Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.286.16ON99899846540.0
YEL061C (CIN8)6.16ON1000100242040.0
Suva_5.66.16ON999100141390.0
Smik_5.266.16ON1002100441310.0
TDEL0G045306.16ON95893023770.0
ZYRO0C07898g6.16ON97493322660.0
NCAS0H008806.16ON100462416280.0
NDAI0D008706.16ON106960015960.0
CAGL0B03641g6.16ON98858315670.0
Kpol_1032.66.16ON100458615610.0
SAKL0E01078g6.16ON94859315410.0
KAFR0L003706.16ON96355515000.0
KLLA0D01045g6.16ON96559314990.0
Kwal_56.224036.16ON94367914640.0
Ecym_30206.16ON94459913921e-176
KNAG0M011306.16ON95060013861e-175
ACR010C6.16ON94561813791e-174
KLTH0C11330g6.16ON94166913581e-171
TBLA0A072306.16ON109759713511e-169
TPHA0M002406.16ON93961713211e-166
Kpol_1045.736.16ON96266110891e-132
TPHA0J003006.16ON9829149771e-115
ACR228C7.387ON11294906641e-71
Smik_2.537.387ON11132206552e-70
YBL063W (KIP1)7.387ON11112206552e-70
Suva_2.547.387ON11102206543e-70
Skud_2.417.387ON11102206534e-70
SAKL0F12298g7.387ON11122236509e-70
Ecym_46887.387ON11343146411e-68
TPHA0E008907.387ON12322186323e-67
TDEL0C016007.387ON11052146294e-67
NCAS0E026407.387ON11023026206e-66
NDAI0E043007.387ON11862186191e-65
ZYRO0B03234g7.387ON11382136172e-65
KAFR0L017107.387ON11512216083e-64
TBLA0D006407.387ON11422304606e-46
SAKL0G18920g2.633ON6493633628e-35
KLTH0G03850g5.531ON4731733531e-34
Kwal_47.186085.531ON4791753495e-34
SAKL0G05016g5.531ON5041733435e-33
KLLA0B00759g5.531ON4561773396e-33
ADR145C2.633ON6351693173e-29
Ecym_34152.633ON6621823164e-29
Suva_7.443.528ON8051823095e-28
Skud_7.533.528ON8051823079e-28
KAFR0F042103.528ON6721823051e-27
SAKL0F01760g3.528ON8091803061e-27
CAGL0I07029g3.528ON7051843051e-27
Ecym_40665.531ON4781722982e-27
TDEL0D059603.528ON7331833042e-27
NCAS0E005503.528ON7841843042e-27
Smik_7.483.528ON8051823033e-27
Kwal_47.190933.528ON8191813033e-27
YGL216W (KIP3)3.528ON8051803014e-27
KLLA0A01606g3.528ON7691823014e-27
ZYRO0E08668g3.528ON7781812997e-27
TBLA0C039403.479ON7391852997e-27
KNAG0B005203.528ON7231872971e-26
KLTH0G01606g3.528ON8191812952e-26
TBLA0C049603.528ON8011882943e-26
TPHA0D034803.528ON8471792944e-26
CAGL0D04994g3.479ON6921482924e-26
ZYRO0D12650g5.531ON4781712865e-26
Kpol_423.83.528ON8061812925e-26
Kpol_1050.1033.479ON6971522881e-25
Kpol_1004.255.531ON5061952841e-25
NDAI0I029603.528ON8681892891e-25
AER441C3.528ON8181832854e-25
KNAG0A078803.479ON7641432835e-25
TPHA0D032003.479ON7241512827e-25
NCAS0F034703.479ON6981512819e-25
Ecym_12003.528ON8331862811e-24
KAFR0B065903.479ON7061502791e-24
AGR253W3.479ON7091692755e-24
NCAS0C013508.678ON6551842745e-24
NDAI0B057703.479ON7631562747e-24
Kpol_505.393.479ON6921502683e-23
TDEL0F036403.479ON7041482674e-23
SAKL0F03168g3.479ON7061492675e-23
YPR141C (KAR3)3.479ON7291442666e-23
Kpol_1013.78.678ON6201802647e-23
ZYRO0F07414g8.678ON6541832649e-23
Suva_16.4693.479ON7311442641e-22
ZYRO0B04290g3.479ON7311482641e-22
Ecym_44073.479ON7111662631e-22
Skud_16.4353.479ON7291442622e-22
SAKL0H06490g8.678ON6573142612e-22
Smik_16.3883.479ON7291442622e-22
KLLA0D05951g8.678ON6682512576e-22
NDAI0E02090singletonON6851972577e-22
TBLA0C053103.479ON6761812532e-21
KAFR0H024108.678ON6582292513e-21
KLLA0B10956g3.479ON6901512514e-21
TDEL0A062408.678ON6373612504e-21
KLTH0F14498g3.479ON7021672514e-21
Kwal_26.88068.678ON7153632442e-20
TPHA0D012708.678ON6961892416e-20
CAGL0M02189g8.678ON6721952408e-20
ACR145W8.678ON6852122372e-19
KLTH0D11286g8.678ON6781892372e-19
Ecym_23958.678ON6872162353e-19
YPL155C (KIP2)8.678ON7062012344e-19
TDEL0B072702.633ON6441992319e-19
Skud_16.1278.678ON7062012292e-18
Smik_6.3528.678ON7152072292e-18
TBLA0C018808.678ON4681512163e-17
TPHA0D041903.479ON6721442174e-17
KNAG0J017208.678ON6251852174e-17
Kpol_1019.112.633ON6472072094e-16
Suva_16.1558.678ON7042012042e-15
Kwal_55.21164singletonOFF5881591782e-12
Kwal_YGOB_55.211643.479ON6571591773e-12
TPHA0N016502.633ON6822151754e-12
Suva_11.1452.633ON6571191658e-11
YKL079W (SMY1)2.633ON6561391514e-09
NCAS0H031802.633ON6602501504e-09
Smik_11.1602.633ON6561371495e-09
Skud_11.1482.633ON6561181487e-09
TBLA0A008202.633ON8031631452e-08
ZYRO0E01078g2.633ON6682331371e-07
NDAI0C004802.633ON5981901291e-06
TBLA0C008002.633ON693711272e-06
KNAG0M025402.633ON5221021236e-06
CAGL0L05104g2.633ON6752041148e-05
KAFR0C040202.633ON6672341084e-04
KNAG0H003602.633ON6811171000.003
NCAS0C052002.633ON57256830.34
AEL270W7.535ON63772800.73
Kwal_55.197335.696ON67649762.8
KLTH0D11902g8.704ON81951753.8
ZYRO0F09570g5.414ON835174744.1
NCAS0C028308.401ON874135736.1
KNAG0M024702.649ON60677726.5
KLLA0F08305g3.414ON32198716.9
KAFR0A084901.100ON125273727.8
Kpol_1063.77.204ON59289718.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.28
         (998 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...  1797   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...  1623   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...  1598   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...  1595   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   920   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   877   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   631   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   619   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   608   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   605   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   598   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   582   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   582   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   568   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   540   e-176
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   538   e-175
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   535   e-174
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   527   e-171
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   525   e-169
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   513   e-166
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   424   e-132
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   380   e-115
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   260   1e-71
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   256   2e-70
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   256   2e-70
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   256   3e-70
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   256   4e-70
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   254   9e-70
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   251   1e-68
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   248   3e-67
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   246   4e-67
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   243   6e-66
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   243   1e-65
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   242   2e-65
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   238   3e-64
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   181   6e-46
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   144   8e-35
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   140   1e-34
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   139   5e-34
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   136   5e-33
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   135   6e-33
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   126   3e-29
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   126   4e-29
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   123   5e-28
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   122   9e-28
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   122   1e-27
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   122   1e-27
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   122   1e-27
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   119   2e-27
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   121   2e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   121   2e-27
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   121   3e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   121   3e-27
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   120   4e-27
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   120   4e-27
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   119   7e-27
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   119   7e-27
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   119   1e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   118   2e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   117   3e-26
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   117   4e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   117   4e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   114   5e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   117   5e-26
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   115   1e-25
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   114   1e-25
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   115   1e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   114   4e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   113   5e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   113   7e-25
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   112   9e-25
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   1e-24
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   112   1e-24
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   110   5e-24
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   110   5e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   110   7e-24
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   107   3e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   107   4e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   107   5e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   107   6e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   106   7e-23
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   106   9e-23
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   106   1e-22
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   106   1e-22
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   105   1e-22
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   105   2e-22
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   105   2e-22
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   105   2e-22
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   103   6e-22
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   103   7e-22
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   102   2e-21
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   101   3e-21
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   101   4e-21
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   100   4e-21
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   101   4e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...    99   2e-20
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    97   6e-20
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    97   8e-20
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    96   2e-19
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    96   2e-19
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    95   3e-19
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    95   4e-19
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    94   9e-19
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    93   2e-18
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    93   2e-18
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    88   3e-17
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    88   4e-17
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    88   4e-17
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    85   4e-16
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    83   2e-15
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    73   2e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    73   3e-12
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    72   4e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    68   8e-11
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    63   4e-09
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     62   4e-09
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    62   5e-09
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    62   7e-09
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    60   2e-08
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    57   1e-07
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    54   1e-06
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    54   2e-06
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    52   6e-06
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    49   8e-05
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    46   4e-04
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    43   0.003
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    37   0.34 
AEL270W Chr5 (132790..134703) [1914 bp, 637 aa] {ON} Syntenic ho...    35   0.73 
Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W...    34   2.8  
KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {...    33   3.8  
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    33   4.1  
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     33   6.1  
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    32   6.5  
KLLA0F08305g Chr6 (773720..774685) [966 bp, 321 aa] {ON} similar...    32   6.9  
KAFR0A08490 Chr1 complement(1700790..1704548) [3759 bp, 1252 aa]...    32   7.8  
Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON} (19685.....    32   8.3  

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score = 1797 bits (4654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 897/998 (89%), Positives = 897/998 (89%)

Query: 1   MPAESQNTIQERXXXXXXXXXXXXXQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60
           MPAESQNTIQER             QMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV
Sbjct: 1   MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60

Query: 61  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120
           VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK
Sbjct: 61  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120

Query: 121 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180
           GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC
Sbjct: 121 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180

Query: 181 SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 240
           SFIELYNEE                   QFMKKLRIFD                      
Sbjct: 181 SFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 240

Query: 241 XXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
               LNDLTPKAALLRKRLRTKSLPNTIK                               
Sbjct: 241 SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQQQQQAMNSRNNSSSNSGSAANNSSSNTNG 300

Query: 301 XRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 360
            RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT
Sbjct: 301 QRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 360

Query: 361 ITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 420
           ITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD
Sbjct: 361 ITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 420

Query: 421 RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 480
           RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ
Sbjct: 421 RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 480

Query: 481 LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKR 540
           LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKR
Sbjct: 481 LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKR 540

Query: 541 EIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNK 600
           EIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNK
Sbjct: 541 EIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNK 600

Query: 601 LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ 660
           LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ
Sbjct: 601 LQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQ 660

Query: 661 PNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKN 720
           PNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKN
Sbjct: 661 PNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKN 720

Query: 721 IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND 780
           IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND
Sbjct: 721 IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLND 780

Query: 781 HLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATL 840
           HLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATL
Sbjct: 781 HLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATL 840

Query: 841 SQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE 900
           SQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE
Sbjct: 841 SQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE 900

Query: 901 XXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNI 960
                      NVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNI
Sbjct: 901 SSITSTHSHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRISNI 960

Query: 961 NGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998
           NGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE
Sbjct: 961 NGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score = 1623 bits (4204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/1002 (80%), Positives = 862/1002 (86%), Gaps = 6/1002 (0%)

Query: 1    MPAESQNTIQERXXXXXXXXXXXXXQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60
            MPAE+QNT Q+R             Q+GCH+VPNEELNITVAVRCRGRNEREI MKSSVV
Sbjct: 1    MPAENQNTGQDRSSNSISKNGNS--QVGCHTVPNEELNITVAVRCRGRNEREISMKSSVV 58

Query: 61   VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120
            VNVPDITGSKE+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVAGPLFQDFIK
Sbjct: 59   VNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIK 118

Query: 121  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+DAAGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 119  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKC 178

Query: 181  SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 240
            SFIELYNEE                   QFMKKLRIFD                      
Sbjct: 179  SFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 238

Query: 241  XXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                LNDLTPKAALLRKRLRTKSLPNTIK                               
Sbjct: 239  SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTN 298

Query: 301  ----XRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSH 356
                 RS M  NDQ+NGIYIQNLQEFHITNA+EGLNLLQ+GLKHRQVASTKMNDFSSRSH
Sbjct: 299  TNNGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSH 358

Query: 357  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 416
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 359  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 418

Query: 417  ALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
            ALVD+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 419  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478

Query: 477  NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQ 536
            NKPQLG+F+MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES+KNEVQ
Sbjct: 479  NKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 538

Query: 537  ECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISG 596
            ECKREIESL SKN+LLVKDKLKS+ETIQSQN Q+ESLK TI+HL+AQLDKQHK E+EIS 
Sbjct: 539  ECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISD 598

Query: 597  FNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQE 656
            FNNKLQK+TEVMQ+AL DYKKRELDLN+KFE HI+KEIK LK+ LFLQL+ MQQ++I QE
Sbjct: 599  FNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQE 658

Query: 657  TDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQN 716
            T+IQPNLDM+KNEVLTLM TMQEKAELMYKDCVKKILNESPKFFNV++EKIDIIR++FQ 
Sbjct: 659  TNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQK 718

Query: 717  FYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKM 776
            FYKNIAENLSDISEENNN+KQYLKNHFFKNNHQELLN H+DSTYENIEK+TN+FVENFK 
Sbjct: 719  FYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKK 778

Query: 777  TLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNM 836
             LNDHL+ENKKLIMQN+T ATSAVIDQEMDLFEP+R KWENSFDLIN CDSMNNEFYN+M
Sbjct: 779  VLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSM 838

Query: 837  AATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILK 896
            AATLSQIK TVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQF+QLI+KH +LK
Sbjct: 839  AATLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLK 898

Query: 897  DNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLR 956
            DNI+           NVDDIYNTIE+IM N+GNKENATKDEMI+NILKEIPNLSK++PLR
Sbjct: 899  DNIKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLR 958

Query: 957  ISNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998
            +SNIN  SVQ +ISPKKH IEDEN SSEN D+EGSRK+ K E
Sbjct: 959  LSNINSNSVQSVISPKKHAIEDENKSSENVDNEGSRKMLKIE 1000

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score = 1598 bits (4139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 816/1001 (81%), Positives = 863/1001 (86%), Gaps = 5/1001 (0%)

Query: 1   MPAESQNTIQERXXXXXXXXXXXXXQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60
           MPAE+QNTIQER             Q+GCH VPNEELNITVAVRCRGRNEREIGMKSSVV
Sbjct: 1   MPAENQNTIQERSSNNISNNLNA--QIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVV 58

Query: 61  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120
           VNVPDITGS+EVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVAGPLFQDFIK
Sbjct: 59  VNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIK 118

Query: 121 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180
           GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+DAAGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 119 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKC 178

Query: 181 SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 240
           SFIELYNEE                    FMKKLRIFD                      
Sbjct: 179 SFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNS 238

Query: 241 XXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXX---XXXX 297
               LNDLTPKAALLRKRLRTKSLPNTIK                               
Sbjct: 239 SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINT 298

Query: 298 XXXXRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHT 357
               RS M  NDQSNGIYIQNLQEFHITNA+EGLNLLQRGLKHRQVASTKMNDFSSRSHT
Sbjct: 299 NNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHT 358

Query: 358 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 417
           IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA
Sbjct: 359 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 418

