDMALQSSRQIRETQELKRSQNELETEMHKLK 763

Query: 2113 --EKIDIIRIEFQNFYKNIAENLSDISEENN--------NLKQYLKNHFFKNNHQELLNH 2262
              EK  ++ IE         +  ++++ E++        NLK+ L     +    +  N 
Sbjct: 764  MKEKQMLLEIETLTSLNEAIKRKNEVNSEDSSGLEKIASNLKESLSRADKRVQELQKSNE 823

Query: 2263 HIDSTYENIEKKTNQFVENFKMTLN 2337
             +     +I KK ++  +N+K   N
Sbjct: 824  ELLDLNNDINKKFDRLTKNYKSLSN 848

>Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250W
            (REAL)
          Length = 1316

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 107/524 (20%), Positives = 209/524 (39%), Gaps = 26/524 (4%)
 Frame = +1

Query: 1387 CSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK 1566
            C T E A K ++ KN     +F   D+  KN   EL  +K+     K K   + +++   
Sbjct: 449  CDTEELAEKIRSFKN-----SFTEDDL--KN---ELENLKT----YKEKLQTWENENIIP 494

Query: 1567 NLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKA 1746
             LN  +E   NE+   + +IE          +D++          +++  +K ++     
Sbjct: 495  KLNQQIEEKNNEMIILENQIEKF--------QDRIMKTNQQADLYAKLGLIKKSVGAKSD 546

Query: 1747 QLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLN-KKFETHISKEIKSLKTAL 1923
            +L K  +  L     N+K++++  +MQ   QD++  +L+++ +K   ++ K I ++    
Sbjct: 547  ELQKIIQTLLN----NSKIRQIFPIMQDFKQDFQGSDLEMDFQKLFINMQKNI-AINNKE 601

Query: 1924 FLQLDNMQQKNIFQ----ETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESP 2091
              ++D      ++     E D+Q N    +     L E + E   +   D    +L ES 
Sbjct: 602  MHEIDRKYTNALYNFNTIEKDLQENQQSKQKVTQLLNENLPEDCTI---DEYSDVLEESE 658

Query: 2092 KFFNVIVE--KIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNN--HQELLN 2259
              +   +E  K+    +EF      IAE  S           YL +  F+N+    +LL 
Sbjct: 659  LSYKTALENLKMHQTTLEFNRKALEIAERDSCC---------YLCSRKFENDSFKSKLLQ 709

Query: 2260 HHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRA 2439
                 T  N EK     V+N K  L+     +K +I  +  N     I+   +  E    
Sbjct: 710  ELKIKTDANFEKSLKDTVQNEKEYLDSLRLLDKHIISLSSINEK---INNSREHLEKANE 766

Query: 2440 KWENSFDLINKCDSMNNEFYNNMAATLSQIK-------------KTVDTSSNSMNESISV 2580
            + ++S   + + ++ +    N+     S I+             K ++ +S S+++ +S+
Sbjct: 767  ETKSSKLKLYELETKSTTLRNDKEFAESDIRPLIERFTYVEKEIKDLENNSKSISDELSI 826

Query: 2581 MKGQVEESENAISLLKNNTKFNDQFKQLISKHII----LKDNIEXXXXXXXXXXXNVDDI 2748
                 +  +    L     K ND  +QL  KHI+     KD                +  
Sbjct: 827  YSTSGDGIQTVDELRDQQRKMNDSLRQL-RKHILGIQMEKDEKVKESSRIISLTKEKELK 885

Query: 2749 YNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNI 2880
             + IE  +T   N +N+ K + ++  +K+I +  + L  RI ++
Sbjct: 886  VSEIESSLTQKQNIDNSIKSKEVN--IKDIDSRVEALESRIVSL 927

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 76/356 (21%), Positives = 159/356 (44%), Gaps = 13/356 (3%)
 Frame = +1

Query: 1624 IESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKL 1803
            ++S+    S+ +K   +S E ++    + +++K  I+ L+ ++D+ HK   +I    +++
Sbjct: 191  LKSIKKDMSVDIKLLKQSVEHLKLDKDRSKAMKLNIHQLQTKIDQYHKEVSQIEFQLSEI 250

Query: 1804 QKMTEVMQVALQDYKK--RELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDI 1977
               ++ +  + QD++K   +++  K  +  IS ++K L  +  + + ++ + ++    D 
Sbjct: 251  TGQSDKLFKSNQDFQKILSKVENLKNAKISISDQVKRLSNS--IDIIDLSKPDLQNLLDN 308

Query: 1978 QPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYK 2157
               + M KN  L  +E          KD    + N S    N ++ +   +    + + K
Sbjct: 309  FSKVLMDKNNQLKDLEASTSN----LKDRQSSLQNRS----NSLIRRQGELEAGKETYEK 360

Query: 2158 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH-------HIDSTYENIEKKTNQFVE 2316
            N+  +LS + E   +  Q L +   KNN    +NH        I     N  KK  + ++
Sbjct: 361  NL-NHLSSLKEAFQHRFQDLSD--IKNNDMAQINHKMSQFKAFISHDLTNTAKKFEEEIQ 417

Query: 2317 NFKMTLNDHLEE---NKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMN 2487
              + +L++ ++    + + +  N  + T  + D E +L E  R+ ++NSF      D + 
Sbjct: 418  LKETSLSELVKSITVDSQNLEYNKKDRTKLICDTE-ELAEKIRS-FKNSFTE----DDLK 471

Query: 2488 NEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNN-TKFNDQ 2652
            NE  N     L   K+ + T  N     I  +  Q+EE  N + +L+N   KF D+
Sbjct: 472  NELEN-----LKTYKEKLQTWEN--ENIIPKLNQQIEEKNNEMIILENQIEKFQDR 520

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
            YBL047C
          Length = 1414

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 85/448 (18%), Positives = 187/448 (41%), Gaps = 20/448 (4%)
 Frame = +1

Query: 1351 TISPAKVTSEETCSTLEYASKAKNIKNKP-QLGAFMMKDILV-KNITMELAKIKSDLLST 1524
            +ISP   T + + ST +  S   +    P    +F  +DI    + + +L+   ++L + 
Sbjct: 522  SISPLPQTVQRSLSTQQSPSMINSKLTHPTSTNSFQNRDIFADSDASAKLSTATTELTNL 581

Query: 1525 KSKEGIYMSQDHYKN-LNSDLESHKNEVQECKREIE----SLASKNSLLVKDKLKSRETI 1689
             ++     +Q    N   S  E     V + K  ++    +L   N   +KD   ++ +I
Sbjct: 582  SNQMSSLTNQASINNEKKSKTEMELKRVTDMKNSMQLKLTTLRQTNDKTIKDIENTQLSI 641

Query: 1690 QSQNSQMESLKATINHLKAQLDKQHKAEL-EISGFNNKLQKMTEVMQVALQDYKKRELDL 1866
             + N++  +L+  +  L+   +K+ + +L E++   N+ QK+ + ++  +        DL
Sbjct: 642  NTINNENTNLQTQLVTLE-NTNKESELKLNELTAQFNESQKLNDELKEKMTTINTTTNDL 700

Query: 1867 NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVL-TLMETMQEKA 2043
              K E     E+KS+           ++K++      Q  L  +  E L T +  +QEK 
Sbjct: 701  ENKIE-----ELKSVY---------QKEKSMTDVNSKQLELKEINVETLNTELSDLQEKI 746

Query: 2044 ELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKN 2223
            ++  K           K  +    +++    + ++ Y+ +A   ++++E  N L    KN
Sbjct: 747  DIYLK---------KQKELDDYKTQVEQQHAQLESTYQQLATKTNELNERQNELDLQNKN 797

Query: 2224 HFFKNNHQELLNHHIDSTYENIEKKTNQFVE----------NFKMTLNDHLEENKKLIMQ 2373
               + N  +     +DS ++ ++K+   F +          ++   + D  E+  +L M 
Sbjct: 798  IVEQENVYKQNVERLDSMFDELKKRKESFDQSNAELHQQHIDYAQRVQDLSEKKMQLSMG 857

Query: 2374 NMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSS 2553
             +      +IDQ    ++P         D+ +   ++ +E  N++    S    T D++ 
Sbjct: 858  ELPPNAKEIIDQ----YKP---------DMTSTTTNLTSEL-NSLDINASPANPTNDSTL 903

Query: 2554 N-SMNESISVMKGQVEESENAISLLKNN 2634
            N S+N +I  +  +  E ++  S + NN
Sbjct: 904  NKSLNSNIDNINEKSREIQHPTSQVMNN 931

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 141/674 (20%), Positives = 260/674 (38%), Gaps = 75/674 (11%)
 Frame = +1

Query: 1036 TKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKE----- 1200
            TK  D  S++ T     L    QD   +I ++       +EN N +  +NQ + E     
Sbjct: 301  TKFPDLESQNET-----LKSDIQDLTLKIEELQ------NENFNLNSMINQMSNEQNNSN 349

Query: 1201 -AGSINQSLLTLGRVINALVDRSGHIPFRESKL-TRLLQDSLGGNTKTALIATISPAKVT 1374
             + SI+ +L TL   IN L  +       +  L T++    +    K  +I++       
Sbjct: 350  NSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQA 409

Query: 1375 SEETCSTLE-YASKAKNIKNKPQ--LGAFMMKDILVKNITMELAKIKSDL---------- 1515
             E   + L    +K  N KN  Q  L  +  K +  ++   EL + + DL          
Sbjct: 410  LENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLF 469

Query: 1516 LSTKSKEGIYMSQDHYKNLN------SDLESHKNEVQECKRE-------IESLASKNSLL 1656
            ++ K+  G  ++++  + +N       DL   +   Q    E       IE L +KN  L
Sbjct: 470  VAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMEL 529

Query: 1657 ---VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQ 1827
               ++   ++ E I++ NS  E    TI   K       +A L +   N+ L+   +V++
Sbjct: 530  LNSIRSLSENLENIENANSHKEFQNKTIADAK-------EAILTLQYHNDILESKVKVLE 582

Query: 1828 VALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQE---TDIQPNLDMV 1998
             A +D  K  L+ N   ++ I  +  S  T+      ++++     E    +++ N D +
Sbjct: 583  -AERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDAL 641

Query: 1999 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLS 2178
            ++++ +      +K+ L         L +      ++ EKI +    F        + L 
Sbjct: 642  ESQIASF---TADKSNLTIS------LEKEKSSNTLMAEKISLTESAF--------DMLK 684

Query: 2179 DISEENNNLKQYLKNHFFKNNHQ--ELLNHHIDSTYE--------NIEKKTNQFVENFKM 2328
              ++E N   + L+N   K   +  +++N +I    E        +I K    F+   + 
Sbjct: 685  TENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQD 744

Query: 2329 TLNDHL-----EENKKLIM----QNMTNATSAVIDQEMDLFEPRRAKWE-NSFDLINKCD 2478
            +LN  L     E+NK  IM    Q++ N    ++D     F  +  + E N+ DLI    
Sbjct: 745  SLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLG 804

Query: 2479 SMNNE-------------FYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAIS 2619
            S   E             +Y N    L +I   + T   S N  IS +  ++E  E+   
Sbjct: 805  SKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQSY 864

Query: 2620 LLKNNTKFN---DQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNK 2790
             +  NT+ +   + F Q ISK +   D  +               +Y + E+ +    + 
Sbjct: 865  TIDTNTRCSSSGNDFSQ-ISKDL---DITKLHLSEAYTQVEEYKQLYTSTEESLKTLESN 920

Query: 2791 ENATKDEMIDNILK 2832
              + K+ M D I K
Sbjct: 921  FESVKNLMDDKISK 934

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 91/460 (19%), Positives = 197/460 (42%), Gaps = 30/460 (6%)
 Frame = +1

Query: 1378 EETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 1557
            +E+  TL       N KNK        ++  + N++MEL  +K + L  K  + + + ++
Sbjct: 1197 KESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVK-ESLGDKETDIMLIKEE 1255

Query: 1558 HYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLK-SRETIQSQNSQMESLKATIN 1734
              K     L + +  VQ  K +++S++  ++ L  D LK   ET + QN+++E      N
Sbjct: 1256 SNK---WRLRAEELSVQIDKVDLDSVSKLSTEL--DALKDDAETKRKQNAELEE---RFN 1307

Query: 1735 HLKAQLDKQHKAELEI-SGFN---NKLQKMTEVMQVALQDYKKRELDLNKKFE------- 1881
             LK Q  ++  A  EI S  N   N+L+     +++AL   +K+ +DL            
Sbjct: 1308 LLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYT 1367

Query: 1882 ---THISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELM 2052
               ++I  E+K+LKT    + ++ +  +  ++ ++   +D +K  ++      Q K   +
Sbjct: 1368 QKLSNIESELKALKT----ENNSFKLSSEKEKMELTDEVDSLKKSLV----EAQSKLSAI 1419

Query: 2053 YKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFF 2232
              D     +N            I+ ++ EF+     + E+ ++  E    L++      +
Sbjct: 1420 GSDSTDSTMN----------AMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLLKEY 1469

Query: 2233 KNNHQELLNHHIDST--YENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVID 2406
            +   ++L +   D +   E  +    ++ E ++    + +EE K+ + + +   +   I+
Sbjct: 1470 EEKIEDLQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKIN 1529

Query: 2407 QEMDLFEPRRAKWENSFDL-----INKCDSMNNEFYNNMAATL-SQIKKTVDTS-----S 2553
            +   + E R+ + EN +++     +N+ ++  N         L  +IK+ V         
Sbjct: 1530 R---VIEKRKHELENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFE 1586

Query: 2554 NSMNES--ISVMKGQVEESENAISLLKNNTKFNDQFKQLI 2667
            N +NE+   S  +G+ + S     L +  +K   Q  + I
Sbjct: 1587 NDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAI 1626

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 76/443 (17%), Positives = 187/443 (42%), Gaps = 37/443 (8%)
 Frame = +1

Query: 1471 VKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNS 1650
            ++++  ELA ++  L+S+++K  +    D  +N +  + S  N++   K   E+L ++ S
Sbjct: 1152 LESLRDELANVQMKLISSENK--LLRHSDLIEN-HEKIVSELNQITLFKESNETLRNQVS 1208

Query: 1651 LLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQV 1830
             L +     +  +  +NS++ +L   +  +K  L  +    + I   +NK +   E + V
Sbjct: 1209 ELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSV 1268

Query: 1831 ALQDYKKRELDLNKKFETHI-----SKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDM 1995
             +    K +LD   K  T +       E K  + A   +  N+ +K   +  +    +  
Sbjct: 1269 QID---KVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQS 1325

Query: 1996 VKNEVLTLMETMQEKAELMYKDCVKKIL--------NE---SPKFFNVIVEKIDIIRIEF 2142
              N+ +  ++      EL      KK +        NE   + K  N I  ++  ++ E 
Sbjct: 1326 SLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKLSN-IESELKALKTEN 1384

Query: 2143 QNFYKNIAENLSDISEENNNLKQYLKNHFFK------NNHQELLNHHIDSTYEN------ 2286
             +F  +  +   ++++E ++LK+ L     K      ++    +N  I+S  +       
Sbjct: 1385 NSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNAMIESMKKEFEEEKL 1444

Query: 2287 --IEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFD 2460
              +E KTN+    +K+  +  L+E ++ I    +  T   I  +++ F+  + +WE  ++
Sbjct: 1445 KLLEDKTNELEAQWKLEKDKLLKEYEEKIEDLQSARTDQSI--KIEEFQSLKKEWEEEYE 1502

Query: 2461 --LINKCDSMNNEFYNNM-AATLSQIKKTVDTSSNSMNESISV----MKGQVEESENAIS 2619
               + + +         +   + ++I + ++   + +     V       ++E + N+I 
Sbjct: 1503 KATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIE 1562

Query: 2620 LLKNNTKFNDQFKQLISKHIILK 2688
             + +  K  ++ K+ + + +++K
Sbjct: 1563 TI-DPGKLREEIKEEVKRDMLIK 1584

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 67/356 (18%), Positives = 140/356 (39%), Gaps = 12/356 (3%)
 Frame = +1

Query: 1828 VALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNE 2007
            +A++D K  EL  +K     +S +I  L+T    +L ++  K    ET+ +  +D V   
Sbjct: 56   LAVKD-KLDELRNSKDQSNVVSNDINELQTLADNKLTSLGGKLATVETEKKELIDKVNGY 114

Query: 2008 VLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDIS 2187
                 E               KI NE          K+  + IE +N +KN   N ++  
Sbjct: 115  ETQFNEL--------------KIKNEGLNL------KVSNLNIELEN-WKN---NSNNFE 150

Query: 2188 EENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLI 2367
             E  N          + +  + L   +    EN    + Q+++       +   + K L+
Sbjct: 151  TEKLNYVXXXXXLSIRESEIQRLKQEVTFLNENKSSLSEQWLKE-----KEEFNKAKLLL 205

Query: 2368 MQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEF---YNNMAATLSQIKKT 2538
             +N+ N+T   +++     +   AK       ++     NN+    Y N    +  +K  
Sbjct: 206  EKNLNNSTIK-LEEATTTLKSMEAK-------VSVLSDKNNDLTKKYENSIWEIKNLKDN 257

Query: 2539 VDTSSNSMNESIS-------VMKGQVEESENAI-SLLKNNTKFNDQFKQLISKHIILKDN 2694
            +  + + MN+ I+       +++GQ+  ++  +   ++ N+KF  +F  L S++  LK +
Sbjct: 258  LLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKFT-KFPDLESQNETLKSD 316

Query: 2695 IEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATK-DEMIDNILKEIPNLSKRL 2859
            I+              ++ + I  +     N  N++  D  +  +  +I  L K++
Sbjct: 317  IQDLTLKIEELQNENFNLNSMINQMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQV 372

>TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {ON}
            Anc_8.604 YOR195W
          Length = 818

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 79/383 (20%), Positives = 176/383 (45%), Gaps = 42/383 (10%)
 Frame = +1

Query: 1564 KNLNSDLESHKNEVQECKREIESLASK---NSLLVKDKLKSRETIQSQ-NSQMESLKATI 1731
            + L S+L S++N+V++    I SL  K   NS  ++   +  +T+Q +    +     T 
Sbjct: 444  EKLGSELSSYENQVKDLNENIHSLEEKDKLNSNKLETITEEYKTLQQKLQDTLSQQSGTT 503

Query: 1732 NHLKAQLDKQHKAELEISGFNNKLQKMT----EVMQVALQDYKKRELDLNKKFETHISKE 1899
            N L  QL++   A++E+    ++L+  +    E +++ L++  +++L+ N K    +  +
Sbjct: 504  NDLNKQLEETRLAKIEVESQLDELKTSSISEKETLEIKLKE-TEQQLENNTKLVDELLAK 562

Query: 1900 IKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTL---METMQEKAELMYKDCVK 2070
              SL+T L  ++++++     Q T+   + ++ K +V  L   ++ ++EK E++  D + 
Sbjct: 563  KTSLETELHEKINSIELLKK-QNTESNDDSEINKAQVGQLKIEIQALKEK-EMVLNDSIN 620

Query: 2071 KILNESPKFFNVIVEK---IDIIRIEFQNFY---KNIAEN--------------LSDISE 2190
            K+ +++ ++     +K   +D  R+E ++     KN+ E               L  + E
Sbjct: 621  KLEDKTEEWKMKYQDKCSDLDKNRLEVESLQMKCKNMEEEHLAELERVHANISLLQTLIE 680

Query: 2191 ENN-NLKQYLK-NHFFK------NNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHL 2346
            ENN N+    K N   K      N  +E +N ++    + I     +     +   N   
Sbjct: 681  ENNDNMNTLKKENELLKTGNSKTNRQEETMNENMTKMSDEINSLKTETTTLKEQLANKEQ 740

Query: 2347 EENK--KLIMQNMTNATSAVIDQEMDLFEP-RRAKWENSFDLINKCDSMNNEFYNNMAAT 2517
            E NK  KL+ +++    S+  +Q++ L +    +K++   D +    ++ NE Y      
Sbjct: 741  EINKRLKLLAEDLYVQYSSKHEQKVKLLKKGYDSKYQTKIDQL----TLQNEGY---LQE 793

Query: 2518 LSQIKKTVDTSSNSMNESISVMK 2586
            + Q+KK +    N   + + +++
Sbjct: 794  VDQLKKQLALERNEKQKVLQLLE 816

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 61/327 (18%), Positives = 130/327 (39%), Gaps = 37/327 (11%)
 Frame = +1

Query: 2083 ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH 2262
            +SP  F++ V+ +  I I+     K I E  ++ +   +++K   KN    ++       
Sbjct: 201  DSPNKFSLHVDNMKTIEIQ-----KAIFETTNEETHRFDDMKADKKNTESNSDKVITPEK 255

Query: 2263 HIDSTYENIEKKTNQFVENFKMTLN-DHLEENKKLIMQNMTNATSAV------------- 2400
                   N+ K T  +  +  +++  +HLEENKK  + +  N+   +             
Sbjct: 256  QTRDDTPNLNKLTPLYNTDLAISMQLNHLEENKKKYVIDEHNSFKVISERNKDLIAQINN 315

Query: 2401 IDQEMDLFEPRRAKWENSFDLIN-KCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESIS 2577
            +++E+++    + +   +F L+  + D ++ ++   +  T  ++ + + T   + N  I 
Sbjct: 316  LNKELNISLSAQEQTIYNFKLLKAEYDGLSEKYETKINITAEEM-ENIQTERENQNRKID 374

Query: 2578 VMKGQVEESENAISLLKNNTKF----------------------NDQFKQLISKHIILKD 2691
             +K ++ E ++ IS+L  N K                       ND+ + L   H  + +
Sbjct: 375  KLKKKISEYKDEISMLNQNQKILQNKYNQTSDESEKWKLSHEEVNDKLQALEKDHQAVLN 434

Query: 2692 NIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRI 2871
            N+             +    N ++D+  N  + E   KD++  N L+ I    K L  ++
Sbjct: 435  NLNQLISDKEKLGSELSSYENQVKDLNENIHSLEE--KDKLNSNKLETITEEYKTLQQKL 492

Query: 2872 SNINGCSVQDIISPKKHTIEDENPSSE 2952
                    QD +S +  T  D N   E
Sbjct: 493  --------QDTLSQQSGTTNDLNKQLE 511

 Score = 37.0 bits (84), Expect = 0.32
 Identities = 35/159 (22%), Positives = 74/159 (46%), Gaps = 2/159 (1%)
 Frame = +1

Query: 1570 LNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQ 1749
            L + +E + + +   K+E E L + NS   + +    E +   + ++ SLK     LK Q
Sbjct: 675  LQTLIEENNDNMNTLKKENELLKTGNSKTNRQEETMNENMTKMSDEINSLKTETTTLKEQ 734

Query: 1750 LDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKK-FETHISKEIKSLKTALF 1926
            L  +   E EI   N +L+ + E + V      ++++ L KK +++    +I  L     
Sbjct: 735  LANK---EQEI---NKRLKLLAEDLYVQYSSKHEQKVKLLKKGYDSKYQTKIDQL----- 783

Query: 1927 LQLDNMQQKNIFQETD-IQPNLDMVKNEVLTLMETMQEK 2040
                 +Q +   QE D ++  L + +NE   +++ ++++
Sbjct: 784  ----TLQNEGYLQEVDQLKKQLALERNEKQKVLQLLEKE 818

>Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356W
            (REAL)
          Length = 947

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 78/429 (18%), Positives = 178/429 (41%), Gaps = 37/429 (8%)
 Frame = +1

Query: 1525 KSKEGIYMSQDHYKNLNSDLESHK---NEVQECKREIESLASKNSLLVKDKLKSRETIQS 1695
            ++ E   +   H     SDL S +   NE++  K EI+ L  + +    D L + + ++ 
Sbjct: 139  RALESKLLGNRHVTYAQSDLSSKEVYINEIKSLKHEIKELRKEKN----DTLNNYDNLEE 194

Query: 1696 QNSQMESLKATINHLKAQLDKQHKA--ELEISGFNNKLQKMTEVMQVALQDYKKRELDLN 1869
            +    + L+  +  L+ +LD +++     E    +  +++  ++        +++  DL 
Sbjct: 195  ET---DDLRNKLQELEKELDVKNRMVNSREAEDHSGCIEEREKI--------ERKLNDLE 243

Query: 1870 KKFETHISKEIKSLKTALFLQLDNMQQK--------------------NIFQETDIQPNL 1989
            KKF+T ++ +++ L+    +Q   ++ K                    N+ Q    +  L
Sbjct: 244  KKFKT-VNDQVRELENRANVQKSELKSKEDQLKESMNQLNEFKNNTDENVSQLESKRIEL 302