Query: 418 LVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477
           L D+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN
Sbjct: 419 LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478

Query: 478 KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE 537
           KPQLGAF+MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES+KNEVQE
Sbjct: 479 KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 538

Query: 538 CKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGF 597
           CKR+IESL+SKNSLL+KDKLKS++TIQSQNSQMESLK TIN LKAQLDKQHK ELEISGF
Sbjct: 539 CKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF 598

Query: 598 NNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQET 657
           NNKLQK+TE+MQ+ALQDYK+RELDLNKKFETHISKEIKSLKT LF QL  M+Q NI QET
Sbjct: 599 NNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET 658

Query: 658 DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF 717
           +IQPNLD++KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR++FQ F
Sbjct: 659 NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 718

Query: 718 YKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMT 777
           Y NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYE+IEKKT++FVENFK T
Sbjct: 719 YNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNT 778

Query: 778 LNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMA 837
           LNDHLEENKKLIMQN+TNATSAVI+QEMDLFEP+R KWENSFDLINKCDSMNNEFYNNMA
Sbjct: 779 LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 838

Query: 838 ATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKD 897
            TLSQIK TVDTSSNSMN+SISVMKGQVEESENA+SLLKNN KFNDQFKQL++KH ILKD
Sbjct: 839 TTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKD 898

Query: 898 NIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRI 957
           NIE           N+DDIY+TIE+IM N+GNKENA K+EMIDNILKEIP+LSKR+PLR+
Sbjct: 899 NIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRL 958

Query: 958 SNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998
           SN NG S Q+I+SPKKH I+DENPS+E  D E SRKI KTE
Sbjct: 959 SNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score = 1595 bits (4131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 795/1004 (79%), Positives = 851/1004 (84%), Gaps = 8/1004 (0%)

Query: 1    MPAESQNTIQERXXXXXXXXXXXXXQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60
            MP E+QN+ QER             Q+GCH+V NEELNITVAVRCRGRNEREI MKSSVV
Sbjct: 1    MPVENQNSSQERTSNNISKNGNS--QIGCHTVHNEELNITVAVRCRGRNEREISMKSSVV 58

Query: 61   VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120
            VNVPDITGSKE+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVA PLFQDFIK
Sbjct: 59   VNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIK 118

Query: 121  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+D+AGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 119  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKC 178

Query: 181  SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 240
            SFIELYNEE                   QFMKKLRIFD                      
Sbjct: 179  SFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSSSRNS 238

Query: 241  XXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                LNDLTPKAALLR+RLRTKSLPNTIK                               
Sbjct: 239  SPRSLNDLTPKAALLRRRLRTKSLPNTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSD 298

Query: 301  X------RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSR 354
                   R+ +  NDQSNGIYIQNLQEFHITNA+EGL LLQ+GLKHRQVASTKMNDFSSR
Sbjct: 299  TNNNNGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSR 358

Query: 355  SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 414
            SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV
Sbjct: 359  SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 418

Query: 415  INALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 474
            INALVD+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN
Sbjct: 419  INALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 478

Query: 475  IKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNE 534
            IKNKPQLGAF+MKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLES+KNE
Sbjct: 479  IKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNE 538

Query: 535  VQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEI 594
            VQECKREIESL SKNSLLVK+KLKS+ETIQSQNSQ+ESLKATI+HL+ QLDKQHK ELEI
Sbjct: 539  VQECKREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEI 598

Query: 595  SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF 654
            SGFN+KLQK+TEVMQ+ALQDYK+RELDLNKKFETHI+ EIK++KT LF QL  +QQ+NI 
Sbjct: 599  SGFNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNIL 658

Query: 655  QETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEF 714
            QETDIQPNLD++KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN IVEKIDII ++F
Sbjct: 659  QETDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDF 718

Query: 715  QNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENF 774
            + FYKNIAENLSDISEENNNLKQY  NHFF+NNHQELL+HH+DSTYE IEKKTNQFVENF
Sbjct: 719  ERFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENF 778

Query: 775  KMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYN 834
            K  LNDHLEENKKLIM+N+T  TSAVIDQEM LFEP+R KWE+SFDLIN+CDSMNNEFYN
Sbjct: 779  KKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYN 838

Query: 835  NMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHII 894
            +MA TLSQIK TVDTSSNSMN+SISVMKGQVEESENAISLLKNN KFNDQFKQLI+KH I
Sbjct: 839  SMATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTI 898

Query: 895  LKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLP 954
            LKDNIE           N+DDIYNTIE IM N+GNKENATKDEMI+N+L EIPNLSKR+P
Sbjct: 899  LKDNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMP 958

Query: 955  LRISNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998
            LRISN N  S+Q+IISPKKH IEDEN S+ N DSE SRKI KTE
Sbjct: 959  LRISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/930 (51%), Positives = 639/930 (68%), Gaps = 47/930 (5%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS EVSINTTGD GITAQ+N+K YTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
           +VFGP A+Q L+F+++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GEL+++
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 214
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEE                      +KL
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS--------RKL 184

Query: 215 RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLPNTIKXXXXX 274
           RIFD                           +   P A  LRKR +T   P+  +     
Sbjct: 185 RIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTA--PSVTQ----- 237

Query: 275 XXXXXXXXXXXXXXXXXXXXXXXXXXXRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLL 334
                                       S     DQ+ GIYIQNLQ+FHITNA EG+ LL
Sbjct: 238 ----------------------------SHQNSQDQNAGIYIQNLQDFHITNAKEGIKLL 269

Query: 335 QRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGAL 394
           Q+GLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+RSGA 
Sbjct: 270 QKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQ 329

Query: 395 NQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 454
           +QRAKEAGSINQSLLTLGRVIN+L D+S H+PFRESKLTRLLQDSLGGNTKTALIATISP
Sbjct: 330 HQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISP 389

Query: 455 AKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGI 514
           AK+ SEETCSTL+YA+KAKNIKNKPQLG+ +MKDILVKNIT ELAKIK+DLLSTKSKEGI
Sbjct: 390 AKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGI 449

Query: 515 YMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLK 574
           YMSQD+YK L +DLES+K EV+ECKR IE+L S+N+LL+KDK  S E    Q  ++++++
Sbjct: 450 YMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMR 509

Query: 575 ATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEI 634
             ++ L ++ +KQ+K E  +    + L+     MQ  ++++++RE D+  K     + E 
Sbjct: 510 DAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEF 569

Query: 635 KSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILN 694
             +K  +   + +++Q+  ++   +Q N+D ++ E+  L+E  Q++ + MYKDCV+KIL+
Sbjct: 570 ARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILD 629

Query: 695 ESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH 754
           E+P  F +  EK+  +       ++++ ENLSD+SEE NNL+QYL +HFFKNNH+E+L  
Sbjct: 630 ETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVS 689

Query: 755 HIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAK 814
           HID TY +I+   +   + FK  +++HLE+NK L+++++  AT  VI +EM LFEP++ K
Sbjct: 690 HIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKK 749

Query: 815 WENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISL 874
           WE+SF  INKCDS+N  F N + + L  IK T+ +S  ++N++I+ +K Q++E E+  S+
Sbjct: 750 WEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPASM 809

Query: 875 LKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTNHGNKENAT 934
           L N+  F++QF  +++K  +L ++++            VD +   I+ +++  G+     
Sbjct: 810 LSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSMEGE 869

Query: 935 KDEMIDNILKEIPNLS----KRLPLRISNI 960
           + E +D IL+ +   +     R PLR +N 
Sbjct: 870 RVEHVDGILRRMDEQNLLYLDRSPLRPANF 899

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/933 (50%), Positives = 630/933 (67%), Gaps = 34/933 (3%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K Y VD
Sbjct: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
           KVFGP A+Q LIF+E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN EL+D+
Sbjct: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 214
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEE                     M+KL
Sbjct: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS--------MRKL 184

Query: 215 RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLPNTI-KXXXX 273
           RI+D                             L     + R+R+RT  L +++ K    
Sbjct: 185 RIYDSGSGSNSNSGSRKNSRNNSPK--------LVTDPMINRRRMRTVPLSSSLAKQQHQ 236

Query: 274 XXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPMTQNDQSNGIYIQNLQEFHITNALEGLNL 333
                                       +    Q D  +G+YIQNLQ+FHIT+A +GL L
Sbjct: 237 WQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQL 296

Query: 334 LQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGA 393
           LQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSENI+RSGA
Sbjct: 297 LQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGA 356

Query: 394 LNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATIS 453
            +QRAKEAGSINQSLLTLGRVIN+L D+S H+PFRESKLTRLLQDSLGGNTKTALIATIS
Sbjct: 357 QHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATIS 416

Query: 454 PAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEG 513
           PAK+ SEETCSTL+YASKAKNIKN+PQL +F+MKDILVKNIT ELAK+KSDLLSTK +EG
Sbjct: 417 PAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREG 476

Query: 514 IYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESL 573
           +YMSQD+YK + +DLES+K E+QE KR IE L+S+NSLL+KDK  S E  + Q  +++++
Sbjct: 477 VYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNM 536

Query: 574 KATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKE 633
           K  ++ L  +L+ QHK E E+      L+    + Q  +++Y +RE  ++++ +  + +E
Sbjct: 537 KDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQE 596

Query: 634 IKSLKTALFLQLDNMQQ----KNIFQETD---IQPNLDMVKNEVLTLMETMQEKAELMYK 686
               +  L   +++++      +I  E +   IQ NL++++ EV+ L+   Q++AE MYK
Sbjct: 597 FLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYK 656

Query: 687 DCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKN 746
           D ++KIL E+P  F  I  K+D + +    +++ + ENLSDISE  NNLKQY  +HFFKN
Sbjct: 657 DWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKN 716

Query: 747 NHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMD 806
           NH+E+LN HID TY+ ++   +  ++ FK  ++DHL++NK L+M+++ +AT+  ID+EM 
Sbjct: 717 NHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQ 776

Query: 807 LFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMKGQVE 866
           LFEP+R KWE SFDLIN CDS++N F  +M + LS IK T  +S++ ++ S+S +K +V+
Sbjct: 777 LFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVK 836

Query: 867 ESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXNVDDIYNTIEDIMTN 926
             E+A ++L  N     Q   +I+K   L++ +              D++   I + + +
Sbjct: 837 GYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIAS 896

Query: 927 HGNKENATKDEMIDNILKEIPNL---SKRLPLR 956
               EN+T   +  N +   P L   S+R PL+
Sbjct: 897 ----ENST---LHQNKIATTPPLGQNSERSPLK 922

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/624 (52%), Positives = 456/624 (73%), Gaps = 7/624 (1%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           ++ +NGIYIQNLQEFHITNA EGL+LLQ+GLKHRQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 295 DENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEH 354

Query: 368 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 427
           +D LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L D+S H+PF
Sbjct: 355 KDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPF 414

Query: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 487
           RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ ++K
Sbjct: 415 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILK 474

Query: 488 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 547
           DIL+KNIT ELAK+KSDL+STKSK+GIYMS +HY+ L  +LES K EVQE KR IE L+S
Sbjct: 475 DILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSS 534

Query: 548 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 607
           +NS+L+KDK  + E  + Q  ++ +LK ++++L  +L+ Q+  E ++     +L+K  E 
Sbjct: 535 QNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREK 594

Query: 608 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 667
           +   +++Y+ ++  L  +    +++ +  LK  L    D ++Q       D++ NL ++K
Sbjct: 595 LNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQSE--GNFDVEMNLKVIK 652

Query: 668 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 727
           +E+ +++E  Q K E+MYK+ +++ L ++P     I E +  +      +Y  I ENLSD
Sbjct: 653 DEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSD 712

Query: 728 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 787
           ISEE NNLKQYL N FF+NNH++LLN HI++T + + + + +    FK+ ++ HL ENKK
Sbjct: 713 ISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKK 772

Query: 788 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 847
           L++ N   AT+ VI +EM+LF+P+R KWE S +LIN+CDS+NN F++NM   +S+IK  +
Sbjct: 773 LMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNL 832

Query: 848 DTSSNSMNESISVMKGQVEE-----SENAISLLKNNTKFNDQFKQLISKHIILKDNIEXX 902
            +SS+S++ +I+ +K QV E       +  + L+N+  FN  F ++I K++IL+ N +  
Sbjct: 833 ASSSSSIHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRKNA 892

Query: 903 XXXXXXXXXNVDDIYNTIEDIMTN 926
                    N+D++  T++  + N
Sbjct: 893 INYTDKSLLNIDELSETVKIALNN 916

 Score =  269 bits (688), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 126/164 (76%), Positives = 142/164 (86%), Gaps = 10/164 (6%)

Query: 36  ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDK 95
           ELNITVAVRCRGRNEREI  KS VVV VPDITG++E+SINTTG+TGITAQMN+K YTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 96  VFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-NGE-LND 153
           VFGP A QDLIF+EVA PLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY NG  L+D
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 154 AAGIIPRVLLKLFDTLELQQ--------SDYVVKCSFIELYNEE 189
           AAGIIPR+L KLFDTL+  +        +D+VVKCSF+ELYNE+
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNED 191

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/600 (54%), Positives = 435/600 (72%), Gaps = 6/600 (1%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           Q+D +NGIYIQNLQEFHI+NA EGL LLQ+GLK+RQVASTKMNDFSSRSHTIFTITLYK+
Sbjct: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399

Query: 367 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIP 426
           HQ  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L DR+ HIP
Sbjct: 400 HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIP 459

Query: 427 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMM 486
           FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ + 
Sbjct: 460 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIIS 519

Query: 487 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLA 546
           KDIL+KNIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L++HK E  E KR IE L+
Sbjct: 520 KDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLS 579

Query: 547 SKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTE 606
           S+N+LL+KDK  S E  + Q  ++   + +IN L+ +++ Q+  E  +    +KLQ   +
Sbjct: 580 SQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCD 639

Query: 607 VMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMV 666
             +  +++Y+ +++D+  K E  +  ++ SL+  L    + ++  N   + DI  NLDM+
Sbjct: 640 TFKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMI 699

Query: 667 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLS 726
           +NEV+ ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I I+ QN +  +A+NLS
Sbjct: 700 QNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLS 759

Query: 727 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK 786
           DISEE NNLKQYL  + F+NNH++L+N HI+ST + +    +     FK  +N HLE N+
Sbjct: 760 DISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNR 819

Query: 787 KLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKT 846
            L++ +   AT  VI++EM+LF PR+ KWE S DLIN+CDS+NN F   +   LS  +  
Sbjct: 820 NLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSK 879

Query: 847 VDTSSNSMNESISVMKGQVEE------SENAISLLKNNTKFNDQFKQLISKHIILKDNIE 900
           +  S N M ++ + +K ++        S N  +++++N     QF +L  K+ I +DN+E
Sbjct: 880 ITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVE 939

 Score =  283 bits (723), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 128/153 (83%), Positives = 139/153 (90%)

Query: 37  LNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKV 96
           LNITVAVRCRGRNEREI +KSSV+V VPDI GS EVSINTT D GITAQMN+K YTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 97  FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAG 156
           FGP A+Q LIF+EVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+++AG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 157 IIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 189
           IIPR+L KLFDTLE+ Q DYVVKCSFIELYNE+
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNED 204

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/583 (52%), Positives = 426/583 (73%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           DQS  IYIQNL+EFHIT+A+EGL LLQ+GLK RQVASTKMNDFSSRSH+IFTITLYK+  
Sbjct: 304 DQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQN 363

Query: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428
            ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488
           ESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAF+MKD
Sbjct: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483

Query: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548
           ILV++IT ELAKIKSDLLSTKSKEG+YMS +HYK+L+ D+E +K E++E KR IESL ++
Sbjct: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543