Query: 1990 DMVKNEVLTLMETMQEK-AELMYKDC-VKKI---LNESPKFFNVIVEKIDIIRIEFQNFY 2154
              + N++  L     EK ++L  K+  +K++   LNE  K  N    +      E +   
Sbjct: 303  RNLTNQLNALKNESDEKDSQLQQKESELKRLTNKLNELEKRLNENSSQSSAKESELKESK 362

Query: 2155 KNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQF--VENFKM 2328
              I E    I+++N+ L+        K N  + L   +      + +K +Q    E+   
Sbjct: 363  SQITELEEKINKKNSQLET-------KENELKSLMAQLTQLENRLNQKDSQLGSKEDELK 415

Query: 2329 TLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNM 2508
            T+N+ L+ + K+  Q      +A  D+ +   + +    EN   ++ K  + +    N+ 
Sbjct: 416  TINEKLQRDIKIARQE-----TASKDERIYALQMKIQNLENDLSMMKKTHNESKSVTNDE 470

Query: 2509 AATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKN-----NTKFNDQFKQLISK 2673
              + S++ K ++T      E    ++ +++E EN   + ++     N + N++   L  +
Sbjct: 471  LESKSKVIKILETDLEVAQEKYLKLQSELKERENRYKISESNLEDENIRLNERISDLARE 530

Query: 2674 HIILKDNIE 2700
            +  LK  ++
Sbjct: 531  NSRLKSTVD 539

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 122/571 (21%), Positives = 224/571 (39%), Gaps = 75/571 (13%)
 Frame = +1

Query: 1093 KKHQDELFRIS-KMNLVDLAGSENINRSGALNQRAKEAGS--------INQSLLTLGRVI 1245
            ++ + EL R++ K+N ++   +EN ++S A     KE+ S        IN+    L    
Sbjct: 324  QQKESELKRLTNKLNELEKRLNENSSQSSAKESELKESKSQITELEEKINKKNSQLETKE 383

Query: 1246 NALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPA-----KVTSEETCSTLE--Y 1404
            N L      +   E++L +  +DS  G+ +  L  TI+       K+  +ET S  E  Y
Sbjct: 384  NELKSLMAQLTQLENRLNQ--KDSQLGSKEDEL-KTINEKLQRDIKIARQETASKDERIY 440

Query: 1405 A--SKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSK------EGIYMSQDH 1560
            A   K +N++N   +         +K    E   + +D L +KSK        + ++Q+ 
Sbjct: 441  ALQMKIQNLENDLSM---------MKKTHNESKSVTNDELESKSKVIKILETDLEVAQEK 491

Query: 1561 YKNLNSDLESHKN--EVQECKRE---------IESLASKNSLLVKDKLKSRETI-----Q 1692
            Y  L S+L+  +N  ++ E   E         I  LA +NS L K  +  + T      +
Sbjct: 492  YLKLQSELKERENRYKISESNLEDENIRLNERISDLARENSRL-KSTVDDKSTAVYRMKE 550

Query: 1693 SQNSQMESLKATINHLKAQLDKQHKAELE-----------ISGFNNKLQKMTEVMQVALQ 1839
            S  ++++SL+  +   K   +K      E           +S   +K  K  E     L 
Sbjct: 551  SYEARLDSLRKEVEEYKVNAEKSESKVEELRIMITENSARVSEKRSKEMKEKERKNKELT 610

Query: 1840 DYKKRELDLNKKFETHISK----------EIKSLKTALFLQLDNMQQKNIFQETDIQPNL 1989
            D  K + D     +  I K          E  +++  L LQ+ N++ K I  E +++   
Sbjct: 611  DNLKMQEDEISSLKAMIEKYKKEFSQSKSEQSNIQRTLNLQILNLENKLIESEDELKSLR 670

Query: 1990 DMVKNEV-----------LTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRI 2136
            D  + E+           L     ++EKA    K+    ILN         +++++  + 
Sbjct: 671  DSQETEIDNWKRKYNNLSLENDRLLEEKASASDKEHEVSILNRK-------IDELEKEKW 723

Query: 2137 EFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVE 2316
              Q   +     L  +   N+ L++           +E LN +   T   +E+K  +  +
Sbjct: 724  NLQASKEKYKHELQKVITANDRLRR----------EKEELNEN-SGTIRMMEEKMARIKK 772

Query: 2317 NFKMTLNDHLEENKKL---IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMN 2487
            N+   +    +EN+KL   ++ N        I Q  D     + K+ +     N    +N
Sbjct: 773  NYLSEITSLQDENRKLEERLILNERQKDDNSIVQLSDFVSYYKLKYHSEVRHNNDLKVIN 832

Query: 2488 NEFYNNMAATLSQIKKTVDTSSNSMNESISV 2580
            +  Y N    LS  +  +DT     + +IS+
Sbjct: 833  D--YLNKVLALSTRRLRLDTRKGEHSLNISI 861

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 122/602 (20%), Positives = 237/602 (39%), Gaps = 27/602 (4%)
 Frame = +1

Query: 910  PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1089
            PM+Q  +   +    L++     ALE   L  R + + Q      +D SS+   I  I  
Sbjct: 117  PMSQPLKEQEVKEHQLKKERFERALESKLLGNRHVTYAQ------SDLSSKEVYINEIKS 170

Query: 1090 YKKHQDELFRISK--MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA--LV 1257
             K    EL +     +N  D    E  +    L +  KE    N       R++N+    
Sbjct: 171  LKHEIKELRKEKNDTLNNYDNLEEETDDLRNKLQELEKELDVKN-------RMVNSREAE 223

Query: 1258 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1437
            D SG I  RE K+ R L D                     E+   T+    +    +   
Sbjct: 224  DHSGCIEERE-KIERKLNDL--------------------EKKFKTVNDQVRELENRANV 262

Query: 1438 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECK 1617
            Q      K+  +K    +L + K++     S+  +   +   +NL + L + KNE  E  
Sbjct: 263  QKSELKSKEDQLKESMNQLNEFKNNTDENVSQ--LESKRIELRNLTNQLNALKNESDEKD 320

Query: 1618 REIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNN 1797
             +++   S+   L  +KL   E   ++NS   S K   + LK    +  + E +I+  N+
Sbjct: 321  SQLQQKESELKRLT-NKLNELEKRLNENSSQSSAKE--SELKESKSQITELEEKINKKNS 377

Query: 1798 KLQKMTEVMQVALQDYKKRELDLNKKFETHISK--EIKSLKTALFLQLDNMQQKNIFQET 1971
            +L+     ++  +    + E  LN+K     SK  E+K++   L   +   +Q+   ++ 
Sbjct: 378  QLETKENELKSLMAQLTQLENRLNQKDSQLGSKEDELKTINEKLQRDIKIARQETASKDE 437

Query: 1972 DI---QPNLDMVKNEVLTLMETMQEKA-----ELMYKDCVKKILNESPKFFNVIVEKIDI 2127
             I   Q  +  ++N++  + +T  E       EL  K  V KIL    +       K+  
Sbjct: 438  RIYALQMKIQNLENDLSMMKKTHNESKSVTNDELESKSKVIKILETDLEVAQEKYLKLQS 497

Query: 2128 IRIEFQNFYK-----------NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDS 2274
               E +N YK            + E +SD++ EN+ LK  + +   K+     +    ++
Sbjct: 498  ELKERENRYKISESNLEDENIRLNERISDLARENSRLKSTVDD---KSTAVYRMKESYEA 554

Query: 2275 TYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENS 2454
              +++ K+  ++  N + +    +EE + +I +N    +     +  ++ E  R   E +
Sbjct: 555  RLDSLRKEVEEYKVNAEKS-ESKVEELRIMITENSARVSE---KRSKEMKEKERKNKELT 610

Query: 2455 FDLINKCDSMNN--EFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLK 2628
             +L  + D +++            SQ K        ++N  I  ++ ++ ESE+ +  L+
Sbjct: 611  DNLKMQEDEISSLKAMIEKYKKEFSQSKSEQSNIQRTLNLQILNLENKLIESEDELKSLR 670

Query: 2629 NN 2634
            ++
Sbjct: 671  DS 672

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 104/520 (20%), Positives = 215/520 (41%), Gaps = 32/520 (6%)
 Frame = +1

Query: 1147 AGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDRSGHIPFRESKLTRLLQDSLG 1323
            A ++ I  S A  +  +E  S  Q +  L ++ + L V RS      +  LT    D++ 
Sbjct: 336  ATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLLTVNSSDTVL 395

Query: 1324 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDI-LVKNITMELAK 1500
              ++ + I TI   +       S    + +     N P+L    MK +  V+++  ++  
Sbjct: 396  PPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVES 455

Query: 1501 IKSDLLSTKSKEGIYMSQDHYKNLNSDLESH-KN--EVQECKREIESLASKNSLLVKDKL 1671
             ++D  S  + E   +     +  N+ LES  KN   + E  ++ +SL SK ++ + ++ 
Sbjct: 456  WEADNDSGLTLEAAKLQISKLEQSNAQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQ 515

Query: 1672 KSRETIQSQNSQM-ESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYK 1848
            K  E ++S+ + + ES    IN L   +D+       I+  N +++   +    A     
Sbjct: 516  KKIEELESKLTDVGESHVQKINVLNKTIDRNQST---INMLNEQIKNTVKSDMNA----- 567

Query: 1849 KRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ---PNLDMVKNEVLT- 2016
            K EL   K+    ++++I + +     +LD +  K+  +E D Q     L +  N+  + 
Sbjct: 568  KSELIACKRENLSLTQQISTKQN----ELDELNSKSAQKERDYQLKIAELSVAANKCKSW 623

Query: 2017 -----LMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDI-IRIEFQNFYKNIAEN-- 2172
                 L+   + + E   +    KI  ES K   +     ++ ++I  +  ++  +E   
Sbjct: 624  ENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETL 683

Query: 2173 ---LSDISEENNNL------KQYLKNHFFKNNHQEL--LNHHIDSTYENIEKKTNQFVEN 2319
               ++ +SEEN +L      K+     F + + +++     +ID   E  + K+N+ +E 
Sbjct: 684  SSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIE- 742

Query: 2320 FKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFD---LINKCDSMNN 2490
                LND L    +  + N        + +  +     +A  E S     L       N 
Sbjct: 743  ----LNDKLRLLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQ 798

Query: 2491 EFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESEN 2610
             FYNN   +       + + + ++++    ++ Q+ E+EN
Sbjct: 799  NFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETEN 838

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 93/510 (18%), Positives = 212/510 (41%), Gaps = 19/510 (3%)
 Frame = +1

Query: 1465 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 1644
            + ++ +  E+AK+ SD+ +           +  K L  + +S   E++   + IESLA++
Sbjct: 919  VQIEQLNTEIAKLNSDIAALTEPA------EARKTLIKERDSLGQELKLANQRIESLAAQ 972

Query: 1645 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLD----KQHKAELEISGFNNKLQKM 1812
            NS+L  D       + +     E L+  + +L+ + D    ++  A+ ++      L+++
Sbjct: 973  NSILY-DTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEI 1031

Query: 1813 TEVMQVALQDYKKRELDLNKKFETHISKE--IKSLKTALFLQLDNMQQKNIFQETDIQPN 1986
            TE + +   +  +        F   ++ E  ++ L+      L N +++N++ +  I+ +
Sbjct: 1032 TEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELE-----GLTNTKEENLYLDESIK-S 1085

Query: 1987 LDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIA 2166
            L+  K  +   +  ++E  EL  K       N S        +KI+  + E + +     
Sbjct: 1086 LNEDKRTLQEEVSRLRESEELAKK-------NSSAISEQEWQQKIETYQQESEKWKLMCQ 1138

Query: 2167 ENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHL 2346
            +   + + E  NL+Q L+        +   N  ++  +  ++K+ ++ +   K T +   
Sbjct: 1139 QMSENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLA 1198

Query: 2347 EENKKL------IMQNMTNATSAVIDQEMDLFEPRRAKWEN------SFDLINKCDSMNN 2490
             E  +L      + + + N  +  +D E +     + K EN        +L +  DS + 
Sbjct: 1199 IELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDS-SE 1257

Query: 2491 EFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLIS 2670
            +   +M   L+ +K+      N +  S++     VE+  + +  LK  ++F D+ + LI 
Sbjct: 1258 KLIADMTKELTTLKE------NPIQGSVN-----VEDYTHRLEQLK--SEFEDEKRVLIE 1304

Query: 2671 KHII-LKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNL 2847
            K    L +  E           N++++   +E+       K     +E  +N+ K I   
Sbjct: 1305 KTTSELTERFEREKKELMNNNANLEELRKPLEE---EWERKTLQRIEEAKENLKKHI--- 1358

Query: 2848 SKRLPLRISNINGCSVQDIISPKKHTIEDE 2937
              RLP          ++ +I+ +K  +E++
Sbjct: 1359 --RLPTEE------KIERVIAKRKAQLEEQ 1380

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 109/551 (19%), Positives = 215/551 (39%), Gaps = 23/551 (4%)
 Frame = +1

Query: 1381 ETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLS--TKSKEGIYMSQ 1554
            E  ST+    K K +    Q  + M ++  +  + + L K  +D  +  TK+K  +Y +Q
Sbjct: 987  EKMSTIVQLCKKKEMS---QYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQ 1043

Query: 1555 D----HYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLK 1722
            D    H +    +   ++ E+     + ESL  +NS+L++   K  +T  +   +     
Sbjct: 1044 DLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIE---KVDDTAANNGDK----- 1095

Query: 1723 ATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEI 1902
               +HLK            +S F+N L+     ++  L   K REL   K+    + K I
Sbjct: 1096 ---DHLKL-----------VSLFSN-LRHERNSLETKLTTCK-RELAFVKQKNDSLEKTI 1139

Query: 1903 KSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILN 2082
              L+    L     Q   +     I    D+ K   +T +  ++E   ++ K  +K +  
Sbjct: 1140 NDLQRTQTLSEKEYQCSAVI----IDEFKDITKE--VTQVNILKENNAILQKS-LKNVTE 1192

Query: 2083 ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKN-HFFKNNHQELLN 2259
            ++ + +  + ++ +    E     +++ +    +S  +N +  Y       K  +Q+L  
Sbjct: 1193 KNREIYKQLNDRQE----EISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQ 1248

Query: 2260 HHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRA 2439
               D+  ++IEK TN+ + + K  L+    EN    ++N  N       +++D  + ++A
Sbjct: 1249 QQKDAQKKDIEKLTNE-ISDLKGKLSS--AENANADLENKFNRLKKQAHEKLDASKKQQA 1305

Query: 2440 KWENSFDLINKC-DSMNNEFYNNMAATLSQIKK-------TVDTSSNSMNESISVMKGQV 2595
               N  + +    D +  + +   A  +    K       + D S +   ++   +  ++
Sbjct: 1306 ALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEI 1365

Query: 2596 EESENAISLLKNNTKFNDQFKQLISKHIILKDNI------EXXXXXXXXXXXNVDDIYNT 2757
            E  +  + + K     +D F++L       KD I      E           +       
Sbjct: 1366 ESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEY 1425

Query: 2758 IEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDE 2937
             +DI T         +DE +  I +   NL KR+ L         +Q IIS +K  +E+E
Sbjct: 1426 SKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEE----RIQKIISKRKEELEEE 1481

Query: 2938 --NPSSENADS 2964
                  ENA S
Sbjct: 1482 FRKKLKENAGS 1492

 Score = 37.4 bits (85), Expect = 0.27
 Identities = 94/490 (19%), Positives = 197/490 (40%), Gaps = 36/490 (7%)
 Frame = +1

Query: 1102 QDELFRISKMNLVDLAGSENINRSGAL-NQRAKEAGSINQSLLTLGRVINALVDRSGHIP 1278
            QDEL  + K  +++ +   N N S A+  +R  E  ++N+       ++N +   +  + 
Sbjct: 484  QDELISLRK--ILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLE 541

Query: 1279 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSE-ETCSTL------EYASKAKNIKNKP 1437
              E K  + LQ       K A  A I    + ++ ET   +       Y   A   +NK 
Sbjct: 542  NYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKA 601

Query: 1438 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECK 1617
               +    +   +    ++ +++++L STK +    +     +NL  +L  +K    +CK
Sbjct: 602  NTNSVTSMEAAREK---KIRELEAELSSTKVENSAII-----QNLRKELLIYKKS--QCK 651

Query: 1618 REIESLASKNSLLVKDKLKSRETIQSQNSQMES-LKATINHLKAQLDKQ----------- 1761
            +             K  L+  E  +    + E  L+  I+HLKA+L+KQ           
Sbjct: 652  K-------------KTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVE 698

Query: 1762 -HKAELEISGFNNKLQKMT-EVMQVALQ--DYKKRELDLNKKFETHISKEIKSLKTAL-F 1926
              +A  E+S    K++ +  E+ ++  +   +   +  L + FE    KE K L+  L  
Sbjct: 699  KERASTELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFE-QCCKEKKELQMRLKE 757

Query: 1927 LQLDNMQQKNIF--QETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFF 2100
             ++ + + K  F  +E   +  +  ++N +  L   +Q K + +  + ++   +   K+ 
Sbjct: 758  SEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEI--ESIRSCKDSQLKWA 815

Query: 2101 NVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFF------KNNHQELLNH 2262
               ++  ++          N    +  +S E  NL + L+   F      +N+    L  
Sbjct: 816  QNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEP 875

Query: 2263 HIDSTYENIE---KKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPR 2433
             +    E I+   K  N  ++ ++  ++ +  EN  + ++N    T    D +++L   +
Sbjct: 876  TLRKELEQIQVQLKDANSQIQAYEEIISSN--ENALIELKNELAKTKENYDAKIEL--EK 931

Query: 2434 RAKWENSFDL 2463
            + KW    DL
Sbjct: 932  KEKWAREEDL 941

 Score = 37.4 bits (85), Expect = 0.27
 Identities = 87/407 (21%), Positives = 157/407 (38%), Gaps = 20/407 (4%)
 Frame = +1

Query: 1471 VKNITMELAK---IKSDLLSTKSKEGIYM---SQDHYKNLNSDLESHKNEVQECKREIES 1632
            V+N T++ AK   I+ + ++ K +  I +    +D YK L S         +E K    S
Sbjct: 554  VENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLAS--------TEENKANTNS 605

Query: 1633 LASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQL----DKQHKAELEISGFNN- 1797
            + S  +   K   K RE     +S      A I +L+ +L      Q K +  +  F N 
Sbjct: 606  VTSMEAAREK---KIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENF 662

Query: 1798 -KLQKMTEVMQVALQDYKKRELDLNKKFET---HISKEIKSLKTALFLQLDNMQQKNIFQ 1965
              L K  E M     D+ K EL+  K +     H+ KE  S +    L    ++ K++  
Sbjct: 663  KGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTE----LSQSRIKIKSLEY 718

Query: 1966 ETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDI-IRIEF 2142
            E      +  +K E  + + T +E     ++ C K              EK ++ +R++ 
Sbjct: 719  E------ISKLKKETASFIPT-KESLTRDFEQCCK--------------EKKELQMRLKE 757

Query: 2143 QNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENF 2322
                 N  EN  D S +    K  +K      N+ E L   + S  + IE   +      
Sbjct: 758  SEISHN--ENKMDFSSKEGQYKAKIKE---LENNLERLRSDLQSKIQEIESIRSCKDSQL 812

Query: 2323 KMTLN--DHLEENKKLIMQNMTNATSAV--IDQEMDLFEPRRAKWENSFDLINKCDSMNN 2490
            K   N  D  E   K ++  ++N  + +  +  E++  +    K +  +  +++     N
Sbjct: 813  KWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQ-----N 867

Query: 2491 EFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKN 2631
               + +  TL +  + +       N  I   +  +  +ENA+  LKN
Sbjct: 868  SDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKN 914

>KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa]
            {ON} similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 1712

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 116/638 (18%), Positives = 253/638 (39%), Gaps = 76/638 (11%)
 Frame = +1

Query: 979  ALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSE 1158
            A +G+N + R L        ++ + S++S       L   +++    + ++         
Sbjct: 828  AEDGINKMNRELLVLSREHNELKNTSTKSKNELEKVLAASNEE----LKRLQDFTREKDS 883

Query: 1159 NINRSGALNQRAKEAGSINQSLL----TLGRVINALVDRSGHIPFRESKLTRLLQDSLGG 1326
            +I +S A  +R K   S N++LL       R    L  R  +     SKLT  L+D    
Sbjct: 884  SIEKSRAELERLK---SENKALLLEKDNASRNSAELKSRLANQELLVSKLTTKLKDI--- 937

Query: 1327 NTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVK----NITMEL 1494
                    +I  AK + E   + +  +++ K +  + ++     +   +K    N+  E 
Sbjct: 938  ---AEKYKSIEQAKASKEHELAEVSESNQTKILSLQSEIVELRQQYDSMKHDKDNMLTET 994

Query: 1495 AKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLK 1674
             K+K  L   +       S+  Y     +++  K+E+    +EIE L S +    K+   
Sbjct: 995  KKLKKSLEDAERSR----SEAAY-----EIKQLKSELDHSSKEIEQLNSSSEEKSKNLAD 1045

Query: 1675 SRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKR 1854
            +  T     +++ESL  T+       DK    E  I     KLQ++ +     +   +K 
Sbjct: 1046 AVNTFNKARNELESLNKTLAEAN---DKLRSRESTIESLEEKLQELKKSSDEKIASLEKS 1102

Query: 1855 ELDLNKKFETHISKEIKSLKT--------------------ALFLQLDNMQQKNIFQETD 1974
              DL K  +     E++  KT                    +L LQ D ++Q  + +E  
Sbjct: 1103 RKDLEKFQQKFRDLELEKSKTQDALTDLQKALQDEKNNHQESLQLQKDKIKQLALEKENS 1162

Query: 1975 IQPNLDMVKNEVLTLMETMQE---KAELMYKDCVKKILNESPKFF------NVIVEKIDI 2127
             + + + +K+EV  L +T+++     +L+++D  KK+     K        ++ ++++  
Sbjct: 1163 AE-STEALKSEVSKLRQTVEDLNKSHKLVHEDYEKKVSELKKKTVSLQDESSLRLQEVSA 1221

Query: 2128 IRIEFQ---NFYKNIAENLSDISEENNNLKQYLKN------------------------- 2223
            +  E +   +  + + E  +D+ E++ N+   +K+                         
Sbjct: 1222 LNTELEETRSRAEKLEEQATDLKEKHKNICNEIKSKVKQEKEKDSRILVLDKEMKSAKTD 1281

Query: 2224 -----HFFKNNHQELLN-HHIDSTYENIEKKTNQFVENFK---MTLNDHLEENKKLI--M 2370
                 H  + ++ E+     I + +E+ E +  +  E+F     TL   L+E    +   
Sbjct: 1282 LSDIVHKLEASNSEIAKLQEIKAEFESQELEGKKQKEDFDAEIKTLRAKLKEKSAEVEKE 1341

Query: 2371 QNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTS 2550
            + M N  S+ ++QE   +  + ++ E   + +    S+ ++  +N    LS + K  ++S
Sbjct: 1342 RKMLNEGSSNLEQE---YSRKISQLEEELESLESKHSLKHQESDNEKRKLSGLLKKSESS 1398

Query: 2551 SNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQL 2664
            +   N  +  ++  +++   +   LK+  + ++Q   L
Sbjct: 1399 ATEKNRELECVRESMKKLRES---LKDKEQQSEQLSSL 1433

>Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR023W
            (REAL)
          Length = 1929

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 96/456 (21%), Positives = 189/456 (41%), Gaps = 46/456 (10%)
 Frame = +1

Query: 1423 IKNKPQLGAFM-MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKN 1599
            +K  P    F+ +K +L+ +  M   K  ++ ++ K K+ +   +   K L    +S  N
Sbjct: 839  VKEDPWFNLFIRIKPLLISSNDMSRTKKFNEQIN-KLKDNLQEMESKKKFLEDRNQSTIN 897

Query: 1600 EVQEC----KREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQ----LD 1755
            E++E     K E E+L  K SLL + K  S ET+QSQ   + + K  IN  K Q    L+
Sbjct: 898  ELKETQELLKLEQENLKKKESLLSRVKTNS-ETLQSQFDGIVTEKNEINKQKLQIIQNLE 956

Query: 1756 KQHKAELEISGFNNK---------------LQKMTEVMQVALQDYKKREL--DLNKKFET 1884
            +  +   E+ G  N+               +Q+++++     ++ K + L  +   K ET
Sbjct: 957  RAEQTIQELQGIINERETALANLNSKNEQLMQQISDLNNDISKEQKSQSLINESRLKLET 1016