Query: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608
           N++L +++L  ++      + + SLK  +  L++ L +Q   E  I      +Q   E M
Sbjct: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603

Query: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 668
           +  +  ++ ++ +L +   T IS EI +++  L   ++ +Q     ++T+I  NL  ++ 
Sbjct: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEK 663

Query: 669 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 728
           EV+ +++  +E+A   Y +CVK +L E+P+ F  +  ++D I    +  +  IAE LSD+
Sbjct: 664 EVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723

Query: 729 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 788
           SEE NNLKQYL N+FFKNNH+ELL+HH+ +TY  +E+ + Q ++NF M L+ H++ENK+ 
Sbjct: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783

Query: 789 IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 848
           +++N+   T  VI+ E+ +F  +RAKWE S  LIN+CDS+N+ F+  + + L +I+  V 
Sbjct: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843

Query: 849 TSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISK 891
           +S +++  +IS ++ +    ++   +++ N     Q  ++  K
Sbjct: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQK 886

 Score =  273 bits (698), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 130/187 (69%), Positives = 144/187 (77%), Gaps = 6/187 (3%)

Query: 32  VPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRY 91
           +  EELNI VAVRCRGRNEREI  KSSVVV+VPD   + EVSINTT D GI A+MN+K Y
Sbjct: 27  LATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTY 86

Query: 92  TVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 151
           TVDKVFGP ASQ L++EE+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL
Sbjct: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146

Query: 152 NDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFM 211
            DAAGIIPRVL +LFDTLE  + DY+VKCSF+ELYNEE                      
Sbjct: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------ 200

Query: 212 KKLRIFD 218
           KKLRIFD
Sbjct: 201 KKLRIFD 207

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/586 (51%), Positives = 440/586 (75%), Gaps = 4/586 (0%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           D+  GIYIQNL+EFHIT+A EG+ LLQRGL++RQVASTKMNDFSSRSHTIFTI LYK+H 
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428
            ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ + KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548
           ILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLES+K EVQECKR I+ L ++
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608
           N LL+KDK  S E    Q  +++S+K +I+HL   ++KQH+ E  +     KL+  +  M
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 668
           Q  ++ + +RE     K +   ++E+  LK+ L   L+ + +K +   TD+  N++ +K+
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 669 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIE-FQNFY-KNIAENLS 726
           EV ++++T Q +A  +YKDC+++++ ESP     + +  DII+++   + Y + ++ ++S
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLND--DIIKMQKISDLYNEQLSISIS 715

Query: 727 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK 786
           +++ E+N+LKQYL   FFK++H+E+LN HI+ TY+NI + +   VE  K  L  +LEE++
Sbjct: 716 ELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESR 775

Query: 787 KLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKT 846
            +I+ ++ N TS ++  EM+LF P++ KWE+SF++INKCDS+NN+++ +++A LS +K +
Sbjct: 776 NIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTS 835

Query: 847 VDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKH 892
           V ++S+ +++ +S M+   + +  +  L +N+ +   QF +++ K+
Sbjct: 836 VTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKN 881

 Score =  265 bits (677), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 143/184 (77%), Gaps = 7/184 (3%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS E++INTT D GI  QMN+K YTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
           KVFGP A+Q LIFEEVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGEL+D+
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 214
           AGIIPRVL KLFD +E Q  DY++KCSFIELYNEE                      KKL
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA-------KKL 183

Query: 215 RIFD 218
           RIFD
Sbjct: 184 RIFD 187

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/593 (52%), Positives = 417/593 (70%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           ++QS+ IYIQNLQEFHITNA +G+NLLQRGLKHRQVASTKMNDFSSRSHTIFTI LYK H
Sbjct: 255 SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH 314

Query: 368 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 427
             E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 315 NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374

Query: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 487
           RESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MK
Sbjct: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434

Query: 488 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 547
           DILVKNIT ELAKIKSD LSTKSK+GIYM+QDHYK L SDLE++K EVQECKREIE + S
Sbjct: 435 DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS 494

Query: 548 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 607
           +N LL+KDK  S E  + Q  +++ L   I HL  ++DKQHK E ++    + L+     
Sbjct: 495 QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT 554

Query: 608 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 667
           +Q +L++ +  +L    + E  +   + S K ++  QL  M+  +  +   I  N+D+++
Sbjct: 555 VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614

Query: 668 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 727
            E+  ++E++   +  + + CV+KIL  +PK F  I   +  I     ++   + +NL D
Sbjct: 615 EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674

Query: 728 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 787
           ISEE NN ++YL  H FKNNH+E L+ H+D TY  ++K   +    FK  ++ HLEENK 
Sbjct: 675 ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734

Query: 788 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 847
           L+++++  A+  V+ +E+ LF P + KWE+S + INKCDS+NN F + +   L +++  +
Sbjct: 735 LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794

Query: 848 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE 900
           + S      +   +K  +++ +    +LKNNTK  +   ++  KH  L+D +E
Sbjct: 795 EGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVE 847

 Score =  280 bits (717), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 147/184 (79%), Gaps = 8/184 (4%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GITAQMN+K YTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
           KVFGP A Q LIF+++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL+DA
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 214
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEE                     +KKL
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESG--------VIKKL 186

Query: 215 RIFD 218
           RIFD
Sbjct: 187 RIFD 190

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/555 (53%), Positives = 410/555 (73%), Gaps = 3/555 (0%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           Q+DQ+ GIYIQNLQEFHIT A EG+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL+K+
Sbjct: 283 QSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE 342

Query: 367 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIP 426
            + E+FR+SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+L D++ H+P
Sbjct: 343 VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVP 402

Query: 427 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMM 486
           FRESKLTRLLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+F+M
Sbjct: 403 FRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIM 462

Query: 487 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLA 546
           KDIL+KNIT EL KIKSDLLSTKSK+GIYM Q HYK L +DL+++K E+QECKR IESL 
Sbjct: 463 KDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLT 522

Query: 547 SKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTE 606
           S+N+LL+KDK    E  + Q  +++++  ++  L A++++Q   E E+ G      K   
Sbjct: 523 SQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNS 582

Query: 607 VMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMV 666
            +   + + K RE  +N KF+T +   +  +   L  Q++N + + I Q   +  NL ++
Sbjct: 583 KLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLI 642

Query: 667 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLS 726
           K+E+  L+ T ++  E  Y++C+ K L+++P  F+ I + +  ++    N+Y  IAENLS
Sbjct: 643 KSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLS 702

Query: 727 DISEENNNLKQYLKNHFF---KNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLE 783
           D+SEE NN KQ++ + F+   K +  ELLN +I++T   IE  +N  +   +  LN+HL 
Sbjct: 703 DLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLR 762

Query: 784 ENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQI 843
            NK+LI+ +++N T+ ++  E+D  +P+ +KWE S +LIN+ D++NNEF +N+ ++++ +
Sbjct: 763 ANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTM 822

Query: 844 KKTVDTSSNSMNESI 858
              +  +++S+N +I
Sbjct: 823 TDKIKQTNDSINNNI 837

 Score =  272 bits (695), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 144/184 (78%), Gaps = 6/184 (3%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKEV+INT+ D G TAQMN+K YTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
           KVFGP A+Q LIF+E+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN EL+D+
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 214
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEE                      KKL
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGN------FKKL 188

Query: 215 RIFD 218
           RIFD
Sbjct: 189 RIFD 192

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/593 (50%), Positives = 420/593 (70%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           N+QS+ IYIQ+LQEFHIT+A EGL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322

Query: 368 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 427
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382

Query: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 487
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+FMMK
Sbjct: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442

Query: 488 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 547
           DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E++K E+QE +REIE L+S
Sbjct: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502

Query: 548 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 607
           +N LL KDK  S++TI+SQ  Q+ +L++++++L  ++D +HK E+E++    KL+     
Sbjct: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562

Query: 608 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 667
           MQ AL+ ++  E  L    +  +   I   +  +  +LDN++Q+ + Q   I  +++ VK
Sbjct: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622

Query: 668 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSD 727
           + + TL+ET+++ A +M ++  +K++ + PKFFN ++ +++ +  +       + E LS 
Sbjct: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682

Query: 728 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKK 787
           I+ ENNNLK YL  HFF+NNHQE+LN H D TY  +   +   +      ++DH+E+N+ 
Sbjct: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742

Query: 788 LIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTV 847
           L+M  +  AT+ VI QEM  FEP R  WE SF+ IN CDS++N+F ++   +L+ +K  +
Sbjct: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802

Query: 848 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE 900
           +++    +     +K  +   ++   +    T  N     + +KH +L+D +E
Sbjct: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELE 855

 Score =  282 bits (721), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 125/159 (78%), Positives = 143/159 (89%)

Query: 31  SVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 90
           S   +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ EVSINT+GD GITA+MN+K 
Sbjct: 7   SPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKT 66

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           YTVDKVFGP A Q L+F+E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GE
Sbjct: 67  YTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGE 126

Query: 151 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 189
           L++AAGIIPRVL KLFDTLE+Q+SDY+VKCSFIELYNEE
Sbjct: 127 LSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEE 165

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/679 (45%), Positives = 442/679 (65%), Gaps = 8/679 (1%)

Query: 304 PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363
           P++  + S+ I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI L
Sbjct: 228 PVSPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 287

Query: 364 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG 423
           YKK   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S 
Sbjct: 288 YKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL 347

Query: 424 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 483
           HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+
Sbjct: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 407

Query: 484 FMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIE 543
           F+MKD+L+K++T EL KIKSDLLSTKSK+GIYMSQ++YK L ++LE++K EV+ECKR +E
Sbjct: 408 FIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAME 467

Query: 544 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 603
            ++++NSLL+K+K  S E  +SQ  ++  L   I  L  ++D+QHK E E+S    +L +
Sbjct: 468 KVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMR 527

Query: 604 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNL 663
               MQ +L+ Y+ +    + + E  +   I S K +L  +++ ++        D++ N+
Sbjct: 528 ALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNV 587

Query: 664 DMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAE 723
           D V  E+  + + M      ++++ +KK+ +++P +F  I  +++ I     ++  N+  
Sbjct: 588 DAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMI 647

Query: 724 NLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLE 783
           +LS ISEE NNLK YL  HFFKNN QE L+ H+D TY  ++   N      +  LN+ L+
Sbjct: 648 HLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELD 707

Query: 784 ENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQI 843
            NK+ +MQ++ +A S V+ +EM L +P +  WENS + IN+CD +NN F N +  T+++I
Sbjct: 708 TNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEI 767

Query: 844 KKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXX 903
            KT+D    +   +    K ++     A S L+NN         +  KH +LK  ++   
Sbjct: 768 FKTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSA 827

Query: 904 XXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEI------P-NLSKRLPLR 956
                      +I N+I+D++ N         +  ID +L+++      P   S + P+R
Sbjct: 828 NYMQAATQKFGEIDNSIQDLL-NAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMR 886

Query: 957 ISNINGCSVQDIISPKKHT 975
               +  +   ++ P+K +
Sbjct: 887 TVQRSVTNTDQLLPPQKSS 905

 Score =  276 bits (705), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 146/185 (78%), Gaps = 8/185 (4%)

Query: 34  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTV
Sbjct: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 153
           DKVFGP A Q LIF+ +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL++
Sbjct: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 154 AAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKK 213
            AGIIPRVL KLFD L  Q  DY++KCSFIELYNEE                      KK
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEE--------LKDLLDETPDSSMPKK 175

Query: 214 LRIFD 218
           LRIFD
Sbjct: 176 LRIFD 180

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  540 bits (1392), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 279/599 (46%), Positives = 420/599 (70%), Gaps = 14/599 (2%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           +QS+ IYIQNLQEFHITNA EG+++LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428
            ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+FMMKD
Sbjct: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548
           ILVK+I+ EL+K+KSD LSTK+KEGIYMS +HY+ + +DLE+++ E+QE KR++ES +S+
Sbjct: 422 ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608
           NSLL+KDK  S++  + Q+ ++  L+ TI +L  ++++QH+ E+++    +KL++    M
Sbjct: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 668
           + +LQ+Y+  EL L    +  + + I S + ++   L+ ++ + + +   I  N+D ++ 
Sbjct: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 669 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 728
                +++++     M  + VK + ++    +    E +  +  + Q +   +   L+++
Sbjct: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEM 661

Query: 729 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 788
           +EENNN+K+YL  HF KNN+QE+L+  ++  Y   +  ++  + +    +  H+EE++ L
Sbjct: 662 TEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNL 721

Query: 789 IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 848
           ++ +M +A S +ID+E+++F+P + +W  SF+ IN+CD+ + +F N     L+ +K+  D
Sbjct: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELAD 781

Query: 849 TS-------SNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIE 900
            S       +  + E+++  +G V ++    S++K     ND       KH +L+D+ E
Sbjct: 782 NSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDIND-------KHKMLEDHFE 833

 Score =  278 bits (711), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 129/185 (69%), Positives = 147/185 (79%), Gaps = 10/185 (5%)

Query: 34  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS EVSINTTGD GI  +MN++ YTV
Sbjct: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77

Query: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 153
           D+VFGP A Q LIF+ +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GEL+D
Sbjct: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137

Query: 154 AAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKK 213
           +AGIIPRVL +LFDTLE  +SD++VKCS+IELYNEE                    + K+
Sbjct: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEE----------LKDLLDDTPDYSKR 187

Query: 214 LRIFD 218
           LRIFD
Sbjct: 188 LRIFD 192

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  538 bits (1386), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/600 (46%), Positives = 410/600 (68%), Gaps = 11/600 (1%)

Query: 304 PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363
           P TQ     GIYIQNL++FHI+ A EGL LLQRGL+ RQVA+TK+ND SSRSHTIFTITL
Sbjct: 264 PPTQT----GIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITL 319

Query: 364 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG 423
           YKK +D+L+R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+L D+S 
Sbjct: 320 YKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA 379

Query: 424 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 483
           HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLG+
Sbjct: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439

Query: 484 FMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIE 543
           F++KDIL+K+++ EL K+++DL  TKSKEGIY+SQ +YK +  DL++ K E+ E KR  +
Sbjct: 440 FIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTND 499

Query: 544 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 603
           SL  +N LL K+K    E   S  S++++L++ +  +  +L + +    ++S     + +
Sbjct: 500 SLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNR 559

Query: 604 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNL 663
           +   ++  ++ Y+++      KF+  +  E+ +L   +  Q D ++  N      I  ++
Sbjct: 560 IQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN-SGNYQIHTHI 618

Query: 664 DMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAE 723
           D ++ EV+ L+ET +E AE +YK C+  +L E+PK F +I + +  IR   +  Y  +A 
Sbjct: 619 DSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMAR 678

Query: 724 NLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLE 783
           N SD+SEE N  KQYL   FF+NNH E++  H D    N++K ++  +++ + ++ ++L 
Sbjct: 679 NFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLS 738

Query: 784 ENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQI 843
            N +++  ++ +    VI++EMDLF P+++KWE S DLIN+ DS++N+F NNM  ++  I
Sbjct: 739 TNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDI 798

Query: 844 KKTVDTSSNSMNESISVMKGQVEESE-NAISLLKNNTKFNDQFKQLISK-----HIILKD 897
              +  S+ SM+ SIS +K  + E++ N+   + +N    + FK +  K     H++  D
Sbjct: 799 ASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVTGD 858

 Score =  212 bits (539), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 104/156 (66%), Positives = 128/156 (82%), Gaps = 4/156 (2%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           +++NITVAVRCRGRN+REI  KS +VV VPD+T + EVSINT+G +GI AQ+ AK YTVD
Sbjct: 23  DDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTVD 82

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGELND 153
           KV+GP +SQ L+FE+ A PLF DF++GYNCT+LVYGMTSTGKTYTMTGD E    G++N 
Sbjct: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142