Query: 1885 HISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQ----EKAELM 2052
             I K +K + ++   ++++  +K    E D+   L  ++      M  +Q    E ++L 
Sbjct: 1017 EIRK-LKEVISSKDSEINSFNEKLSSSEEDLDIKLVTLEKNCNIAMSRLQSLVAENSDLR 1075

Query: 2053 YKD--------CVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLK 2208
             K+         +   L         + EKID  + E   F K   + +S+  + +  LK
Sbjct: 1076 SKNENLQKEKAVLSNQLKNKENELQKMREKIDNHQKELAIFSKQRDDAVSEHGKISVELK 1135

Query: 2209 QYLKNHF--FKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMT 2382
            +  +N    +K+N Q+     I+  Y N +++  +  +  +  L + L +NK        
Sbjct: 1136 E-TRNQLTEYKSNCQK-----IEDEYSNFQRQIKEKEQKKRTDLAESLNDNK-------I 1182

Query: 2383 NATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSM 2562
                A + QE+ L +    +        N   +  +  Y + +     + K       + 
Sbjct: 1183 KELEARLAQEISLNQYLNKRISGPLIQSNSSPTGRSVSYADDSLNKEDVMKKYYDLQLAF 1242

Query: 2563 NESISVMKGQVEESENAISLLK------NNTKFNDQ 2652
             E    ++ ++EE +N IS L+       ++ F+DQ
Sbjct: 1243 TEVTRNLENEIEEKKNLISRLRFTETRLASSSFDDQ 1278

 Score = 41.2 bits (95), Expect = 0.018
 Identities = 66/324 (20%), Positives = 140/324 (43%), Gaps = 21/324 (6%)
 Frame = +1

Query: 1045 NDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGS----I 1212
            N+   R H    +   K+ Q+++   S   +++   ++N  +   + +R  E       +
Sbjct: 1496 NELQLREH----VHALKQAQEDIK--SMATIIERLKTQNKQKEKLIWEREMERNDSDMQL 1549

Query: 1213 NQSLLTLGRV----------INALVDRSGHIPFRESKLTRL--LQDSLGGNTKTALIATI 1356
             ++LL L RV          ++ L +R G +  R      +  L++ L  + KT      
Sbjct: 1550 QETLLELKRVQDVKKILSDDLSHLKERLGAVEDRSQYTDEINRLKEELNHSLKT------ 1603

Query: 1357 SPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKE 1536
               +   ++  +TL+Y  +  N  ++ ++   ++K +      +E+   + D +S    E
Sbjct: 1604 ---ETNLKKEFATLKYRLETSNNDSEAKISD-LLKQLDHYTKVVEMLNNERDAVSLSENE 1659

Query: 1537 GIYMSQDHYKNLNSDLESHKNEV---QECKREIES-LASKNSLLVKDKLKSRETIQSQNS 1704
             +Y     Y+ LN++ +S K+ V    + K E+ES L  K   L    +   +++Q    
Sbjct: 1660 -LYQK---YEALNTECKSLKSAVASLSKVKEELESNLKQKTEELDASSIAFSKSVQENKE 1715

Query: 1705 QMESLKATINHLKAQLDKQHK-AELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFE 1881
              E +K     LK Q+++  +  EL       KLQ  + V +    D K++ +DL ++  
Sbjct: 1716 ISEKMKYLEETLKLQIEQNARNGELV-----RKLQDNSNVFREKFDDEKQKNIDLFEE-- 1768

Query: 1882 THISKEIKSLKTALFLQLDNMQQK 1953
               ++ ++ L T L   ++N+Q +
Sbjct: 1769 ---NQSLQKLNTDLQSHVENLQDR 1789

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 83/428 (19%), Positives = 176/428 (41%), Gaps = 32/428 (7%)
 Frame = +1

Query: 1471 VKNITMELAKIKSDLLSTKSKEGIYMSQ-DHYK----NLNSDLESHKNEVQECKREIESL 1635
            ++ ++ EL  I  + L  + + G    Q D Y+    N N DL+   N V   K E++ +
Sbjct: 197  LERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTV---KNELDQM 253

Query: 1636 ASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMT 1815
             S N +L +   +    ++  ++ +++++ + N+ KA     H+ EL +       Q++ 
Sbjct: 254  KSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKAT----HEKELTLK------QQLI 303

Query: 1816 EVMQVALQDYKKR---ELDL-------NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQ 1965
             V+Q  L + ++    EL L       + + ++  ++EI  LK     QL+++Q++N+  
Sbjct: 304  VVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKN----QLNHVQERNVEL 359

Query: 1966 ETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQ 2145
            E  ++ + D       T  + ++      Y D             +V+ +K++  + + +
Sbjct: 360  EFKLRKSEDYTAVSNSTSSDDLRNSLAKAYDD------------IDVLKKKLNDEQSQRE 407

Query: 2146 NFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFK 2325
            NF KN+ E + D+  E   L+ Y               H   +  E +++ T        
Sbjct: 408  NFEKNLEEFMDDLETELPTLEAY--------------RHRAAAREEELKEAT-------- 445

Query: 2326 MTLNDHLEENKKLIMQNMTNATSAV--IDQEMDLFEPRRAKWENSFDLINKCDSMNNE-- 2493
              L +   + K L+   +  A S +  I+QE+ L   +R+   N        +S+ N+  
Sbjct: 446  -LLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSA 504

Query: 2494 ---------FYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNN---- 2634
                     F  N+     ++      +   ++E ++  K  +E  +  + LLK      
Sbjct: 505  GPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELA 564

Query: 2635 TKFNDQFK 2658
            TK  ++ K
Sbjct: 565  TKLEEEDK 572

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 68/393 (17%), Positives = 170/393 (43%), Gaps = 24/393 (6%)
 Frame = +1

Query: 1483 TMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIE----SLASKNS 1650
            +M+L   +   L ++ +  +  +QD +    +DLE   N++++  +E E    SL  + +
Sbjct: 786  SMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETT 845

Query: 1651 LLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQV 1830
             L  D  + +++++ + S +E   + I      ++K+ + + E +    +L++ TE+   
Sbjct: 846  ELKDDFRQKKKSLKEEMSNVEKRYSEI------VEKERETKWENTRLTKQLKEKTEL--- 896

Query: 1831 ALQDYKKRELDLNKKFE-THISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNE 2007
             ++ YK    D  K  E + + KE++ LK  L         ++  Q    + +++++   
Sbjct: 897  -IEKYKAASDDEGKLEEISSLQKELQVLKNEL--------TESYSQTESYRKDIELLNQS 947

Query: 2008 VLTLMETMQEKAELMYKDCVKKI---LNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLS 2178
            +  + + +  K E  +K+ + ++    N       V+  +ID +  E +   K   +   
Sbjct: 948  IADINKQVLNK-EAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKI 1006

Query: 2179 DISEENNNLKQYLKN-HFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEEN 2355
            + +   N L++  K     K ++++ L   +    E + K  N+   N++  L +H   +
Sbjct: 1007 NFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQV-KYANKAQNNYEQELQNHANVS 1065

Query: 2356 KKL-------------IMQNMTNATSA--VIDQEMDLFEPRRAKWENSFDLINKCDSMNN 2490
            K +             I +   +AT A  ++++    ++ +R ++E   +   K     +
Sbjct: 1066 KTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEES 1125

Query: 2491 EFYNNMAATLSQIKKTVDTSSNSMNESISVMKG 2589
            E  N M    S++    +   N+ +  ++ ++G
Sbjct: 1126 E-QNKMLFEQSKLTTQANDEDNAESSGVNSIEG 1157

>CAGL0D00638g Chr4 complement(80947..83028) [2082 bp, 693 aa] {ON}
            similar to uniprot|Q07457 Saccharomyces cerevisiae
            YDL074c BRE1
          Length = 693

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 85/414 (20%), Positives = 171/414 (41%), Gaps = 24/414 (5%)
 Frame = +1

Query: 1504 KSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRE 1683
            +S  ++ + K+ +++    Y+N  +DLESH + +    R IE L +   L  K+  ++R 
Sbjct: 236  QSSGITEEEKKKLFLQ---YENKITDLESHNSSL---NRIIEELENYKQLNEKELAQTRL 289

Query: 1684 TIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELD 1863
             I +  S+  S +     L  Q++K       +   N  L    E      Q+  K +  
Sbjct: 290  EISNLLSEKHSNEEEREDLLHQIEK-------LKASNTDLTLTNESFLSKFQELAKEKDT 342

Query: 1864 LNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKA 2043
              +K  +   K ++SLK            +N+  E D+          V T  + +  K 
Sbjct: 343  FQEKISSDFEKTLESLKA-----------QNLALEKDLV--------RVRTTRDELISKV 383

Query: 2044 ELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQ--NFYKNIAENLSDISEENNNLKQYL 2217
             ++  +  K +L    K      + +DI+R +++   F  N + +   + +E  +L+   
Sbjct: 384  AILEAETSKSVLISDLK------QALDILRDQWEKIEFRNNQSPSSDALLKEIQDLESAF 437

Query: 2218 K--NHFFKNNHQELLNHH-------IDST------YENIEKKTNQFVENFKMTLNDHLEE 2352
            K  +      + E LNH        I+ T      + ++  K +  VEN    L+  L +
Sbjct: 438  KELSSLTHKKYSEYLNHESVISKLTIEKTKADQKYFASMRSKDSILVEN--KNLSKSLNK 495

Query: 2353 NKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIK 2532
              +LI+Q     T  +  Q+++    + A  +N+   +   +   N    N+ + + + K
Sbjct: 496  ANELILQ--LKDTDKLYKQKIESLHKQLALSQNNEKRLVDSNKAANLKVMNLNSEIQKQK 553

Query: 2533 KTVDTSSNSMNESISVM---KGQVEESENAISLLKNN----TKFNDQFKQLISK 2673
            K +D +S+  NE I+ +    G ++  E  I   +N      K N++ ++ +SK
Sbjct: 554  KLLDFTSSQKNELINELTEANGMLKSKELEIEFKENELQTALKKNEKLEEFLSK 607

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 83/406 (20%), Positives = 150/406 (36%), Gaps = 26/406 (6%)
 Frame = +1

Query: 1555 DHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATIN 1734
            D + NL   L  + N       +I+SL  +     K K + R   +    +++SLKA  +
Sbjct: 110  DEFLNL---LRKYTNSNGSSDSKIDSLGLELQRANKTKSELRLQNKKLTDEIDSLKAYYH 166

Query: 1735 HLKAQLDKQ-----------HKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFE 1881
             L    D++            K +      +N  Q+ T V  V                 
Sbjct: 167  GLVRSYDREDSMTVKRVFNKQKTDDNTDNISNTEQRPTSVSPVLTNG------------A 214

Query: 1882 THISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKD 2061
            TH+  E+K+ + AL    D+ Q   I +E   +  L +     +T +E+        +  
Sbjct: 215  THVKNEVKTEQEALNNHTDSSQSSGITEEE--KKKLFLQYENKITDLES--------HNS 264

Query: 2062 CVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNN 2241
             + +I+ E   +  +  +++   R+E  N       N     EE  +L   ++     N 
Sbjct: 265  SLNRIIEELENYKQLNEKELAQTRLEISNLLSEKHSN----EEEREDLLHQIEKLKASNT 320

Query: 2242 HQELLNHHIDSTYENIEKKTNQFVE----NFKMTLNDHLEENKKLIMQNM-TNATSAVID 2406
               L N    S ++ + K+ + F E    +F+ TL     +N  L    +    T   + 
Sbjct: 321  DLTLTNESFLSKFQELAKEKDTFQEKISSDFEKTLESLKAQNLALEKDLVRVRTTRDELI 380

Query: 2407 QEMDLFEPRRAKWENSFDLINKCDSMNN-----EFYNNMAATLSQIKKTVDTSSNSMNES 2571
             ++ + E   +K     DL    D + +     EF NN + +   + K +    ++  E 
Sbjct: 381  SKVAILEAETSKSVLISDLKQALDILRDQWEKIEFRNNQSPSSDALLKEIQDLESAFKEL 440

Query: 2572 ISVMKGQVEE---SENAISLLKNNTKFNDQ--FKQLISKHIILKDN 2694
             S+   +  E    E+ IS L       DQ  F  + SK  IL +N
Sbjct: 441  SSLTHKKYSEYLNHESVISKLTIEKTKADQKYFASMRSKDSILVEN 486

 Score = 38.5 bits (88), Expect = 0.10
 Identities = 45/220 (20%), Positives = 98/220 (44%), Gaps = 14/220 (6%)
 Frame = +1