Query: 154 AAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 189
            AGI PR+L+KLF+ L   Q DYVVKCSF+ELYNE+
Sbjct: 143 QAGIAPRILVKLFECL---QDDYVVKCSFVELYNED 175

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  535 bits (1379), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 284/618 (45%), Positives = 419/618 (67%), Gaps = 2/618 (0%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           ++  +GIY+QN+QEFHI NA EG+N+LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK  
Sbjct: 242 SESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNC 301

Query: 368 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 427
             ELFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S HIPF
Sbjct: 302 DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361

Query: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 487
           RESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA MMK
Sbjct: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK 421

Query: 488 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 547
           DILVKNI+ ELAKIKSD LSTKSK+GIYMS +HY+ + +DLE+ + E+QE KR+IESL S
Sbjct: 422 DILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS 481

Query: 548 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 607
           +N+LL+KDK  S+E  + QNS+++ L++TI +L  ++++QH  E E++   +KL++    
Sbjct: 482 QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT 541

Query: 608 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 667
           MQ +L+ Y+  EL L    +  + + I S + ++   L+ ++   + +   I+ N++ + 
Sbjct: 542 MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNIT 601

Query: 668 NEVLTLMETMQEKAELMYKDCVKKILNESPK-FFNVIVEKIDIIRIEFQNFYKNIAENLS 726
                 +++++     M  D + K++ E+P  +     E +  ++ E  ++   +   L+
Sbjct: 602 TIFDDTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLT 660

Query: 727 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK 786
           +ISEENN+L++YL  H FKN+ QE+L+  ++S Y+ ++  ++Q +      +  H+EE++
Sbjct: 661 EISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESR 720

Query: 787 KLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKT 846
            L++ +M +  + +ID E  LF+P R +W  S D IN+CD+ +  F     + L ++K+ 
Sbjct: 721 TLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKEL 780

Query: 847 VDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXX 906
            D S  S  ++++  K + +   + +  L  +     Q   +  KH +L+D+ +      
Sbjct: 781 SDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYF 840

Query: 907 XXXXXNVDDIYNTIEDIM 924
                  +D+  +I+ I+
Sbjct: 841 KESSKGFEDMDCSIKKII 858

 Score =  271 bits (694), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 144/184 (78%), Gaps = 10/184 (5%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GI A+MN++ YTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
           KVFGP A Q LIF+E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+L+D+
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 214
           AGIIPR++ KLFD LE   SD++VKCS+IELYNEE                      K+L
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188

Query: 215 RIFD 218
           RIFD
Sbjct: 189 RIFD 192

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  527 bits (1358), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/669 (43%), Positives = 435/669 (65%), Gaps = 15/669 (2%)

Query: 304 PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363
           P   ++ ++ I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI L
Sbjct: 227 PTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 286

Query: 364 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG 423
           Y+K   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ 
Sbjct: 287 YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 346

Query: 424 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 483
           HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+
Sbjct: 347 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 406

Query: 484 FMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIE 543
           F+MKD+LVKN+T EL KI+SDLL+TKSK+GIYMSQ++YK L ++LE++K EVQECKR IE
Sbjct: 407 FIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIE 466

Query: 544 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 603
            L+++N LL K+K  + E  +SQ  +++ L   I+ L  ++D+QHK E E+S    +L +
Sbjct: 467 RLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMR 526

Query: 604 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQ--QKNIFQETDIQP 661
               MQ +L+ Y+ +      + E  + + I S K +L  +++ ++  +++ F   D+  
Sbjct: 527 ALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGF---DVDA 583

Query: 662 NLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNI 721
           N+D +  E+  + + +      + +  + KI  ++P +   I  +++ I     ++  ++
Sbjct: 584 NIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDL 643

Query: 722 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDH 781
             +LS ISEE N+LK YL  HFFKNN Q+ L+ H+D TY  ++   N      +  +N+ 
Sbjct: 644 MMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEE 703

Query: 782 LEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLS 841
           LE NK+++MQ++ NA S V+ +EM L +P +  WE+S + IN+CD +N+ F  ++ + + 
Sbjct: 704 LETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVR 763

Query: 842 QIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEX 901
            + + ++        ++      +   ++A   L+ +       +++  KH +LK  ++ 
Sbjct: 764 DVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQD 823

Query: 902 XXXXXXXXXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEI---P----NLSKRLP 954
                        +I ++I+ ++ +    +  +++  I+ +L+++   P      S + P
Sbjct: 824 SASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTP 882

Query: 955 LRISNINGC 963
           +RI+   GC
Sbjct: 883 MRIT--QGC 889

 Score =  273 bits (697), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 128/184 (69%), Positives = 145/184 (78%), Gaps = 8/184 (4%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           EELNITVAVRCRGRNE+E+  KSSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
           +VFGP A Q LIF+ +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL++ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 214
           AGIIPRVL KLFD L+    DY++KCSFIELYNEE                      +KL
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEE--------LKDLLDETPDSSMPRKL 176

Query: 215 RIFD 218
           RIFD
Sbjct: 177 RIFD 180

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  525 bits (1351), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 287/597 (48%), Positives = 401/597 (67%), Gaps = 17/597 (2%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           D +N IYIQNLQEF+I NA +G+ LLQ+GL+HR+VASTKMND SSRSHTIFTITLYK+H 
Sbjct: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428
             L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488
           ESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG+F+MKD
Sbjct: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548
           +L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLES+K EVQE KR  E L S+
Sbjct: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608
           N  L+KDK  S E  + Q  Q+E     I  L   LD+ +K E  +     +L+ +   M
Sbjct: 569 NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNI--------------- 653
           Q  +++Y++R+L++ +  +  +  E K LK  L   L N+    I               
Sbjct: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIE 688

Query: 654 -FQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRI 712
               ++ Q N+D+++N  L +++ +QEK++ +Y  C+++IL++ P   N    +I+ I  
Sbjct: 689 AIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDF 748

Query: 713 EFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVE 772
           ++ + +  I ENLSD+SEE NN K+YL N F +NN++ +L +H++S    IE  +N  + 
Sbjct: 749 QYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNLLL 808

Query: 773 NFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEF 832
           N    +N+    N KL  + + N  + ++ +E +  +P + KW  S ++IN  D +NN F
Sbjct: 809 NINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTF 868

Query: 833 YNNMAATLSQIKKTVDTSSNSMNESISVMK-GQVEESENAISLLKNNTKFNDQFKQL 888
           +N+M   + QI   +  S N +N SI+ +K  ++ E+E    +L +NT++ +   +L
Sbjct: 869 HNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNINEL 925

 Score =  273 bits (699), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 146/184 (79%), Gaps = 9/184 (4%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS EVSINT+ + GI A MN+K YTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
           KVFGP ASQDL+F+E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GEL+D+
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 214
           AGIIPRVL KLF++ E+   DY++KCSF+ELYNE+                      KKL
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNT---------YKKL 179

Query: 215 RIFD 218
           RIFD
Sbjct: 180 RIFD 183

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  513 bits (1321), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 271/617 (43%), Positives = 417/617 (67%), Gaps = 2/617 (0%)

Query: 313 GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 372
            IYIQNL+EFHI NA EG+ LLQ+GLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296

Query: 373 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKL 432
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ D++ HIPFRESKL
Sbjct: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356

Query: 433 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVK 492
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ +MKD+ +K
Sbjct: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416

Query: 493 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLL 552
           ++  ELAKIK DL STK K+G+YM+Q+HYK+L +DLES+K E+QEC R ++SL  +N+LL
Sbjct: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476

Query: 553 VKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAE-LEISGFNNKLQKMTEVMQVA 611
           +KDK  S E  + Q   +  +  T+++++  L+ QHK E + +    +  +K  + M+  
Sbjct: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK-MKTV 535

Query: 612 LQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVL 671
           +++Y ++E  +    ++  + E+  LK  L   L+ + ++N+  +T+++ N+ ++K++V+
Sbjct: 536 IKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVI 595

Query: 672 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEE 731
           +++   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I ++
Sbjct: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655

Query: 732 NNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQ 791
            + L +Y  N FFK+NH  ++N H+++T   IEK  +   + F+  +    E+N+KLI++
Sbjct: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715

Query: 792 NMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSS 851
           N+   +S +I  EM+ F+  +++W+ SF  IN CD +NN +++ M   L  +K  + +S 
Sbjct: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775

Query: 852 NSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXX 911
             + + ++ +K  V+   +   LL  +    D + Q+ISK   L D+++           
Sbjct: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLL 835

Query: 912 NVDDIYNTIEDIMTNHG 928
             D+I  +I+    N+ 
Sbjct: 836 VFDEICKSIQFAFANYS 852

 Score =  266 bits (680), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 147/186 (79%), Gaps = 11/186 (5%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGD--TGITAQMNAKRYT 92
           +E+NI VAVRCRGRN+REI  KSSV+V+VPD+ GS E+SINT+ D  +G+TAQ+N+K YT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 93  VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN 152
           VDKVFGP A+Q LIFEE+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+L+
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 153 DAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMK 212
           D+AGIIPRVL KLF+T+E Q  +YV+KCSFIELYNEE                     +K
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK---------LK 183

Query: 213 KLRIFD 218
           KLRIFD
Sbjct: 184 KLRIFD 189

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  424 bits (1089), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 241/661 (36%), Positives = 401/661 (60%), Gaps = 15/661 (2%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           +++   YIQNL+EFHITNA EG+ LL RGLK+RQ+AS+K   +SSR+ TIFTI LYK+ +
Sbjct: 252 EKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE 311

Query: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428
            E+FR+SK N VDLAG+E+ ++    NQR K+   INQ +  L +++N+L ++   IPF+
Sbjct: 312 GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFK 371

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488
           +SKLT L++D+L GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  + K+
Sbjct: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE 431

Query: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548
            L+K+I+ ELAK+KSDLLSTKSKEG+YMS +HY  L  DL+ HK E+ + K+ I+ L  +
Sbjct: 432 TLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQ 491

Query: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608
           ++ L KDK    E  + Q  +++S++ +++ +   ++KQ + E ++    +KL++    M
Sbjct: 492 STTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNM 551

Query: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 668
            V +  Y  RE  +  + +T  ++E+  LK+ L   L   ++  +    +I+ NL+    
Sbjct: 552 NVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHE 611

Query: 669 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 728
           E+  +++  + + + ++ DC+KK+  ESPK F+  ++ +  +       Y N+AE LSD+
Sbjct: 612 EIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDV 671

Query: 729 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 788
           SEE NNLKQY+   FFKNNH+ELL  +++ TY  ++K ++ F+  F   L  +LE NK +
Sbjct: 672 SEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSV 731

Query: 789 IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVD 848
           ++QN+ +ATS VI+ EM+ F P++ KWE S +LI K    +NEF       + +++ T+ 
Sbjct: 732 LLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLK 791

Query: 849 TSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXX 908
            +S S+ +++S MK ++ E + A ++++NN    ++F  ++ K+ ILKD +         
Sbjct: 792 GTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTEE 851

Query: 909 XXXNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEI----------PNLSKR-LPLRI 957
                D + ++I ++  N    E  T      +ILKEI          PN+  R  P+R 
Sbjct: 852 SIVAFDKLDDSIRNVFKN----EIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVRQ 907

Query: 958 S 958
           S
Sbjct: 908 S 908

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 91/158 (57%), Gaps = 15/158 (9%)

Query: 36  ELNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93
           E NI V  R +G+  NE+   ++  +++  P +   K        D  +      + + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFK------GKDDAV-----KREFGM 60

Query: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEK--LYNGEL 151
           D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E   L++   
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 152 NDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 189
             + G+IPRVL +LFD L     D+VVKCS++E+YNEE
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEE 158

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  380 bits (977), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 287/914 (31%), Positives = 471/914 (51%), Gaps = 62/914 (6%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPD-ITGSKEVSINTTGDTGITAQMNAKRYTVDKV 96
           NITVAVRCR   + E    S  ++++ D   G+    I     TG       K YT+D V
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 97  FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGELNDAA 155
           +G    Q  +F+E   P ++ F  GYN +++ YG   +GK YT+ G+  +L N   N+A 
Sbjct: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA--NNAE 121

Query: 156 ----GIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEEXXX---XXXXXXXXXXXXXXXX 208
               G++PRVL +LF  LE   +D+++KCSF+E+YN+E                      
Sbjct: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATG 181

Query: 209 QFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLP--N 266
              KKLRI D                           N      A++RKR+  +SLP  N
Sbjct: 182 STGKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPPNN 237

Query: 267 TIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPMTQNDQSNGIYIQNLQEFHITN 326
           +I                                  S  + +++ N IYIQNLQE  IT 
Sbjct: 238 SI-------------SNNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITE 284

Query: 327 ALEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMNLVD 381
             EG+ ++++GLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++ V+
Sbjct: 285 IEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVN 344

Query: 382 LAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLG 441
            AGSE  + + + N      G+ N +L +  ++IN +V+ S +  F +SKLT+LLQ++  
Sbjct: 345 FAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFD 398

Query: 442 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKI 501
           G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ + K+ L+K ++ EL K 
Sbjct: 399 GITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKT 458

Query: 502 KSDLLSTKSKE-GIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSR 560
           KSDLLS KS + GIYM + HY  L   LES+K ++Q  K  I  L  K + +  +K    
Sbjct: 459 KSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFE 518

Query: 561 ETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKREL 620
           E  + Q  ++++L+ TI++L   L+KQ K E E+     KL  +   MQ +++ Y  +E+
Sbjct: 519 EINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEI 578

Query: 621 DLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEK 680
            L  K +    KE+  LK +L     +++ +      ++  N+D +K E+L +    Q K
Sbjct: 579 HLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSK 638

Query: 681 AELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLK 740
            + +  +   ++L+ SPK+F  +   +  +    +  +   +E LSDISEE NNL  Y+ 
Sbjct: 639 VKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYIN 698

Query: 741 NHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAV 800
           ++F K++H+EL++ +I+ TY  ++  + +F ENFK  L+ ++E+N K + +++T+ TS +
Sbjct: 699 DNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEI 758

Query: 801 IDQEMDLFEPRRAKW--------ENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSN 852
           ++ E+  F P + KW        EN  + I K  + N+E    +A  LS+   T +   N
Sbjct: 759 VENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEI---LAKLLSESTSTSELFIN 815

Query: 853 SMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIEXXXXXXXXXXXN 912
           +M    S +K  VE  E    +  +N     +F ++I+K+  LKD I            +
Sbjct: 816 NM----SSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDS 871

Query: 913 VDDIYNTIEDIMTN 926
            D++   ++++  N
Sbjct: 872 FDNLKEAMQNVFKN 885

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  260 bits (664), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 177/490 (36%), Positives = 281/490 (57%), Gaps = 50/490 (10%)

Query: 314 IYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT-----LYKKHQ 368
           I+++ ++E +I +A EGL LL  G   R+VA+TK ND SSRSHTIFTIT     ++    
Sbjct: 251 IFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTKIHPISG 310

Query: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428
           ++  ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S HIP+R
Sbjct: 311 EQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYR 370

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488
           ESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ+   M K+
Sbjct: 371 ESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAKE 430

Query: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548
             +     E+ +++ +L ++ SKEGIY++Q+ ++      ES+   V+E + +I++L  +
Sbjct: 431 SCIIEYIQEIERLRKELRASHSKEGIYITQEKFET----YESNSILVEEQQAKIDNLQEQ 486

Query: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608
              L +  L+  + I+ ++ Q++ L       +  L++     + I+G ++K        
Sbjct: 487 LRRLKEKFLEQTKLIKEKDGQIKELDVAN---RKYLEQSKDLTIYINGIHSK-------- 535