Query: 1357 SPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSD---LLSTK 1527
            SP+     +    LE A K  +     +   ++  + ++  +T+E  K K+D     S +
Sbjct: 420  SPSSDALLKEIQDLESAFKELSSLTHKKYSEYLNHESVISKLTIE--KTKADQKYFASMR 477

Query: 1528 SKEGIYMSQDHYKNLNSDLESHKNEVQECK-------REIESLASKNSLLVKDKLKSRET 1686
            SK+ I +     KNL+  L      + + K       ++IESL  + +L   ++ +  ++
Sbjct: 478  SKDSILVEN---KNLSKSLNKANELILQLKDTDKLYKQKIESLHKQLALSQNNEKRLVDS 534

Query: 1687 IQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDL 1866
             ++ N ++ +L + I   K  LD     + E+     +   M +  ++ ++ +K+ EL  
Sbjct: 535  NKAANLKVMNLNSEIQKQKKLLDFTSSQKNELINELTEANGMLKSKELEIE-FKENELQT 593

Query: 1867 ----NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETD 1974
                N+K E  +SKE  ++     L   N+ + ++ +E +
Sbjct: 594  ALKKNEKLEEFLSKENYNMNKPSSLATTNLDEDSMAEELE 633

>Skud_16.106 Chr16 complement(192440..195055) [2616 bp, 871 aa] {ON}
            YPL174C (REAL)
          Length = 871

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 65/309 (21%), Positives = 135/309 (43%), Gaps = 5/309 (1%)
 Frame = +1

Query: 1594 KNEVQECK-REIESLASKNSLLVKDKLKSRET-IQSQNSQMESLKATINHLKAQLDKQHK 1767
            +N +Q C     E    KN   + DK+K+ +   +S  S+++  +   + L+A ++    
Sbjct: 85   RNALQLCNPANNEPSLLKNDNTLHDKVKALQVQCESLTSELDVSEQQKDQLRAAIENLSI 144

Query: 1768 AELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQ 1947
            +E ++    + L K+ E ++V   D K R        E  IS ++ +   A    +  + 
Sbjct: 145  SESDLLSQTSGLNKLVEALKVENDDMKIR------LEEFAISTDLSNNTVAQNFDVKKLW 198

Query: 1948 QKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCV--KKILNESPKFFNVIVEKI 2121
              N   +  ++         +    + ++E  +L+ ++    KKI +++ +     V   
Sbjct: 199  DNNRLLQGLLEQTTASYNEAMKVQEDLLEENTQLLEENTALSKKISDQTLRLEQTNVTIS 258

Query: 2122 DIIR-IEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKK 2298
            D+ + +E Q+   NI + L++ +    N  + LK    +   +E LN H+  TYE +E++
Sbjct: 259  DLAQQLEAQSKSSNIVDKLTNDNILLTNDIKSLKKQIKEVCAKEKLNEHLRFTYEELEQE 318

Query: 2299 TNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCD 2478
             N  + N +  L     ENK+++  N     +A +   + L E +        +L  K +
Sbjct: 319  LNLQLSNLQSAL-----ENKQILANNYIE-ENARLKSMLKLSESQATDKCQGLEL--KVN 370

Query: 2479 SMNNEFYNN 2505
            ++N E Y N
Sbjct: 371  TLNEELYQN 379

>SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 963

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 113/550 (20%), Positives = 223/550 (40%), Gaps = 11/550 (2%)
 Frame = +1

Query: 1009 GLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL-FRISKMNLVDL-AGSENINRSGAL 1182
            G+K+ +V   KM   S R++    I  Y+K+ +EL  +++ +N   +   +E      AL
Sbjct: 457  GVKNHEVEDLKMQLESLRNNNSDVIKNYEKNLNELNKKVADVNEKKVKLENETKTLQTAL 516

Query: 1183 NQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1362
             +  +E   + ++L      I+ +            K +  L D L          ++  
Sbjct: 517  AKSHQEKDELKKNLSESKEFISKI-----------RKESNTLADQLREYNFLKKNESVMK 565

Query: 1363 AKVT-SEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEG 1539
              +T  E+T S LE   +  N+K +    +  ++D  ++N  +      S  L T +KE 
Sbjct: 566  LSITQKEKTISYLEQQIRDYNVKEETTKNS--LRDAKLENEHL------SKKLDTLTKEN 617

Query: 1540 IYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESL 1719
              + +D  KN +  LE +  E  +    ++ L  K   L   K  S       N Q++S+
Sbjct: 618  ESLKKDVKKN-DGSLEQYIKENGKLSERLDILQEKYDTLQNMKSNS-------NDQVDSI 669

Query: 1720 KATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYK-KRELDLNKKFETHISK 1896
            +     L  +L + +K    I    ++L + T ++Q   ++    R L  + + +  I  
Sbjct: 670  RRQCEELNVKLKESNK---RILSLEDELNESTSILQERTRETNTMRRLLADSENDRGIKL 726

Query: 1897 EIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLME-TMQEKAELMYKDCVKK 2073
            +    K A+ L+  +  Q  +  +T  +        E+  L E  M+ K+E+        
Sbjct: 727  KELQEKFAITLEEKSKLQSELTLQTSRK------TREIQELRELNMELKSEI-------H 773

Query: 2074 ILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQEL 2253
             LN   K     +E +  +    Q      AE+  ++    ++LK+ L     K    E 
Sbjct: 774  TLNLKIKQQQSEIEHLSSVNRNMQRKSSASAESSGELDNVVSSLKEALSRSEKKIRDTEN 833

Query: 2254 LNHHIDSTYENIEKKTNQFVENFK--MTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFE 2427
            +N  +    +++ KK ++  +N+K   T  + L+E    +  + +N+++  +        
Sbjct: 834  INEELKDLNKDLNKKLDRLSKNYKTVSTQLNLLKEGNSPVPPSRSNSSTFTLS------- 886

Query: 2428 PRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMK----GQV 2595
                  +N+ D +++  S+ NE  +N  +T        DT S  +NE I+ +K    G +
Sbjct: 887  ------DNASDSVSRRPSLVNESSSNTVST--------DTRS-ELNEKIAYIKNVLLGFL 931

Query: 2596 EESENAISLL 2625
            E  E    LL
Sbjct: 932  EHREQRSQLL 941

>KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {ON}
            Anc_5.414 YDR356W
          Length = 1040

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 69/411 (16%), Positives = 165/411 (40%), Gaps = 28/411 (6%)
 Frame = +1

Query: 1516 LSTKSKEG---IYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKS--- 1677
            LS K KE    +   ++ ++ +N+DL+   + ++E  R+ E    +    +KD +KS   
Sbjct: 315  LSEKVKETTLKLTQQREEFEKVNNDLKQKLSALREDLRKKEDQHERELRKLKDTIKSSSN 374

Query: 1678 --RETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKK 1851
               E I+S    +E+ +  +  L+  L K  +   E+    N +      +Q   +++K+
Sbjct: 375  DNTEFIESLKKDVETKRTRLAQLETDLQKSKRRVTELESTLNTINTQYSDIQ---KEFKE 431

Query: 1852 RELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETM 2031
             ++D +++   +I    K        +++ ++  ++ + T ++ N D +  E+ +    +
Sbjct: 432  YQIDTDRRL-NNIDNSDKRHLVEHSKEIERVKADHLLEMTQLEKNYDSLLTELNSSKAEL 490

Query: 2032 QEKAELMYKDCVK-------------KILNESPKFFNVIVEKIDIIRIEFQNFYKNIAEN 2172
             EK E    +  K             +++N        + ++I     + ++    + + 
Sbjct: 491  SEKLEGAESELAKCKEELNSKKIEHERLINSHETNVKSLKDQIYDQTTQIRSLESTVDDL 550

Query: 2173 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLN--DHL 2346
             +DI  +   L   L+  + + + +   N+ I    E I +     + +    LN  + L
Sbjct: 551  SADIGRKEAAL-LLLQTKYDELSDRYQSNNEISQDVEKITRSLENQINDLNHKLNHANIL 609

Query: 2347 EENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQ 2526
               K   + + +N  S+       L      K E       K   + ++ +N       +
Sbjct: 610  LSTKDAELSSTSNELSSATTSIKKLTAQIHDKTEKIEQSRAKISQLESQLFNKTIKASKE 669

Query: 2527 IKKTVDTSS---NSMNESISVMKGQVEESENAISLLKN--NTKFNDQFKQL 2664
              KT++T +   + + E +   K + + +    ++L+   + K+ DQ K L
Sbjct: 670  SLKTIETKNAQIDDLTEQLEKAKSEFDRALKTNNILEEQISRKYQDQIKDL 720

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 110/547 (20%), Positives = 212/547 (38%), Gaps = 13/547 (2%)
 Frame = +1

Query: 991  LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 1170
            LN +    K   V  +K  +     H +  +T  +K+ D L  ++++N      SE +  
Sbjct: 440  LNNIDNSDKRHLVEHSKEIERVKADH-LLEMTQLEKNYDSL--LTELNSSKAELSEKLE- 495

Query: 1171 SGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKT--AL 1344
             GA ++ AK    +N   +   R+IN+                + L+D +   T    +L
Sbjct: 496  -GAESELAKCKEELNSKKIEHERLINS-----------HETNVKSLKDQIYDQTTQIRSL 543

Query: 1345 IATISPAKVT-SEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLS 1521
             +T+         +  + L   +K   + ++ Q    + +D  V+ IT  L    +DL  
Sbjct: 544  ESTVDDLSADIGRKEAALLLLQTKYDELSDRYQSNNEISQD--VEKITRSLENQINDLNH 601

Query: 1522 TKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQN 1701
              +   I +S       +++L S  NE+      I+ L ++    + DK +  E  +++ 
Sbjct: 602  KLNHANILLSTK-----DAELSSTSNELSSATTSIKKLTAQ----IHDKTEKIEQSRAKI 652

Query: 1702 SQMES--LKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKK 1875
            SQ+ES     TI   K  L        +I     +L+K       AL+     E  +++K
Sbjct: 653  SQLESQLFNKTIKASKESLKTIETKNAQIDDLTEQLEKAKSEFDRALKTNNILEEQISRK 712

Query: 1876 FETHISK---EIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAE 2046
            ++  I     E+  L   L ++     ++      DIQ   D       TL +T+Q +  
Sbjct: 713  YQDQIKDLEDEVDGLSNTLRIRTREENERIKQLNEDIQEWQDRYD----TLNDTLQSQIS 768

Query: 2047 LMYKDCVKKILN---ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYL 2217
                    + L+   E       + EK   I          + +  + I EEN+NL+ YL
Sbjct: 769  KRSHSTRAEQLSFKRERESLLQEVAEKDGEI--------DKLKQKNTSILEENDNLRDYL 820

Query: 2218 KNHF-FKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATS 2394
            K+     +  ++L+  + D      E+  +   EN  + L + L   +   +   ++  S
Sbjct: 821  KSSSKLSSGFEQLMTKYKDMKRTFAERVASLEKEN--LELEESLHRTRIDALSRDSSGPS 878

Query: 2395 AVIDQ-EMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNES 2571
              +D+   DL +  R K+ N     N    MN+     + AT  +++  +      ++ S
Sbjct: 879  PNVDRTHADLADYYRIKYHNEVTHNNDMKVMNDYLNLVLRATTQKLRTDLRRVKRELSTS 938

Query: 2572 ISVMKGQ 2592
             ++  GQ
Sbjct: 939  GALFSGQ 945

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
            YGR238C
          Length = 1086

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 93/468 (19%), Positives = 182/468 (38%), Gaps = 6/468 (1%)
 Frame = +1

Query: 1573 NSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATIN-----H 1737
            +SD+ S+K E +E + E            +D++K +E    +    E +++ +      H
Sbjct: 651  SSDISSNKEEKEEEETE------------EDQVKEQEQPSKEEEHEEEMESMVESDIRPH 698

Query: 1738 LKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKT 1917
            L  +   +  +E EIS  N  +      +  A+ +  + EL+  K      + E  S   
Sbjct: 699  LTDEESVEESSEKEIS-LNKPVDNTQITIDRAMLEQMRSELEGLKTDGETKAIEASSRIQ 757

Query: 1918 ALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKF 2097
             L  +L N++   +  +  ++P LD+VK         +Q + +++  +            
Sbjct: 758  ELEAELQNLKANRM--DKQVEPELDVVK---------LQSRCDVLEGNN----------- 795