Query: 609 QVALQDYKKRELDL---NKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDI------ 659
              L+DY+   + +   N K    I+    ++   L  ++D+++  N+    +I      
Sbjct: 536 ---LEDYEHTMIGIHNNNMKLLEDINDNRGNIHEDLLAKVDHIETCNLIISREITSLISI 592

Query: 660 ----QPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKI-DIIRIEF 714
               Q   D  K  +  + E +QEK   + +   +  L+    F +   E++ DII+   
Sbjct: 593 RNVLQAYSDRFKTVLGGVFEELQEKLTQVGRTTEESQLDVDLSFVDEKFEEVTDIIKATC 652

Query: 715 QNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENF 774
           +N  + + E++S++  E  +L     +         LL     + +  ++K    +VE+ 
Sbjct: 653 ENLVRTMDEHVSNMKLETTDLTSSCAS---------LLEKECQALHGKLQK----YVESM 699

Query: 775 KMTLNDHLEE 784
           K  LN  L+E
Sbjct: 700 KQELNSTLQE 709

 Score =  137 bits (346), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 97/161 (60%), Gaps = 15/161 (9%)

Query: 36  ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDK 95
           E NI V VRCR RNEREI  KSSVV++     G +EV +   G TG     + K YT D+
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNG-REVILTNPG-TG-----SNKTYTFDR 104

Query: 96  VFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE----- 150
           VFG  + Q+ +F +VA     + I+GYNCTV  YG T TGKTYTM+GD  +         
Sbjct: 105 VFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPN 164

Query: 151 ---LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
              L++ AGIIPRVL++LF  L     DY VK SF+ELYNE
Sbjct: 165 FVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNE 205

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  256 bits (655), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 169/220 (76%), Gaps = 8/220 (3%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 368 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 419
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 420 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 479
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 480 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 519
           Q+   + KD  +K+   E+ K+K+DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 93/161 (57%), Gaps = 16/161 (9%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI V VRCR RN+REI  KSSVV++     G KE+ ++       ++  + K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 147
           G  + Q+ +F   A    ++ + GYNCT+  YG T TGKTYTM+GD          +KL 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 148 NGELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
            GE    AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNE 206

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  256 bits (655), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 169/220 (76%), Gaps = 8/220 (3%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 368 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 419
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 420 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 479
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 414

Query: 480 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 519
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  127 bits (319), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 92/158 (58%), Gaps = 10/158 (6%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI V VRCR RN+REI  KSSVV++     G KE+ ++       ++  + K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-------EKLYNGE 150
           G  + Q+ +F   A    ++ + GYNCT+  YG T TGKTYTM+GD       +   N  
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 168

Query: 151 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
           L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 169 LGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNE 206

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  256 bits (654), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 129/220 (58%), Positives = 169/220 (76%), Gaps = 8/220 (3%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 368 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 419
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 420 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 479
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 480 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 519
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 97/177 (54%), Gaps = 19/177 (10%)

Query: 28  GCHSVP---------NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTG 78
           G H VP           E NI V VRCR RN REI  KSSVV++     G KE+ ++   
Sbjct: 33  GKHPVPPPICNNSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQG-KEIILSNGS 91

Query: 79  DTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 138
               ++  + K Y  D+VFG  + Q+++F   A    ++ + GYNCT+  YG T TGKTY
Sbjct: 92  HQSYSS--SKKTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTY 149

Query: 139 TMTGD-------EKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
           TM+GD       +   N  L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 150 TMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNE 206

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  256 bits (653), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 169/220 (76%), Gaps = 8/220 (3%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 234 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 368 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 419
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 294 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 353

Query: 420 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 479
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 354 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 413

Query: 480 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 519
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 414 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

 Score =  126 bits (316), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/165 (41%), Positives = 94/165 (56%), Gaps = 10/165 (6%)

Query: 31  SVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 90
           S    + NI V VRCR RN+REI  KSSVV++     G KE+ ++       ++  + K 
Sbjct: 44  SAATSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKT 100

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD------- 143
           Y  D+VFG  + Q+ +F   A    ++ + GYNCT+  YG T TGKTYTM+GD       
Sbjct: 101 YQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDV 160

Query: 144 EKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
           +   N  L + AGIIPRVL+ LF  L     +Y VK +F+ELYNE
Sbjct: 161 QSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNE 205

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  254 bits (650), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 129/223 (57%), Positives = 164/223 (73%), Gaps = 5/223 (2%)

Query: 304 PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363
           P      S+ I ++ ++E +I +A EGL LL  G   RQVASTK ND SSRSHT+FTIT 
Sbjct: 242 PEKNTQGSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITT 301

Query: 364 YKKHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 418
                D     E  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL
Sbjct: 302 NVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL 361

Query: 419 VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 478
           VD S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN 
Sbjct: 362 VDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNT 421

Query: 479 PQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 521
           PQ+   M KD  +     E+ +++ +L +T++K+GIY++Q+ Y
Sbjct: 422 PQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  139 bits (349), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 100/162 (61%), Gaps = 12/162 (7%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR-YTVDKV 96
           NI V VRCR RN+REIG KSSVV++     G ++V ++    +   +  N K+ YT D+V
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQG-RDVILSNPSSSSSGSLTNVKKTYTFDRV 112

Query: 97  FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------ 150
           FG  + Q+++F  VA     + ++GYNCTV  YG T TGKTYTM+GD  +          
Sbjct: 113 FGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQ 172

Query: 151 ----LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
               L++ AGIIPRVL+ LF  L+ + +DY VK SF+ELYNE
Sbjct: 173 SSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNE 214

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  251 bits (641), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/314 (44%), Positives = 208/314 (66%), Gaps = 23/314 (7%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT----- 362
           N   + I ++ ++E +I +A EGL LL  G   R+VA+T+ ND SSRSHTIFTIT     
Sbjct: 249 NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 363 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 422
           ++    ++  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 309 IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 423 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 482
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+ 
Sbjct: 369 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 483 AFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREI 542
             M K+  +     E+ K++ +L +  +KEGIY++++ Y+      ES+   V+E + +I
Sbjct: 429 QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYET----YESNCILVEEQQAKI 484

Query: 543 ESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQ 602
           ++L  +     +  L+  + ++ +++Q++ +K+ IN               I+ +N KL 
Sbjct: 485 DNLQEQIKRFKEKYLEQTKLVKEKDTQVKMIKS-INE-------------RITMYNKKLT 530

Query: 603 KMTEVMQVALQDYK 616
              + ++  ++DY+
Sbjct: 531 DYLDKLRFRVEDYE 544

 Score =  138 bits (347), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 96/159 (60%), Gaps = 15/159 (9%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI V VRCR RN REI  KSSVVV+     G + +  N +  TG     N K YT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQS--TG-----NNKTYTFDQVF 108

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA--- 154
           G  + Q+ +F++VA     + ++GYNCTV  YG T TGKTYTM+GD  +    L D    
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 155 -----AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
                AGIIPRVL++LF  L+ +  DY VK SF+ELYNE
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNE 207

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  248 bits (632), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/218 (57%), Positives = 161/218 (73%), Gaps = 5/218 (2%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           N   + I ++ ++E +I +A EGL LL  G   R+VASTK+ND SSRSHTIFTI      
Sbjct: 334 NCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTK 393

Query: 368 QD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 422
            D        +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVDRS
Sbjct: 394 VDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRS 453

Query: 423 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 482
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+ 
Sbjct: 454 HHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQIN 513

Query: 483 AFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 520
             + KD  +     E+ +++++L   ++KEGIY++QD 
Sbjct: 514 QSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQ 551

 Score =  117 bits (293), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 99/218 (45%), Gaps = 69/218 (31%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEV----------SINTTGDTGITAQ-- 85
           NI V VRCR R +REI  KSSVV++     G+K +          + N  G T       
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 86  ---------------MNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYG 130
                           N + YT DKVFG  + Q+ +FE VA     + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 131 MTSTGKTYTMTGD----------EKLYNGELNDAAGIIPRVLLKLFDTLE---------- 170
            T TGKTYTM+GD          +K+  GE    AGIIPRVL+ LF  L           
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGE---HAGIIPRVLVYLFKELSKNDTITNTKV 227

Query: 171 -------------------LQQSDYVVKCSFIELYNEE 189
                              L+ ++Y VK SF+ELYNE+
Sbjct: 228 NNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEK 265

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  246 bits (629), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 163/214 (76%), Gaps = 5/214 (2%)

Query: 314 IYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 369
           I ++ ++EF+I +A EGL LL  G   R+VA+TK ND SSRSHT+FTIT      D    
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 370 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428
            +  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488
           ESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   M K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK 522
             +     E+ +++ +L +++ KEG+Y+++D ++
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 98/159 (61%), Gaps = 13/159 (8%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           N+ V VRCR RNE+EI  KSSVV++     G + +  N  G    +   + + YT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAG----SLSHSKRTYTFDQVF 96

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN----- 152
           G  + Q+ +F+EVA     + ++GYNCTV  YG T TGKTYTM+GD  +  G+L+     
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISIL-GDLDSQDKI 155

Query: 153 ---DAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
              + +GIIPRVL+ LF  L  + ++Y VK SF+ELYNE
Sbjct: 156 LLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNE 194

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  243 bits (620), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 200/302 (66%), Gaps = 22/302 (7%)

Query: 311 SNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT-----LYK 365
           S+ I ++ ++E +I +A +GL LL  G   R+VA+TK ND SSRSHT+FTIT     L  
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 366 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHI 425
              ++  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD + HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 426 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFM 485
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   M
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 486 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESHKNEVQECKREI 542
            KD  +     E+ +++ +L +++ K+GI ++QD +    S+   ++  K ++Q  + +I
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQI 478

Query: 543 ESLASK--NSLLVKDKLKSR------ETIQ--SQNSQ----MESLKATINHLKAQLDKQH 588
           +    K      +   L+SR      +TIQ  SQ +Q    +E+ ++  NH   ++ K H
Sbjct: 479 QRFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNHYIERVTKIH 538

Query: 589 KA 590
            +
Sbjct: 539 DS 540

 Score =  130 bits (326), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 94/158 (59%), Gaps = 12/158 (7%)

Query: 39  ITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFG 98
           I V VRCR RNEREI  KSSVV++     G+ + +     +  +      + YT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 99  PGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN------ 152
             + Q+ +F + A     + ++GYNCTV  YG T TGKTYTM+GD  +  G+L+      
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 153 --DAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
             + AGIIPRVL++LF  L+  +  Y VK SF+ELYNE
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNE 214

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  243 bits (619), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 160/218 (73%), Gaps = 5/218 (2%)

Query: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367
           N+ S+ I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHT+FTI      
Sbjct: 283 NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 368 QDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 422
            D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 343 IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 423 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 482
            HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 483 AFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 520
             M KD  +     E+ +++ +L +++ K+GI ++QD 
Sbjct: 463 QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQ 500

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 94/158 (59%), Gaps = 12/158 (7%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI V VRCR R+EREI  KSSVV++     G++ +  N +           K Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGE------ 150
           G  + Q+ +F + A     + + GYNCTV  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 151 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
           L + AGIIPRVL+ LF  L L ++DY VK SF+ELYNE
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNE 260

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  242 bits (617), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/213 (55%), Positives = 160/213 (75%), Gaps = 5/213 (2%)

Query: 314 IYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 369
           I ++ ++E +I +A EGL LL +G   R+VA+TK ND SSRSHTIFTI  +    D    
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 370 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428
            +  +I K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVINALV+ S HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488
            SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 521
             +     E+ +++ +L +++ +EG+Y++Q+ Y
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

 Score =  134 bits (337), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 74/159 (46%), Positives = 98/159 (61%), Gaps = 13/159 (8%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI V VRCR RN+REI  KSSVVV+     G K  S+  +  +   +    K Y  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVST---MGRKGKSVILSNPSSPLSHPK-KTYMFDEVF 99

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN----- 152
           G  + Q+ IF EVA    Q+ ++GYNCTV  YG T TGKTYTM+GD  ++ G+L+     
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-GDLDSQDKI 158

Query: 153 ---DAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
              + AGIIPRVL+ LF  L  + +++ VK SF+ELYNE
Sbjct: 159 LLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNE 197

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  238 bits (608), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 5/221 (2%)

Query: 306 TQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK 365
           ++N+  + I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHTIFTIT   
Sbjct: 246 SRNNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNI 305

Query: 366 KHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 420
              D     +  +I K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLTLGRVINALVD
Sbjct: 306 TKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVD 365

Query: 421 RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 480
            S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 366 HSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQ 425

Query: 481 LGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 521
           +   M KD+ +     E+ +++ +L +++ K+G+Y++Q+ +
Sbjct: 426 INQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 94/161 (58%), Gaps = 17/161 (10%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI V VRCR RN+REI  KSSVV++     G KEV ++   D         K Y  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLS---DPSSVLSHTKKTYIFDQVF 114

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 147
           G  + Q+++F   A     + ++GYNCT+  YG T TGKTYTM+GD          +K+ 
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 148 NGELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
            GE    AGIIPRVL+ LF  L  + ++Y VK SF+ELYNE
Sbjct: 175 LGE---HAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNE 212

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  181 bits (460), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 145/230 (63%), Gaps = 31/230 (13%)

Query: 313 GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD--- 369
            I ++ +QE  I NA+EGLNLL +G   R+V STK+ND SSRSHTIFTIT      D   
Sbjct: 207 SIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQT 266

Query: 370 --ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGH--- 424
             E  +I K+NLVDLAGSENI +SG   +R++E G IN+SLLTLGRVINAL D++ +   
Sbjct: 267 NKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALSDKTNNTHG 324

Query: 425 ---------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 463
                                IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET 
Sbjct: 325 SNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETI 384

Query: 464 STLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEG 513
           STLEYA++A +IKN P++         + +   ++ ++K +L ++  K G
Sbjct: 385 STLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIG 434

 Score =  133 bits (334), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 96/167 (57%), Gaps = 26/167 (15%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI V VRCR RN++EI  KSSVVV+     G++ +  N+T         N  +Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA--- 154
           G  + Q+ IF  VA    Q+ I GYNCT+  YG T TGKTYTM+GD  +  G+LN     
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNSTKNI 118

Query: 155 -----AGIIPRVLLKLFDTLELQQSD--------YVVKCSFIELYNE 188
                AGIIPRVL++LF +LE   S+        Y VK SF+ELYNE
Sbjct: 119 LLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNE 165

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  144 bits (362), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 126/363 (34%), Positives = 193/363 (53%), Gaps = 45/363 (12%)

Query: 312 NGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DE 370
           +GIY++ L   ++T+  E L+ +++G   R V+ST MN  SSRSH+I  I L K++  +E
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEE 254

Query: 371 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD-------RSG 423
             + S + LVDLAGSE + ++ A     +EA  IN SL  LG VINAL          S 
Sbjct: 255 NIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSA 314

Query: 424 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 483
           HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+AK IKN      
Sbjct: 315 HIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN------ 368

Query: 484 FMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKRE-- 541
           F    IL KN       ++  L   KS+E  Y+ +         + + + E+ E K +  
Sbjct: 369 FA---ILNKNNLSSRNLLEQQLEELKSRETGYLLR---------ISTLEKELLESKAQND 416

Query: 542 IESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINH--LKAQLDKQHKAELEISGFNN 599
           IE  + K      D L+  + ++   SQ+ESL   I+H    A  D     +  I    N
Sbjct: 417 IEDPSQKPLPPTPDLLEENKKLK---SQVESLAGLISHSNSGATDDPSISYDDLIQNLMN 473

Query: 600 KLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF--QET 657
           + + + E+ Q +L +    +++LNKKF+  ++   + + T     L++  Q+ ++  QET
Sbjct: 474 RCENVVEI-QASLDE----QVELNKKFQQSLASTTERMYT-----LEDRSQRLLYQLQET 523

Query: 658 DIQ 660
            I+
Sbjct: 524 QIE 526

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 65/109 (59%), Gaps = 11/109 (10%)

Query: 83  TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 142
           + Q N + +T D+VF  G++Q+ ++E VAG + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 143 DEKLYNGELNDAAGIIPRV---LLKLFDTLELQQSDYVVKCSFIELYNE 188
            +        +  G+IPR+   + K  +T + +   + V  SF+E+Y E
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLE 167

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  140 bits (353), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 113/173 (65%), Gaps = 8/173 (4%)

Query: 315 YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF-- 372
           +++ LQEF + +  E L+ L++G + + V +T +N+ SSRSHTIFTI + +K    L   
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 373 --RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGH--IPFR 428
             R S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  L  +     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 481
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 15/93 (16%)

Query: 103 QDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVL 162
           Q  ++E++A       + GYN  +  YG T +GK++TMTG  +L         GI+PR+ 
Sbjct: 63  QAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRMC 114

Query: 163 LKLFDTLELQQSD-------YVVKCSFIELYNE 188
            +LF+  E+ +S        + ++CS++E+YNE
Sbjct: 115 QELFEVREMYESSDDQASTQFKIRCSYLEIYNE 147

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  139 bits (349), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 115/175 (65%), Gaps = 8/175 (4%)

Query: 315 YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 374
           +++ L+EF +++  + LN +++G + R + ST +N++SSRSHTIFTI++ +K +  L  +
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 375 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGH--IPFR 428
               S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ L  R     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 483
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL A
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQLNA 341

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 84/192 (43%), Gaps = 29/192 (15%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI VAVR R   ERE+    S++  V D    +    N   +T        + +  D+ F
Sbjct: 4   NIKVAVRLRRPLEREV--DESIIARVEDGNVIQVKDRNQKNET--------RSFHFDQCF 53

Query: 98  GPG----ASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 153
                  A Q  ++E+++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGSP--------E 105

Query: 154 AAGIIPRVLLKLFDTLELQQSD-------YVVKCSFIELYNEEXXXXXXXXXXXXXXXXX 206
           + GI+ R+  +LF+  E+ +S        + ++CS++E+YNE                  
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGRCRIRERAD 165

Query: 207 XXQFMKKLRIFD 218
              F++ LR FD
Sbjct: 166 KTTFVEGLREFD 177

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  136 bits (343), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 110/173 (63%), Gaps = 8/173 (4%)

Query: 315 YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ----DE 370
           +++ L EF +    E L  +++G + R V  T MN+ SSRSH IFTI++ +       D 
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 371 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DRSGHIPFR 428
             R S + LVDLAGSE ++ +GA   R KE  +IN+SL TLGRV++ L   +R   IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 481
           +S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN  ++
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARV 368

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 77/173 (44%), Gaps = 22/173 (12%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI VAVR R    RE G      V  P  +   +  I+T+           K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 98  ----GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE---KLYNGE 150
                    Q++I++ +        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 151 L-------NDAAGIIPRVLLKLFDTLELQQSD-------YVVKCSFIELYNEE 189
                   + A GIIPRV   LFD   +  S+       + + CS++E+YNE+
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQ 175

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  135 bits (339), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 110/177 (62%), Gaps = 5/177 (2%)

Query: 303 SPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 362
           SP  +       ++Q++  F +    E L  L  G   R VAST+MN  SSRSH IFT++
Sbjct: 137 SPRVRETNDKKTFVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLS 196

Query: 363 LYKKHQDELFRISKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINALVD 420
           + ++  D   R S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ L  
Sbjct: 197 IKQQEPDGSIRESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAK 256

Query: 421 RSGH-IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
            S H IP+R+S LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK
Sbjct: 257 NSKHLIPYRDSLLTWVLKENLGGNSKTCMIACISPIDL--EESLSTLRYATTAKEIK 311

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 83  TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 142
           T +   + +  D +F   +SQ  I  E+        ++GYN  +  YG T +GKTYTM G
Sbjct: 29  TVEPPLRSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRG 88

Query: 143 DEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDY-VVKCSFIELYNEE 189
                    N   GIIP +   LFD LEL ++    V  ++ E+YNE+
Sbjct: 89  T--------NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEK 128

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  126 bits (317), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 104/169 (61%), Gaps = 3/169 (1%)

Query: 313 GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL- 371
           G+Y++      +++  E LN +  G   R   ST MN  SSRSH I  I L K+   E  
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDNLEGN 247

Query: 372 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DRSGHIPFRE 429
            + S + LVDLAGSE + ++ A+    +EA  IN SL +LG VINAL   ++  HIP+R+
Sbjct: 248 IQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIPYRD 307

Query: 430 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 478
           S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IKNK
Sbjct: 308 SQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 12/105 (11%)

Query: 88  AKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 147
           A+ +  D VFG  A Q+ +F+ VA  +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPP--- 113

Query: 148 NGELNDAAGIIPRVLLKLFDTLELQQS----DYVVKCSFIELYNE 188
                   G+IPR+  ++F+ + L ++    +YVV  SF+E+Y E
Sbjct: 114 -----GHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLE 153

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  126 bits (316), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 112/182 (61%), Gaps = 5/182 (2%)

Query: 302 RSPMTQNDQSN-GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 360
           R+ +T ++ S  G+Y+Q+     +++  E L+ +  G   R  +ST MN  SSRSH I  
Sbjct: 203 RTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVK 262

Query: 361 ITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 419
           I L K+   E   + S + LVDLAGSE ++++ A+    +EA  IN SL +LG VINAL 
Sbjct: 263 INLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALT 322

Query: 420 DRS---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
            +     HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+
Sbjct: 323 QKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIE 382

Query: 477 NK 478
           NK
Sbjct: 383 NK 384

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 64/112 (57%), Gaps = 12/112 (10%)

Query: 81  GITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM 140
           G+  +  ++ +  D VFG  ++QD +++ VA  +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 141 TGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQS----DYVVKCSFIELYNE 188
            G          D  G+IPR+  ++F+ + L +S    +YVV  SF+E+Y E
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLE 180

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  123 bits (309), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 107/182 (58%), Gaps = 8/182 (4%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 364
           + + D  N I + NL   H T   + +NL+ +G  +R  + T+ N+ SSRSH +  I + 
Sbjct: 260 IIREDTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM 319

Query: 365 KKHQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV- 419
           + ++          + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL  
Sbjct: 320 QTNKLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCL 379

Query: 420 ---DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
               R+ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 380 NDGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 477 NK 478
            K
Sbjct: 440 TK 441

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 14/122 (11%)

Query: 73  SINTTGDTGITAQMNAK----RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLV 128
           SIN+ G     +Q        ++  DK+F   +SQ  +++E   PL    + GYN TV  
Sbjct: 131 SINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFA 190

Query: 129 YGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELY 186
           YG T  GKTYT++G             G+I   + +LF+ ++    + ++ +  S++E+Y
Sbjct: 191 YGATGCGKTYTVSGTP--------SQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIY 242

Query: 187 NE 188
           NE
Sbjct: 243 NE 244

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  122 bits (307), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 109/182 (59%), Gaps = 8/182 (4%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 364
           + + D  N I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH++  I + 
Sbjct: 260 VIREDTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIM 319

Query: 365 KKHQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV- 419
           + ++          + ++++DLAGSE  + +     R  E  +IN+SLL LG  INAL  
Sbjct: 320 QTNKLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCL 379

Query: 420 ---DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
               R+ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 380 NDGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 477 NK 478
            K
Sbjct: 440 TK 441

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F   +SQ  +++E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP----- 206

Query: 150 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 188
                 GII   + +LF+ +     + ++ +  S++E+YNE
Sbjct: 207 ---SQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNE 244

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 113/182 (62%), Gaps = 8/182 (4%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 364
           + + DQ++ I + NL      N  + ++L+ RG  +R  + T+ N+ SSRSH++  I + 
Sbjct: 202 IIREDQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVK 261

Query: 365 K--KHQDELFRI----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 418
           +  K+ D++       S ++++DLAGSE    +     R  E  +IN+SLL LG  INAL
Sbjct: 262 QVLKNFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINAL 321

Query: 419 V--DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
               +S HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK IK
Sbjct: 322 CINKKSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIK 381

Query: 477 NK 478
            K
Sbjct: 382 TK 383

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 13/104 (12%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F   ++Q+ IFE+   PL    + G+N TV  YG T  GKTYT+ G       
Sbjct: 91  KFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING------- 143

Query: 150 ELNDAAGIIPRVLLKLFDTLEL-----QQSDYVVKCSFIELYNE 188
             ++  GII R + +LF  +E+      +S   +  S++E+YNE
Sbjct: 144 -TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNE 186

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 106/180 (58%), Gaps = 8/180 (4%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           + D   GI + NL         + ++L+ RG  +R  + T  N+ SSRSH +  I + +K
Sbjct: 245 REDSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQK 304

Query: 367 HQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 419
           ++     E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 305 NRTAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSG 364

Query: 420 -DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 478
              + H+P+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK IK K
Sbjct: 365 RRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 10/102 (9%)

Query: 89  KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 148
           +++  DK+F   A+Q  ++E    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 134 QKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGTP---- 189

Query: 149 GELNDAAGIIPRVLLKLFDTLE-LQQSDYV-VKCSFIELYNE 188
               +  G+I   + +LF  +E L+ S +  +  S++E+YNE
Sbjct: 190 ----EQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNE 227

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 108/184 (58%), Gaps = 10/184 (5%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 364
           + + D  N I + NL +   T   E ++L+ RG  +R  + T+ N+ SSRSH +  I + 
Sbjct: 263 IIREDTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIV 322

Query: 365 KKHQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV- 419
           +K++     E      ++++DLAGSE    +     R  E  +IN+SLL LG  INAL  
Sbjct: 323 QKNRTPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCI 382

Query: 420 ----DRS-GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 474
               +R   H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK 
Sbjct: 383 NGNDERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKE 442

Query: 475 IKNK 478
           IK K
Sbjct: 443 IKTK 446

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F   A+Q  +++     L    + G+N TV  YG T  GKTYT++G       
Sbjct: 155 KFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP----- 209

Query: 150 ELNDAAGIIPRVLLKLFDTLE-LQQS-DYVVKCSFIELYNE 188
              +  GI+ + + +LF  +E L+ +  + +  SF+E+YNE
Sbjct: 210 ---ENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNE 247

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 105/172 (61%), Gaps = 7/172 (4%)

Query: 315 YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK----KHQDE 370
           YI+ L +  + +  E L  ++ G   R VA T +N+ SSRSH I TI + +       D 
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 371 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV-DRSGHIPFRE 429
           + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L  ++   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 430 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 481
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHL 342

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 74/161 (45%), Gaps = 23/161 (14%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           NI VA+R R +  RE    S +         S E+++       +   +    Y  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPSVIKRKT-----SNEITLQKDNTANVITTVEHTFY-FDQVF 57

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGI 157
              ++Q  I+ E+A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 158 IPRVLLKLFDTLELQQSD---------YVVKCSFIELYNEE 189
           IP V  +LF  +++ Q +         + V  S+ ++YNE+
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQ 150

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 107/183 (58%), Gaps = 13/183 (7%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           + D  N I + NL         + ++L+  G  +R  ++T  N+ SSRSH +  I + + 
Sbjct: 238 REDSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQS 297

Query: 367 HQ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV- 419
            +      D  F  +K++++DLAGSE    +    +R +E  +IN+SLL LG  INAL  
Sbjct: 298 SRTAEITSDHTF--AKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCI 355

Query: 420 ----DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 475
                R+ H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK I
Sbjct: 356 SDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEI 415

Query: 476 KNK 478
           K K
Sbjct: 416 KTK 418

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F   A+Q+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 128 KFVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGTP----- 182

Query: 150 ELNDAAGIIPRVLLKLFDTL-ELQQS-DYVVKCSFIELYNE 188
              +  G+I   + +LF  + EL+ +  + +  S++E+YNE
Sbjct: 183 ---ERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNE 220

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 109/184 (59%), Gaps = 10/184 (5%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 364
           + + D +N I + NL   +     E ++L+ +G  +R  + T+ N+ SSRSH +  I + 
Sbjct: 258 IIREDGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIM 317

Query: 365 KKHQDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV- 419
           + ++          + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL  
Sbjct: 318 QTNRTADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCL 377

Query: 420 -----DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 474
                +RS HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK 
Sbjct: 378 TDGGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKE 437

Query: 475 IKNK 478
           IK K
Sbjct: 438 IKTK 441

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 57/101 (56%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F   ASQ+ +++     L    + G+N TV  YG T  GKTYT++G       
Sbjct: 150 KFVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP----- 204

Query: 150 ELNDAAGIIPRVLLKLFDTLE-LQQSD-YVVKCSFIELYNE 188
              +  GII RV+ +LF+ +E L+ +  + +  S++E+YNE
Sbjct: 205 ---EQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNE 242

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  121 bits (303), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 107/182 (58%), Gaps = 8/182 (4%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 364
           + + D  + I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH +  I + 
Sbjct: 260 VIREDTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM 319

Query: 365 KKHQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV- 419
           + ++          + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL  
Sbjct: 320 QTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCL 379

Query: 420 ---DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
               RS HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 380 NDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 477 NK 478
            K
Sbjct: 440 TK 441

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F   +SQ  +++E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP----- 206

Query: 150 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 188
                 GII   + +LF+ +     + ++ +  S++E+YNE
Sbjct: 207 ---SQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNE 244

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  121 bits (303), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 110/181 (60%), Gaps = 9/181 (4%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           + D    I + NL    ++   + ++L+ +G  +R  ++T  N+ SSRSH +  + + ++
Sbjct: 234 REDSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQR 293

Query: 367 HQD----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 419
           ++     E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 294 NRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSG 353

Query: 420 -DRSG-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477
             R G H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 354 RKRGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKT 413

Query: 478 K 478
           K
Sbjct: 414 K 414

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 10/102 (9%)

Query: 89  KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 148
           +++  D+VF   +SQ  ++E    PL    + G+N TV  YG T  GKTYT++G      
Sbjct: 123 QKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGTP---- 178

Query: 149 GELNDAAGIIPRVLLKLFDTL-ELQQSD-YVVKCSFIELYNE 188
               +  GII   + +LF  + ELQ +  + +  S++E+YNE
Sbjct: 179 ----ENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNE 216

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 105/180 (58%), Gaps = 8/180 (4%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           + D  N I + NL   H     + ++L+ +G  +R  + T+ N+ SSRSH +  I + + 
Sbjct: 262 REDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQT 321

Query: 367 HQ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 419
           ++          + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 322 NKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND 381

Query: 420 -DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 478
             RS HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 56/101 (55%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F   +SQ  +++E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPS---- 207

Query: 150 ELNDAAGIIPRVLLKLFDTL-ELQ-QSDYVVKCSFIELYNE 188
                 GII   + +LF+ + +L+ + D+ +  S++E+YNE
Sbjct: 208 ----QPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNE 244

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 109/182 (59%), Gaps = 14/182 (7%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 367
           D  N  ++ NL +    N  E ++L+ +G  +R  + T  N+ SSRSH +  I + + + 
Sbjct: 235 DSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNR 294

Query: 368 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 419
                QD+ F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 295 TADIKQDQTF--ATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSS 352

Query: 420 DRSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
            R+G   H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK
Sbjct: 353 TRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIK 412

Query: 477 NK 478
            K
Sbjct: 413 TK 414

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 56/104 (53%), Gaps = 12/104 (11%)

Query: 89  KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 148
           +++  D++F    +Q  ++E    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 122 QKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT----- 176