Query: 2098 FNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDST 2277
             +++ +K+  +       + ++    + I +++N L QY +    K  +++L +      
Sbjct: 796  -HILEDKVTELESLLNAKFLDVGNLNTIIKQQSNQLDQYNQESSIKEEYEKLQDQF---- 850

Query: 2278 YENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSF 2457
              ++ KK N   E  K T+ND       L ++N   + S ++D  +  +     K +N  
Sbjct: 851  --DLVKKEN---ETLKQTVND-----LNLGLKNDITSYSTLLDDFLGQW-----KQKNLA 895

Query: 2458 DLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNT 2637
            +  ++    + E YN         K  VD  SN ++E IS  K   +  E          
Sbjct: 896  NTDDESKLKSVETYNQ------HHKAVVDKLSNRLDELISKSKEMTQSKE---------- 939

Query: 2638 KFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKD-EM 2814
            K N ++K L  KH  L   +            N  D  NT+          +NA+K  E+
Sbjct: 940  KLNQEYKALEMKHSTLSQELLSKKSKLDIIESNYKDSLNTV----------QNASKALEV 989

Query: 2815 IDNILKEIPNLSKRLPLRISNINGCSVQDIISPKKHTIEDENPSSENA 2958
                L +   L+K+L   +  +   S         HTI D+   S ++
Sbjct: 990  SQQELTKYRELNKKLQEEVDELKYRSA--------HTINDQTGDSPDS 1029

>TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1915

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 88/425 (20%), Positives = 176/425 (41%), Gaps = 33/425 (7%)
 Frame = +1

Query: 1477 NITMELAKIKSDLLSTKSKEGIYMSQ-DHYKNLNSDLESHKNEVQECKREIESLASKNSL 1653
            +I+ +L +   DL     +  I  S  DHYK     +ES+   V E +R  E L S + +
Sbjct: 1532 DISTKLQECMVDLQKKDDQINILKSSIDHYKGEMIKMESNLTNVDELERLREELHSFSKI 1591

Query: 1654 LVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMT---EVM 1824
                + + ++TI + N  +E+L+       A+L +++      S + +KL+++T   + +
Sbjct: 1592 ----ETEYKKTISNLNYNLETLQNDYEANVAELLREN------SHYTSKLEQLTLDRDNI 1641

Query: 1825 QVALQDYKKR-------------ELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQ 1965
                QD  KR             ELD  + F  ++ K++ S+   L    D + +     
Sbjct: 1642 IAENQDISKRYSESIVTQNNLIKELDDIRDFCANLEKKLSSMDIELVTTKDKLYKT---- 1697

Query: 1966 ETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQ 2145
               I  N D++ N+               Y +   K+  E  +  + ++EK+ +   + +
Sbjct: 1698 ---ITENTDLLNNKA--------------YLEDALKLQGEQIERSSQLIEKLQMEVNDSK 1740

Query: 2146 NFYKNIAENLSDISEEN----------NNLKQYLKNHFFKNNHQELLNHHIDSTYENIEK 2295
              Y ++ +   D+SEEN          NN  + L+      + ++L +  ++   + +  
Sbjct: 1741 LKYDDLKQKKIDVSEENTTINKLNMKLNNDIKLLEKQLADTSEKDLWSSRLNELQDQLTS 1800

Query: 2296 KTNQFVENFK--MTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWE-NSFDLI 2466
            +TN   E  K    L + LE+ K L  + M         + + +    R K E +S + I
Sbjct: 1801 ETNMKYELIKENKVLGNDLEDLKNLNTKQM---------EIIKIANEERKKLEGDSMEYI 1851

Query: 2467 NKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVE---ESENAISLLKNNT 2637
            NK  ++  +    ++     IK+ +  +S    E +  +  +VE   +   ++S  KN+ 
Sbjct: 1852 NKVSNLEKQ----LSKQQLDIKRMIRDNS-YFEEKVEELDKEVEYWKQKFQSLSPNKNDA 1906

Query: 2638 KFNDQ 2652
              N Q
Sbjct: 1907 NVNSQ 1911

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 69/395 (17%), Positives = 161/395 (40%), Gaps = 3/395 (0%)
 Frame = +1

Query: 1471 VKNITMELAKIKSDLLS--TKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 1644
            +K++ ++L+  ++DL S     ++   ++    K L +D  S K ++   KR+ E    +
Sbjct: 1031 IKDMELQLSNSENDLDSKLVTLEKNCNVALVRLKTLLNDNSSLKTQIATLKRDHELFEQQ 1090

Query: 1645 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 1824
              L + +    ++ +  QN  +++L+           ++ K  LE +    +L K  E +
Sbjct: 1091 LKLKIAETDALQQKLFQQNQTLKTLQ----------QEKSKILLENTSMTKELNKTKENL 1140

Query: 1825 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 2004
            +V +Q+++  EL+   +      + +KS      ++L+    +   +  ++   +  + N
Sbjct: 1141 KVYIQNFQ--ELEQKHRALEEQQRSVKSGDEGRIMKLETRISEESARNKNLSEEIKRMNN 1198

Query: 2005 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 2184
            +              M     + I+NES      +  KID++  E Q+    +A N +  
Sbjct: 1199 D------------RAMELSINRSIVNESDHNVEKMASKIDLLEAELQDL--TVAFNKATE 1244

Query: 2185 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 2364
            +E+N   K         +   E+       T  +   K  + +E+  + +N    +N+ L
Sbjct: 1245 NEKNMTSKLRFTETKLASTVLEI------QTVTSQRNKLRKIIESSDLKVN---LDNELL 1295

Query: 2365 IMQNMTNATSAVIDQEMD-LFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 2541
             + N +  ++  +  E   L +    + +  +D   K  S++ +F  +    +S     +
Sbjct: 1296 KVDNTSEISAKQLTLEAQYLRKQLEIETKARYDAEAKLSSLSKKFEKSSGDAIS--SPNL 1353

Query: 2542 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFN 2646
             T   +  E +     Q+E    ++S L++ T  N
Sbjct: 1354 ITKLKASEEKVR----QLEIRLKSMSPLRDRTNIN 1384

 Score = 39.3 bits (90), Expect = 0.071
 Identities = 68/341 (19%), Positives = 142/341 (41%), Gaps = 8/341 (2%)
 Frame = +1

Query: 1366 KVTSEETCS-TLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGI 1542
            K+T  +    T +   K   + N   L     K +    +  E AK++  +L+ K     
Sbjct: 877  KITESQCVDLTRKLCDKESELTNVQALLQEESKKLKEHEMLAEEAKVQEGILTEKL---- 932

Query: 1543 YMSQDHYKNLNSDLESHK----NEVQECKREIESLA-SKNSLLVKDKLKSRETIQSQNSQ 1707
                D  + +N ++ES++    +E ++   +IESL  S N    + K    +  Q    +
Sbjct: 933  ----DELRTINKEIESNQAILASENKDYIEKIESLEKSINEQEQETKTLYEKREQKYIIE 988

Query: 1708 MESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETH 1887
            +  L+A    LKA+ +  H   L  +   +KL K+T+V        K  EL L+   E  
Sbjct: 989  ISELEAD---LKAKKETLHSLTLNNNELTDKLSKLTKVESEQRLKIKDMELQLSNS-END 1044

Query: 1888 ISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCV 2067
            +  ++ +L+    + L  ++ K +  +         +K ++ TL     ++   +++  +
Sbjct: 1045 LDSKLVTLEKNCNVAL--VRLKTLLNDN------SSLKTQIATL-----KRDHELFEQQL 1091

Query: 2068 KKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQ 2247
            K  + E+      + ++   ++   Q   K + EN S +++E N  K+ LK   +  N Q
Sbjct: 1092 KLKIAETDALQQKLFQQNQTLKTLQQEKSKILLENTS-MTKELNKTKENLK--VYIQNFQ 1148

Query: 2248 ELLNHH--IDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 2364
            EL   H  ++    +++      +   +  +++    NK L
Sbjct: 1149 ELEQKHRALEEQQRSVKSGDEGRIMKLETRISEESARNKNL 1189

>CAGL0L02695g Chr12 (317998..319377) [1380 bp, 459 aa] {ON} similar to
            uniprot|Q12234 Saccharomyces cerevisiae YOR216c RUD3
          Length = 459

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 66/325 (20%), Positives = 142/325 (43%), Gaps = 11/325 (3%)
 Frame = +1

Query: 1474 KNITMELAKIKSDLLSTKSKEGIYMSQ--------DHYKNLNSDLESHKNEVQECKREIE 1629
            +NI  EL ++K++    +S+    +S+           K   ++LE  K ++QE + +  
Sbjct: 90   ENIREELERVKTERDQVESQYQTLLSRLSSMKTIFSKMKESEAELEVVKEQLQEYENQNL 149

Query: 1630 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 1809
            +L +K SLL K+K +  ET  + N ++ESL+   +  ++  DK  +++  I    ++L+ 
Sbjct: 150  NLKNKVSLLTKEKKELEETATTLNKELESLE---SEQESNDDKLKESQTRIKELEHQLEA 206

Query: 1810 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQ---KNIFQETDIQ 1980
             +E+ +      KK    LN + +             L + +DN +Q    +  +  D++
Sbjct: 207  KSEISKSESGRLKKENEQLNSQVQ------------ELLVVIDNNKQDLSASKEEIEDLK 254

Query: 1981 PNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKN 2160
             N++ ++NE + L     +    +  D V+K   E     N+   +I+ +R +     + 
Sbjct: 255  QNVENLENEKVKLQNAFNDME--LQLDAVEKANKEQLDEKNL---EINALRTQLDQAIEA 309

Query: 2161 IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND 2340
                +S + E    L    ++   K   ++    H  S    +  +T        + LN+
Sbjct: 310  KNAEISKMEELEKKLAAMKQDVTLKEKFEKESKEHA-SQIAKLRHET--------IVLNE 360

Query: 2341 HLEENKKLIMQNMTNATSAVIDQEM 2415
            HL +   ++ Q   ++ S  +D+E+
Sbjct: 361  HLTKALAMLKQ---SSDSESVDKEL 382

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 56/272 (20%), Positives = 109/272 (40%), Gaps = 3/272 (1%)
 Frame = +1

Query: 2161 IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVEN-FKMTLN 2337
            +AE  +++SE+   ++  L+      + ++      D   +N E+  +  V+N  + T N
Sbjct: 18   VAEQPAEVSEKEVEVEVPLERLDGAQDSEDDSRLEADKHEQNSEEVGSDKVDNEVEETRN 77

Query: 2338 DHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFD-LINKCDSMNNEFYNNMAA 2514
            D  E +        T  T   I +E++  +  R + E+ +  L+++  SM          
Sbjct: 78   DGAENSN-------TGNTDENIREELERVKTERDQVESQYQTLLSRLSSM---------- 120

Query: 2515 TLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTK-FNDQFKQLISKHIILKD 2691
                  KT+ +        + V+K Q++E EN    LKN       + K+L      L  
Sbjct: 121  ------KTIFSKMKESEAELEVVKEQLQEYENQNLNLKNKVSLLTKEKKELEETATTLNK 174

Query: 2692 NIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRI 2871
             +E            + +    I+++      K   +K E    + KE   L+ ++   +
Sbjct: 175  ELESLESEQESNDDKLKESQTRIKELEHQLEAKSEISKSES-GRLKKENEQLNSQVQELL 233

Query: 2872 SNINGCSVQDIISPKKHTIEDENPSSENADSE 2967
              I+  + QD +S  K  IED   + EN ++E
Sbjct: 234  VVIDN-NKQD-LSASKEEIEDLKQNVENLENE 263

>Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON}
            (38596..41385) [2790 nt, 930 aa]
          Length = 929

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 77/384 (20%), Positives = 161/384 (41%), Gaps = 19/384 (4%)
 Frame = +1

Query: 1789 FNNKLQ--KMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF 1962
            FN+ +Q       + V LQ  K   +++NKK   ++ KE+K    A     +  QQ+ + 
Sbjct: 71   FNDSMQFDDTLPELDVNLQSSKLTSINMNKK---NLIKELKENSNASNPLKE--QQEQLS 125

Query: 1963 QETDIQPNLDMVKNEVLTLMETMQEKAELMYK-DCVKKILNESPKF------FNVIVEKI 2121
            + T    NL +  N +L ++  + ++ EL    + + +I     K+      FN++  K 
Sbjct: 126  KLTTENYNLKLKCNSLLKVLNNVTDQGELRKSLEFLDEIEEWKSKYSTANSEFNLLKIKY 185

Query: 2122 DIIRIEFQNFYKNIAENLSDISEENNNL--KQYLKNHFFKNNHQ-ELLNHHIDSTYENIE 2292
            D + I+F+N    + E  S++ +    +  +  L+N   K + +   LN  +D+  + + 
Sbjct: 186  DDLVIKFRNLESKVDEQESEVEDHTRCIIERDNLQNKIDKLSEELGTLNDKLDTITKELI 245

Query: 2293 KKTNQFVENFK--MTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLI 2466
             K      N +    LN H++      ++N        I ++ D  + ++ + +   + +
Sbjct: 246  AKDELIASNEEDIKQLNSHID-----TLKNTIRGLEETIIEKDDNLKKQKDEIKTLNNNL 300

Query: 2467 NKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKN----- 2631
            N  D + +EF              +       N  ISV++  + +S+N  + LK      
Sbjct: 301  NDSDHLGSEFL------------LLQNKLKEKNSQISVLENNLIDSKNTATELKTRLENL 348

Query: 2632 NTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDE 2811
              +++D+ ++ I++   L DNI+           ++D      +D      N  N     
Sbjct: 349  QKEYDDKLREKINQIHKLDDNIKQLKSERDSKYVSLDTNDKVRKDFERMRENNAN----- 403

Query: 2812 MIDNILKEIPNLSKRLPLRISNIN 2883
             +D+ L +I N +K    +IS ++
Sbjct: 404  -LDSKLSQISNENKLFRDKISKLS 426

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 76/418 (18%), Positives = 169/418 (40%), Gaps = 58/418 (13%)
 Frame = +1

Query: 1486 MELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKD 1665
            +EL K + D + T +     ++ D  + +    E+H NE+Q    +   + + +   V+D
Sbjct: 440  VELMKRRIDEIITNNNRENSIAADKSEEIREKQEAHINELQRKLNDTLKVQTLSISTVED 499

Query: 1666 K-----LKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQV 1830
            K     LK+++ ++    +++  +  +  LK Q+         I    N  ++ ++ ++ 
Sbjct: 500  KFKAEILKTKKELEENAQKLQKSEELVKELKRQV---------IENTTNASERNSKRLET 550

Query: 1831 ALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNM-----------QQKNIFQETDI 1977
                 K +E++L K     +  +I SL+    L+ +N+           +++++ ++  +
Sbjct: 551  -----KDKEINLLKNDIIELKNKINSLEKDSKLEDNNLREYYTNKIRQIEEESLNEKVKL 605

Query: 1978 QPNLDMVKNEVLTLMETMQEKAELMYKDC--------------------VKKILNESPKF 2097
            +  + M+K+E  TL+E+ +         C                    V   LN+  K 
Sbjct: 606  EREIFMLKSERDTLIESNKHDINFWKSKCNSLEKQNEALLSQENEGFSSVNLKLNQRLKE 665

Query: 2098 FNVIVEKIDIIRIEFQNFYKNIA-----------ENLSDISEENNNLKQYLKN-HFFKNN 2241
             + ++ + + ++ +     + ++           E    +++ +   K+Y K+  F K  
Sbjct: 666  LDELLNQNNTLKKDNMELTRKLSKSQILNEEYKVELRKAVADLDMATKEYQKSKDFTKIR 725

Query: 2242 HQELLNHHIDSTYENI---EKKTNQFVENFKMTLNDHLEEN----KKLIMQNMTNATS-- 2394
              +  N  +D+  +N+   + K N   +++   L++  EEN    KKL M   T+ +S  
Sbjct: 726  GSDDSNFELDNMRKNLLIMKTKYNNIKKDYLTKLSELQEENLQLEKKLSMNQPTSRSSDN 785

Query: 2395 -AVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMN 2565
             A + Q  D  +  R K+ N     N    MN      + A   QI+  +      MN
Sbjct: 786  AAAVQQ--DRIDYYRLKYHNEVKSNNDLKVMNEYLNRVLMAGSQQIRLDLLKLKEEMN 841

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
            SMC2Subunit of the condensin complex; essential SMC
            chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase; Smc2p/Smc4p complex
            binds DNA; required for clustering of tRNA genes at the
            nucleolus
          Length = 1170

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 62/278 (22%), Positives = 133/278 (47%), Gaps = 19/278 (6%)
 Frame = +1

Query: 1459 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQ--DHYKNLNSDLESHKNE-------VQE 1611
            K + +K    E++ I+ D+    S +G  +++     K L  +LE  ++E        Q 
Sbjct: 764  KQMSLKKCQEEVSTIEKDMKEYDSDKGSKLNELKKELKLLAKELEEQESESERKYDLFQN 823

Query: 1612 CKREIESLASK---NSLLVKDKLKSRETIQSQNSQME----SLKATINHLKAQLDKQHKA 1770
             + E E L+S+   N  L+ + LKS E+++ +NS +E     ++  +  ++ +L+++ K 
Sbjct: 824  LELETEQLSSELDSNKTLLHNHLKSIESLKLENSDLEGKIRGVEDDLVTVQTELNEEKKR 883

Query: 1771 ELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQ 1950
             ++I    N+L+ + +  Q    + K  EL+L K    H   + KS    +   +++++Q
Sbjct: 884  LMDIDDELNELETLIKKKQ---DEKKSSELELQKL--VHDLNKYKSNTNNMEKIIEDLRQ 938

Query: 1951 KNIFQETDIQPNLDMVKNEVLTLMETMQEKAELM---YKDCVKKILNESPKFFNVIVEKI 2121
            K+ F E D     ++VK      ++T +E+++ +   +++  KK+   +P   N+I E +
Sbjct: 939  KHEFLE-DFDLVRNIVKQNEGIDLDTYRERSKQLNEKFQELRKKV---NPNIMNMI-ENV 993

Query: 2122 DIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFK 2235
            +      +   K I ++   I E  + L +Y +    K
Sbjct: 994  EKKEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVK 1031

 Score = 38.9 bits (89), Expect = 0.088
 Identities = 45/232 (19%), Positives = 90/232 (38%), Gaps = 4/232 (1%)
 Frame = +1

Query: 1942 MQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKI 2121
            +Q+       +I+P L+ ++NE    +E    + +L                     EK 
Sbjct: 192  LQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDL---------------------EKT 230

Query: 2122 DIIRIEFQNFYKNIAENLSDISE--ENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEK 2295
            + I + ++  Y NI    + I E  EN   +  + N F K   +E     IDS  E++E 
Sbjct: 231  ERIVVSYE--YYNIKHKHTSIRETLENGETRMKMLNEFVKKTSEE-----IDSLNEDVE- 282

Query: 2296 KTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKC 2475
                     ++ L    E +K+  +  + N  + ++++   L      K EN  D   K 
Sbjct: 283  ---------EIKLQKEKELHKEGTISKLENKENGLLNEISRLKTSLSIKVENLNDTTEKS 333

Query: 2476 DSMNNEFYNNMAATLSQIKKTVDTSSN--SMNESISVMKGQVEESENAISLL 2625
             ++ +E  ++ A  + +     +T  +   + E +S  +   +  E  +S L
Sbjct: 334  KALESEIASSSAKLIEKKSAYANTEKDYKMVQEQLSKQRDLYKRKEELVSTL 385

>KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} similar to
            uniprot|P12753 Saccharomyces cerevisiae YNL250W RAD50
            Subunit of MRX complex with Mre11p and Xrs2p involved in
            processing double-strand DNA breaks in vegetative cells
            initiation of meiotic DSBs telomere maintenance and
            nonhomologous end joining
          Length = 1296

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 92/451 (20%), Positives = 178/451 (39%), Gaps = 65/451 (14%)
 Frame = +1

Query: 1669 LKSRETIQSQNS-QMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDY 1845
            L + +TI+   S  ++ LK ++ HLK   D+    ++ IS   NK+++  + ++    D 
Sbjct: 187  LDNLKTIKKDISIDIKLLKQSVEHLKTDKDRSTATKVNISKLENKIEEYQKEVKSIEHDL 246

Query: 1846 K--KRELDL----NKKFETHISK--EIKSLKTALFLQLDNMQQKNIFQETDIQPNL---- 1989
                +E D     N+KF+  +SK   +K  KT+   Q+  +Q        +I PN     
Sbjct: 247  NIITKESDALFSSNQKFQETLSKLDNLKHNKTSFMEQIQRLQ-----SSIEILPNSKSEL 301

Query: 1990 -DMVKN-------EVLTLMETMQEKAEL--MYKDC---------VKKILNESPKFFNVIV 2112
             DM++N       + + L E   EK  L  +  DC         ++  L      +    
Sbjct: 302  EDMLQNFQRLLEEKNIELFEYQSEKERLLSLLNDCRNEQQEVVRLQGELGSKKNQYETSK 361

Query: 2113 EKIDIIRIEFQNFYKNIAENLSD-----ISEENNNLKQYL-KNHFFKNNHQELLNHHIDS 2274
             K++ I  E    Y    E+++      +   N NL+  L K+HF +   +E L     S
Sbjct: 362  IKMNTILTELSELYNISKESVTSEVSTMLHTANKNLESLLAKHHFEETTLEEKL-----S 416

Query: 2275 TYENIEKKTNQFVENFKMTLNDHLEENKKL---IMQNMTNATSAVIDQE-MDLFEPRRAK 2442
               N   K  Q +      LN   ++ KKL   +     +     +++E ++ +E +  +
Sbjct: 417  VLRNSFAKKEQQLSYISSDLNKLADQTKKLRNRLNDKRVSEKDLKVEKEALNNYESKLKQ 476

Query: 2443 W--ENSFDLINKCDSMNNEFYNNMAATLSQIKKTV----------------DTSSNSMNE 2568
            W  E   D I+      N+   ++   L  I++ +                  S ++  +
Sbjct: 477  WNTERIVDAISTSIKTKNQDILSLEDELEVIQQQITKANQHSDLYAKLSLLKASESTKKK 536

Query: 2569 SISVMKGQVEESENAISLLKN-NTKFNDQFKQLISKHII----LKDNIEXXXXXXXXXXX 2733
             +  +K Q+EE  N +S+  N       QF  ++ K  +    +K++ +           
Sbjct: 537  DVETIKKQLEEGANLVSVSFNLEGDLLSQFNSILDKKRVDLKKIKNDSDIATKEFIQYEN 596

Query: 2734 NVDDIYNTIEDIMTNHGNKENATKDEMIDNI 2826
             +  I   I +I +N  + E+  K+ + D +
Sbjct: 597  QLQGIEEQIYEIESNITSIESRLKESLPDEV 627

 Score = 35.8 bits (81), Expect = 0.78
 Identities = 53/283 (18%), Positives = 111/283 (39%), Gaps = 6/283 (2%)
 Frame = +1

Query: 1489 ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDK 1668
            EL+K+ SDL   + +  IY+S +  +                   IE+L SK   +  + 
Sbjct: 791  ELSKLTSDLRRVEEELSIYISDEKLET------------------IETLHSKQKRVNNEL 832

Query: 1669 LKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYK 1848
               R+ I     Q E      N+L + + +++      S  NN    + E + +  +  +
Sbjct: 833  RALRKDISDLQIQKEDKSKEYNNLLSLIREKN------SNINNMESALQEYLNITKEVCE 886

Query: 1849 KRELDLNKKFETHI-SKEIKSLKTALFL---QLDNMQQKNIFQETDIQPNLDMVKNEVLT 2016
               +  + + E+ I ++E+  LK  +      L+  + K+   E + +   D ++++V  
Sbjct: 887  NESIIESSEKESEILTEEVNDLKLEISSASGSLNEGKAKHRQLEVEARERKDKIESQVAN 946

Query: 2017 LMETMQEKAELMYKDCVKKILNES--PKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISE 2190
            + E ++        D  + I  E    +  N +  K   I+   ++   N  + L D   
Sbjct: 947  VNELVELIQNFEINDAPRLIECEEKLTEISNSVESKTAEIK-SIEDSINNTVQKLKDSDN 1005

Query: 2191 ENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVEN 2319
            E  N+K  +     K   Q + N        + E++ N++ E+
Sbjct: 1006 EFKNIKLNIDLLGLKCELQRIENAISSMDVTHAEQERNKYQED 1048

 Score = 33.9 bits (76), Expect = 3.0
 Identities = 107/507 (21%), Positives = 193/507 (38%), Gaps = 88/507 (17%)
 Frame = +1

Query: 1513 LLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLK------ 1674
            LL  K+ E ++