Query: 149 GELNDAAGIIPRVLLKLFDTLELQQSD---YVVKCSFIELYNEE 189
              ++  GII   + +LF  +E Q  D   + ++ SF+E+YNE+
Sbjct: 177 ---SEQPGIIFLTMQELFIRME-QLKDTKKFQLQLSFLEIYNEQ 216

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 107/181 (59%), Gaps = 13/181 (7%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           D +  I + NL  ++     + ++L+ +G  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 369 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 419
                 D  F  + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 299 TADLKSDHTF--ATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLND 356

Query: 420 --DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477
              RS H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 357 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKT 416

Query: 478 K 478
           K
Sbjct: 417 K 417

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 56/101 (55%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           R+  D++F   ++Q  ++E    PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 127 RFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGSP----- 181

Query: 150 ELNDAAGIIPRVLLKLFDTLE-LQQSDYV-VKCSFIELYNE 188
              +  GII + + +LF+ +E L+ + +  +  SF+E+YNE
Sbjct: 182 ---ENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNE 219

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 104/185 (56%), Gaps = 13/185 (7%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 364
           +  +DQS   Y+ N++ F I N  + + L+ +    R  +ST +N  SSRSH IF I L 
Sbjct: 553 IRHDDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLE 612

Query: 365 K-KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL----- 418
              H+     ISK+NLVDLAGSE IN S     R KE  SIN+SL  LG VI+AL     
Sbjct: 613 GYNHKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNK 672

Query: 419 -------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 471
                  + ++ HIPFR SKLT LL+ SL G++KT +   +S  +    ET ++L +A+K
Sbjct: 673 NHLNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATK 732

Query: 472 AKNIK 476
             N K
Sbjct: 733 VNNTK 737

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 49/101 (48%), Gaps = 14/101 (13%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D VF        +F E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 444 FEFDHVFKQDEGNSEVFNEIE-QLIQSALDGYNVCIFAYGQTGSGKTYTM---------- 492

Query: 151 LNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 188
           LN   G+IP  +  +F   D+L+    +Y V C FIELYNE
Sbjct: 493 LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNE 533

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 105/187 (56%), Gaps = 17/187 (9%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL- 363
           + + D +  I + NL      +  + L+L+ RG  +R  + T+ N  SSRSH +  I + 
Sbjct: 250 VIREDSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIM 309

Query: 364 -------YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 416
                   K+HQ        ++++DLAGSE    +    +R  E  +IN+SLL LG  IN
Sbjct: 310 QRNKLVDLKEHQT----FGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCIN 365

Query: 417 ALVDRSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 471
           AL    G     H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++
Sbjct: 366 ALCSNDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANR 425

Query: 472 AKNIKNK 478
           AK IK K
Sbjct: 426 AKEIKTK 432

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 53/108 (49%), Gaps = 10/108 (9%)

Query: 83  TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 142
           T   +  ++  DK+F    SQ+ ++      L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 143 DEKLYNGELNDAAGIIPRVLLKLFDTLELQQS--DYVVKCSFIELYNE 188
                     +  GII R + +LF  ++      D+ +  SF+E+YNE
Sbjct: 195 T--------RENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNE 234

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 108/181 (59%), Gaps = 9/181 (4%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           + D    I + NL    +    + ++L+ +G  +R  ++T  N+ SSRSH +  + + +K
Sbjct: 234 REDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQK 293

Query: 367 HQD----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 419
           ++     E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 294 NRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGG 353

Query: 420 DRSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477
            R G  H+P+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK IK 
Sbjct: 354 KRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKT 413

Query: 478 K 478
           K
Sbjct: 414 K 414

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 62/124 (50%), Gaps = 17/124 (13%)

Query: 73  SINTTGDTGITAQMNAKR-----YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVL 127
           SI T   +     MN++R     +  D+VF   ASQ+ ++E    PL    + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 128 VYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSD---YVVKCSFIE 184
            YG T  GKTYT++G          +  GII   + +LF  +E Q  D   + +  S++E
Sbjct: 162 AYGATGCGKTYTVSGTA--------ENPGIIFLTMQELFAKME-QLKDTKKFELTASYLE 212

Query: 185 LYNE 188
           +YNE
Sbjct: 213 IYNE 216

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 112/188 (59%), Gaps = 23/188 (12%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           D +N I + NL  +      E ++L+ +G  +R  +ST  N+ SSRSH +  I L ++++
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 369 --------DELFRISKMNLVDLAGSENINRSGALNQRAK---EAGSINQSLLTLGRVINA 417
                   ++LF  S ++++DLAGSE   R+ +   R +   E  +IN+SLL LG  INA
Sbjct: 281 LNNDINSTEQLF--STLSIIDLAGSE---RAASTKNRGETLLEGANINKSLLALGNCINA 335

Query: 418 LVDRSG-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 470
           L   +        HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA+
Sbjct: 336 LCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYAN 395

Query: 471 KAKNIKNK 478
           +AK IK K
Sbjct: 396 RAKEIKTK 403

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           R+  DK+    ++Q  +F+    PL    + GYN TV  YG T  GKTYT++G       
Sbjct: 109 RFIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGTP----- 163

Query: 150 ELNDAAGIIPRVLLKLFDTLE-LQQSDYV-VKCSFIELYNE 188
              +  GII   L  LF+ +E L+ +  + +  S++E+YNE
Sbjct: 164 ---ENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNE 201

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  117 bits (294), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 100/179 (55%), Gaps = 9/179 (5%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           D    I + NL         E ++ + RG  +R  + T  N+ SSRSH +  I + +  +
Sbjct: 239 DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 369 DELF----RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----- 419
                     + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL      
Sbjct: 299 TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 420 DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 478
            R+ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK+IK K
Sbjct: 359 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F   A+Q  ++      L    + G+N TV  YG T  GKT+T++G       
Sbjct: 127 KFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGTP----- 181

Query: 150 ELNDAAGIIPRVLLKLFDTLE-LQQSDYV-VKCSFIELYNE 188
              +  GII   + +LF  +E L+ +  + +  S++E+YNE
Sbjct: 182 ---EQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNE 219

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 93/148 (62%), Gaps = 4/148 (2%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRS 391
           +L+R  K R  AST  N+ SSRSH+IF I L  K++    +    +NLVDLAGSE +N S
Sbjct: 540 VLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSS 599

Query: 392 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 448
             + +R +E  SIN+SL  LG VI+AL    G   HIPFR SKLT LLQ SL G++KT +
Sbjct: 600 MVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLM 659

Query: 449 IATISPAKVTSEETCSTLEYASKAKNIK 476
              ISPA +   ET ++L +ASK  N K
Sbjct: 660 FVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 58/117 (49%), Gaps = 17/117 (14%)

Query: 78  GDTGITAQMNAKR---YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTST 134
           GD G+T      +   +  DK+F    + D IF+EV G L Q  + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEV-GQLIQSSLDGYNVCIFAYGQTGS 439

Query: 135 GKTYTMTGDEKLYNGELNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 188
           GKTYTM          LN   GI+P  +  +F   D L  +   Y V C FIE+YNE
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNE 486

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 103/171 (60%), Gaps = 11/171 (6%)

Query: 315 YIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL-----YKKHQD 369
           +++ L+E  + N  E ++ + +G ++R V ST MN  SSRSH IF I++     +KK   
Sbjct: 179 FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 370 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD----RSGHI 425
            +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ L +    RS  I
Sbjct: 239 VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 426 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
           P+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS  K +K
Sbjct: 299 PYRESALTWILKENLGGNSNTCLVACVSPENYY--ESLSTLRYASLTKKVK 347

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 59/115 (51%), Gaps = 21/115 (18%)

Query: 88  AKRYTVDKVFGPGAS----QDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 143
           AK +  D  FG   S    Q +I+E +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 144 EKLYNGELNDAAGIIPRVLLKLFDTLEL-----QQSDYV----VKCSFIELYNEE 189
           +           GI+PR   +LF+   +     Q+SD +    VKCSF E+YNE+
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQ 155

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 106/181 (58%), Gaps = 13/181 (7%)

Query: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368
           D  + I + NL         + ++L+ +G  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 257 DNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNR 316

Query: 369 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 419
                   +F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 317 TVDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLND 374

Query: 420 --DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477
              RS H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 375 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 434

Query: 478 K 478
           K
Sbjct: 435 K 435

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 10/101 (9%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F  G+SQ  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 145 KFIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGTP----- 199

Query: 150 ELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 188
              +  GII   + +LF  +E      ++ +  S++E+YNE
Sbjct: 200 ---EQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNE 237

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 101/152 (66%), Gaps = 4/152 (2%)

Query: 325 TNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLA 383
           +N  E   L+QR  K R+ A T MN+ SSRSH++F + +   ++D   R    +NLVDLA
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 384 GSENINRSGALN-QRAKEAGSINQSLLTLGRVINALVDRSG--HIPFRESKLTRLLQDSL 440
           GSE +NRSG ++ +R +E   IN+SL ++G VI+AL   SG  HIPFR +KLT LL+ SL
Sbjct: 603 GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 441 GGNTKTALIATISPAKVTSEETCSTLEYASKA 472
            G++KT ++ T+SP+  +  ET ++L +A+K 
Sbjct: 663 QGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 50/101 (49%), Gaps = 14/101 (13%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  DK+F    S   +F EV   L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 408 FQFDKIFNYDESNRQVFGEVK-ELVQSALDGHNVCIFTYGQTGSGKTYTM---------- 456

Query: 151 LNDAAGIIPRVLLKLFD---TLELQQSDYVVKCSFIELYNE 188
           LN+  GIIP  L  + D   +++     Y +K  F+E+YN+
Sbjct: 457 LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYND 497

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 106/195 (54%), Gaps = 28/195 (14%)

Query: 313 GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD--- 369
            +YI+N+ E  ++N  + +  ++ G ++R   ST MN  SSRSH I +IT+ +   D   
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNT 247

Query: 370 --ELFRISKMNLVDLAGSENINRSGAL----NQRAKEAGSINQSLLTLGRVINALVDR-- 421
              +   S    VDLAGSE   RS A     N R KE  SIN+SL TL RV+ +L  R  
Sbjct: 248 NSSIISDSICRFVDLAGSE---RSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREE 304

Query: 422 ---------SGH---IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 469
                    S H   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ STL YA
Sbjct: 305 LKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESASTLRYA 362

Query: 470 SKAKNIKNKPQLGAF 484
             A+ IK    +  +
Sbjct: 363 DIAQTIKTNSIINTY 377

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 72/165 (43%), Gaps = 20/165 (12%)

Query: 39  ITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFG 98
           ++V VR   R+E         V+N   I  S      TT           K +  DK F 
Sbjct: 5   VSVYVRVAPRDESRRHRAICKVINTDSILLSSNPKRQTTFIRSSFENKEEKIFKFDKCFD 64

Query: 99  PGA----SQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154
            G     SQ   ++       +D + GYNC +L YG T +GKTYTM G+ K      ND 
Sbjct: 65  EGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------NDT 118

Query: 155 AGIIPRVLLKLFDTLE----------LQQSDYVVKCSFIELYNEE 189
            G+IPR    LF  +E           Q+S+Y V CS  E+YNE+
Sbjct: 119 RGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQ 163

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 17/189 (8%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 364
           + + D+ + I + NL   +  +  + ++L+ RG  +R  +ST+ N+ SSRSH +  I + 
Sbjct: 298 IIREDKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIM 357

Query: 365 KKH------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 418
           + +       +  F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL
Sbjct: 358 QTNTKIDLTSEHTF--ATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINAL 415

Query: 419 VDRSG---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 469
              +          HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA
Sbjct: 416 CIPTNNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYA 475

Query: 470 SKAKNIKNK 478
           ++AK IK K
Sbjct: 476 NRAKEIKTK 484

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 84  AQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 143
           A+ N  ++  DK+F   +SQD ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 144 EKLYNGELNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 188
           +        +  GII RV+ +LF+ +E    +  + +  S++E+YNE
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNE 282

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  114 bits (285), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 110/183 (60%), Gaps = 14/183 (7%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEG-LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK 365
           + D  +   + NL  +H    +E  ++L+ RG  +R  + T  N+ SSRSH +  + + +
Sbjct: 237 REDSDSTTTVANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQ 295

Query: 366 KH------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 419
                   +D+++  + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL 
Sbjct: 296 SSRTVDLKEDKMY--ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALC 353

Query: 420 --DRSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 475
              R    H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+I
Sbjct: 354 MTGRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDI 413

Query: 476 KNK 478
           K K
Sbjct: 414 KTK 416

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 10/102 (9%)

Query: 89  KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 148
           +++  DK+F   ASQ  +F+    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 126 QKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISGTP---- 181

Query: 149 GELNDAAGIIPRVLLKLFDTL-ELQQS-DYVVKCSFIELYNE 188
               D+ GII   + +LF  +  L+ +  + +  S++E+YNE
Sbjct: 182 ----DSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNE 219

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-KHQDELFRISKMNLVDLAGSENINRS 391
           +L+R  K R  AST  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE ++ S
Sbjct: 612 VLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHSS 671

Query: 392 GALNQRAKEAGSINQSLLTLGRVINALVDRSG--HIPFRESKLTRLLQDSLGGNTKTALI 449
               +R +E  +IN+SL  LG VI AL D++   HIPFR SKLT LLQ SL GN+KT + 
Sbjct: 672 QVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMF 731

Query: 450 ATISPAKVTSEETCSTLEYASKA 472
             ISP+     ET ++L +ASK 
Sbjct: 732 VNISPSSSHINETINSLRFASKV 754

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 57/101 (56%), Gaps = 14/101 (13%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  DK+F  G S D +F+EV G L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 472 FKFDKIFDTGESNDEVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 520

Query: 151 LNDAAGIIPRVLLKLFDTLE-LQQS--DYVVKCSFIELYNE 188
           L+   G+IP  +  +FD +E L++   +Y + C F+E+YNE
Sbjct: 521 LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNE 561

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 8/151 (5%)

Query: 332 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK---MNLVDLAGSENI 388
           N+L++  K R  A+T  N+ SSRSH++F I  Y K ++E+   S    +NLVDLAGSE +
Sbjct: 570 NVLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERL 627

Query: 389 NRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTK 445
           N S A+  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++K
Sbjct: 628 NSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSK 687

Query: 446 TALIATISPAKVTSEETCSTLEYASKAKNIK 476
           T +   ISP K    ET ++L +ASK  + K
Sbjct: 688 TLMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 52/101 (51%), Gaps = 14/101 (13%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           Y  D++F    S   +F+E+ G L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 430 YKFDRIFDQADSNTEVFKEI-GQLVQSSLDGHNVCIFAYGQTGSGKTYTM---------- 478

Query: 151 LNDAAGIIPRVLLKLFDTLELQQSD---YVVKCSFIELYNE 188
           LND  G+IP  +  +FD  E  +     Y + C FIE+YNE
Sbjct: 479 LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNE 519

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 93/151 (61%), Gaps = 8/151 (5%)

Query: 332 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 388
           N+L+R  K R  AST  N+ SSRSH+IF I L   +    +E + I  +NLVDLAGSE I
Sbjct: 547 NILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERI 604

Query: 389 NRSGALNQRAKEAGSINQSLLTLGRVINAL--VDRSG-HIPFRESKLTRLLQDSLGGNTK 445
           N S     R +E  +IN+SL  LG VI+AL   D+   HIPFR SKLT LLQ SL GN+K
Sbjct: 605 NSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSK 664

Query: 446 TALIATISPAKVTSEETCSTLEYASKAKNIK 476
           T +   ISP+     ET ++L +ASK  + K
Sbjct: 665 TLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 73/167 (43%), Gaps = 29/167 (17%)

Query: 35  EELNITVAVRCRGRNE-REIGMKSSVVVNVPDITGS---------KEVSINTTGDTGITA 84
           +EL   + V CR R     I  K +  + V D             K + +N    T I  
Sbjct: 343 QELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNNATQI-- 400

Query: 85  QMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 144
               +R+  DK+F    +   +F+EV G L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 401 ---PQRFKFDKIFNQTDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 145 KLYNGELNDAAGIIPRVLLKLFD---TLELQQSDYVVKCSFIELYNE 188
                 L    GIIP  +  +F+    L+ +   Y + C F+E+YNE
Sbjct: 453 ------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNE 493

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/186 (36%), Positives = 112/186 (60%), Gaps = 16/186 (8%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEG-LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363
           + + D  N   + NL  +H   +++  ++L+ +G  +R  + T  N+ SSRSH +  I +
Sbjct: 237 IIREDTDNTTTVANLS-YHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHV 295

Query: 364 YKKH------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 417
            +        +D+ +  + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INA
Sbjct: 296 VQSSRSVDLKEDKTY--ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINA 353

Query: 418 LVDRSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 472
           L   +G     H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++A
Sbjct: 354 LC-MTGRRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRA 412

Query: 473 KNIKNK 478
           K+IK K
Sbjct: 413 KDIKTK 418

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (52%), Gaps = 10/102 (9%)

Query: 89  KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 148
           +++  DK+F   A+Q  +F     PL    I G+N TV  YG T  GKT+T++G      
Sbjct: 128 QKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISGTP---- 183

Query: 149 GELNDAAGIIPRVLLKLFDTLE-LQQS-DYVVKCSFIELYNE 188
               +  GII   + +LF  +E L+ +  + +  S++E+YNE
Sbjct: 184 ----ENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNE 221

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 92/150 (61%), Gaps = 8/150 (5%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 389
           +L R  K R  ASTK N+ SSRSH+IF I L+ K+    ++ + I  +NLVDLAGSE IN
Sbjct: 555 VLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLVDLAGSERIN 612

Query: 390 RSGALNQRAKEAGSINQSLLTLGRVINAL---VDRSGHIPFRESKLTRLLQDSLGGNTKT 446
            S    +R +E   IN+SL  LG VI+AL     +  HIPFR SKLT LL+ SL GN+KT
Sbjct: 613 SSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKT 672

Query: 447 ALIATISPAKVTSEETCSTLEYASKAKNIK 476
            +   IS +     ET ++L +ASK  + K
Sbjct: 673 LMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 78/160 (48%), Gaps = 24/160 (15%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTG---ITAQMNAKRY 91
           +EL   + V CR R      +KS   +  P+ +  K  S++    T    IT   N  +Y
Sbjct: 369 QELRGNIRVYCRLR----PPLKS---IEDPNTSHIKVYSLDNDHGTQTMEITKNNNTNKY 421

Query: 92  TVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 151
             DK+F    S   IF+EV G L Q  + GYN  +  YG T +GKT+TM          L
Sbjct: 422 KFDKIFDQFESNSEIFKEV-GQLVQSALDGYNVCIFAYGQTGSGKTFTM----------L 470

Query: 152 NDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 188
           N + GIIP  +  +F   D L+ +  +Y + C F+E+YNE
Sbjct: 471 NPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNE 510

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 100/169 (59%), Gaps = 6/169 (3%)

Query: 313 GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK--HQDE 370
           G YI N+    +T+  +   +L++  K R  A+T+ N+ SSRSH++F + +  +  H  E
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGE 597

Query: 371 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDRSG--HIPF 427
             +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI AL    +G  +IPF
Sbjct: 598 TSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIPF 656

Query: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
           R SKLT LLQ SL G++KT +   I P      ET ++L +ASK  + K
Sbjct: 657 RNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 77/161 (47%), Gaps = 24/161 (14%)

Query: 35  EELNITVAVRCRGR----NEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKR 90
           +EL   + V CR R    NE +  M   ++    +  G++ ++IN   + G     N   
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINR--NEGRILSYN--- 414

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D +F P  +   IFEE+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 415 FQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 463

Query: 151 LNDAAGIIPRVLLKLFDT---LELQQSDYVVKCSFIELYNE 188
           LN   G+IP  L  +F     L+ +  +Y ++C +IE+YNE
Sbjct: 464 LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNE 504

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 102/184 (55%), Gaps = 18/184 (9%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L+E    ++ E +  ++RG  HR+ A T  N  SSRSH I  I L   
Sbjct: 272 RDDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNT 331

Query: 367 HQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 422
           +  +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L   S   
Sbjct: 332 NVIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAA 388

Query: 423 -----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 471
                      GHIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS+
Sbjct: 389 SHGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASR 448

Query: 472 AKNI 475
           AKN+
Sbjct: 449 AKNV 452

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 48/98 (48%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D V+ P  S   I+E +  P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 151 LNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188
                  +  +  K+ +   + +  + V  S++E+YNE
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNE 232

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 94/156 (60%), Gaps = 13/156 (8%)

Query: 332 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 388
           N+L+R  K R  AST  N+ SSRSH+IF I L   ++   ++ + I  +NLVDLAGSE I
Sbjct: 602 NILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERI 659

Query: 389 NRSGALNQRAKEAGSINQSLLTLGRVINALVD--------RSGHIPFRESKLTRLLQDSL 440
           N S    +R +E  +IN+SL  LG VI+AL          +  HIPFR SKLT LLQ SL
Sbjct: 660 NSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSL 719

Query: 441 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
            GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 720 IGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (53%), Gaps = 14/102 (13%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           ++  DK+F    + D +F+EV G L Q  + GYN  +  YG T +GKTYTM         
Sbjct: 452 KFKFDKIFNQNETNDDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 501

Query: 150 ELNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 188
            L+   GIIP  +  +F   + L+ +   Y ++C F+E+YNE
Sbjct: 502 -LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNE 542

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 89/150 (59%), Gaps = 8/150 (5%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 389
           L+++  K R  A+T  N+ SSRSH+IF I L   +    +  + I  +NLVDLAGSE +N
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGI--LNLVDLAGSERLN 596

Query: 390 RSGALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKT 446
            S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT
Sbjct: 597 SSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKT 656

Query: 447 ALIATISPAKVTSEETCSTLEYASKAKNIK 476
            +   ISP +   +ET ++L +ASK    K
Sbjct: 657 LMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 14/103 (13%)

Query: 89  KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 148
           +++  D++F        +F+E+ G L Q  + GYN  +  YG T +GKT+TM        
Sbjct: 395 QKFQFDRIFDQHEVNKDVFDEI-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM-------- 445

Query: 149 GELNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 188
             LN   G+IP  +  +F   D+L+ +  +Y V C F+E+YNE
Sbjct: 446 --LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNE 486

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 91/148 (61%), Gaps = 4/148 (2%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRS 391
           LL+R  K R  AST  N+ SSRSH+IF + L  ++     R    +NLVDLAGSE IN S
Sbjct: 549 LLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSHGILNLVDLAGSERINTS 608

Query: 392 GALNQRAKEAGSINQSLLTLGRVINAL--VDRSG-HIPFRESKLTRLLQDSLGGNTKTAL 448
             + +R +E  SIN+SL  LG VI+AL   D S  HIPFR SKLT LLQ SL GN+KT +
Sbjct: 609 QVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLM 668

Query: 449 IATISPAKVTSEETCSTLEYASKAKNIK 476
              IS     + ET ++L +ASK  + K
Sbjct: 669 FVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 72/155 (46%), Gaps = 20/155 (12%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSKEVSINTTGDTGITAQMNAKRYTVDKV 96
           NI V  R R    RE    + + V    D  G++ + +   G  G   Q+    +  D++
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNG-YGSGPQI----FKFDRI 408

Query: 97  FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAG 156
           F    +   +F+E+ G L Q  + GYN  +  YG T +GKTYTM          LN   G
Sbjct: 409 FNEKETNYDVFQEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPTDG 457

Query: 157 IIPRVLLKLFDT---LELQQSDYVVKCSFIELYNE 188
           IIP  +  +F+    L+ +   Y V C F+E+YNE
Sbjct: 458 IIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNE 492

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 88/149 (59%), Gaps = 6/149 (4%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YKKHQDELFRISKMNLVDLAGSENINR 390
           LL+R  K R  A+T  N+ SSRSH++F I L  Y  +  E  +   +NLVDLAGSE IN 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 391 SGALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTA 447
           S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 448 LIATISPAKVTSEETCSTLEYASKAKNIK 476
           +   ISP      ET ++L +ASK  + +
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 61/129 (47%), Gaps = 20/129 (15%)

Query: 69  SKEVSINTTGDTGITAQMNAKR------YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGY 122
           S  V IN   D   T  MN  R      +  DK+F P  S D IFEE+   L Q  + GY
Sbjct: 385 SCHVHINLFNDDEGTQSMNITRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGY 443

Query: 123 NCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLEL---QQSDYVVK 179
           N  +  YG T +GKTYTM          L+   G+IP  L  +F  + L   +  +Y + 
Sbjct: 444 NVCIFAYGQTGSGKTYTM----------LHPQNGMIPSTLDHIFQWIHLLKERGWEYEIS 493

Query: 180 CSFIELYNE 188
             FIE+YNE
Sbjct: 494 SQFIEIYNE 502

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 391
           +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 392 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 448
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 449 IATISPAKVTSEETCSTLEYASKA 472
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 76/158 (48%), Gaps = 17/158 (10%)

Query: 35  EELNITVAVRCRGRNE-REIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93
           +EL   + V CR R   + +    + ++NV +   +  V          TAQ++   +  
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVH--EFKF 438

Query: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 153
           DK+F    +   +F+EV G L Q  + GYN  +  YG T +GKT+TM          LN 
Sbjct: 439 DKIFDQQDTNVDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 154 AAGIIPRVLLKLFDT---LELQQSDYVVKCSFIELYNE 188
             GIIP  +  +F+    L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNE 525

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  106 bits (264), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 103/180 (57%), Gaps = 15/180 (8%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D + G+ +  L E    +  E LN ++ G KHR+ +ST  N  SSRSH I  I L   
Sbjct: 224 RDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISS 283

Query: 367 --HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL---VDR 421
                E+   S ++L DLAGSE   R  A ++R +E   IN+SLL LG VI+ L   V+ 
Sbjct: 284 DLSSGEVV-TSTLSLCDLAGSE---RVTAQHERRQEGSFINKSLLALGTVISKLSAEVNN 339

Query: 422 S------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 475
           S       HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL +AS+AKN+
Sbjct: 340 STESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 54/103 (52%), Gaps = 12/103 (11%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           YT D VF P AS   ++     PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 151 LNDAAGIIP----RVLLKLFDTLELQQSDYVVKCSFIELYNEE 189
           ++  AG+IP     +  K+FD+   +   Y    S++E+YNE+
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEK 198

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 96/183 (52%), Gaps = 17/183 (9%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           + D   G+ I  L E    ++ E L  ++ G K R+   T  N  SSRSH I  I L K 
Sbjct: 255 REDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKT 314

Query: 367 HQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 422
              E   +S  ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L   S   
Sbjct: 315 DLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSH 371

Query: 423 ----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 472
                     GHIP+R+SKLTR+LQ +L GN     I TI      S ET +TL +AS+A
Sbjct: 372 RNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRA 431

Query: 473 KNI 475
           KN+
Sbjct: 432 KNV 434

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 15/136 (11%)

Query: 58  SVVVNV-PDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQ 116
           SVV+ + P+  G +E+      D       +   +  D VF    +   ++ + + P+  
Sbjct: 90  SVVIRLKPN--GGRELDPWFVRDEHTMQHADYGEFKYDHVFKTACNNVEVYAQTSKPMID 147

Query: 117 DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTL--ELQQS 174
              +G N TV  YGMT +GKT+TM G E        +  G+IP  +  L+  +  E  Q 
Sbjct: 148 RVFEGLNATVFAYGMTGSGKTFTMAGTE--------ETLGLIPLSVAYLYSRVMEESLQG 199

Query: 175 D--YVVKCSFIELYNE 188
           D  + +  S++E+YNE
Sbjct: 200 DSRFEIAVSYLEIYNE 215

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 391
           +L+R  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 576 VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 392 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 448
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 636 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 449 IATISPAKVTSEETCSTLEYASKA 472
              ISP+     ET ++L +ASK 
Sbjct: 696 FVNISPSSSHINETLNSLRFASKV 719

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 76/158 (48%), Gaps = 17/158 (10%)

Query: 35  EELNITVAVRCRGRNERE-IGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93
           +EL   + V CR R   E +    + ++NV +   ++   + +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNR--GVQSMEVTKIQNTPQVHEFKF 438

Query: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 153
           DK+F    + + +F+EV G L Q  + GYN  +  YG T +GKT+TM          LN 
Sbjct: 439 DKIFDQRNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 154 AAGIIPRVLLKLFDT---LELQQSDYVVKCSFIELYNE 188
             GIIP  +  +F+    L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE 525

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 87/148 (58%), Gaps = 4/148 (2%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLY-KKHQDELFRISKMNLVDLAGSENINRS 391
           LL++  + R  AST  N+ SSRSH++F I L    H         +NLVDLAGSE IN S
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSERINSS 625

Query: 392 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 448
             L +R +E  +IN+SL  LG V++AL        HIPFR SKLT LLQ SL GN+KT +
Sbjct: 626 QVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLM 685

Query: 449 IATISPAKVTSEETCSTLEYASKAKNIK 476
              IS  +    ET ++L +ASK  + K
Sbjct: 686 FVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 75/155 (48%), Gaps = 18/155 (11%)

Query: 38  NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSKEVSINTTGDTGITAQMNAKRYTVDKV 96
           NI V  R R   + E    + + VN   D  G + + I  + +TG +   N   +  D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---FKFDRI 433

Query: 97  FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAG 156
           F    + + +FEE+ G L Q  + GYN  +  YG T +GKTYTM          LN   G
Sbjct: 434 FDQNETNENVFEEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 157 IIPRVLLKLFDTLE---LQQSDYVVKCSFIELYNE 188
           IIP  +  +F  +E    +  +Y + C FIE+YNE
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNE 517

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 6/166 (3%)

Query: 316 IQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 375
           I N+ +  +T+  +  ++L+R  + R  A T+ N+ SSRSH++F + +   H D+   +S
Sbjct: 543 ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQTGEVS 601

Query: 376 --KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRES 430
             K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI AL        HIPFR S
Sbjct: 602 HGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 431 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
           KLT LLQ SL G++KT +   I   +  + ET ++L +ASK  + K
Sbjct: 662 KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 16/102 (15%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  DK+F P  +   +F+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 417 FHFDKIFEPHNTNADVFQEIC-QLVQCSLDGYNVCIFAYGQTGSGKTYTM---------- 465

Query: 151 LNDAAGIIPRVLLKLF----DTLELQQSDYVVKCSFIELYNE 188
           LN   G+IP  L  +F    D +E     Y + C +IE+YNE
Sbjct: 466 LNPGDGMIPMTLSHIFQWTEDLME-HGWRYEMDCEYIEIYNE 506

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 391
           +L++  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 392 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 448
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 449 IATISPAKVTSEETCSTLEYASKA 472
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 78/161 (48%), Gaps = 23/161 (14%)

Query: 35  EELNITVAVRCRGRNEREI--GMKSSVV-VN-VPDITGSKEVSINTTGDTGITAQMNAKR 90
           +EL   + V CR R   E    + +S++ VN   D  G + + +     T I +      
Sbjct: 381 QELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEV-----TKIQSTTQVHE 435

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  DK+F    + + +F+EV G L Q  + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQQNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 151 LNDAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 188
           LN   GIIP  +  +F   + L+ +  DY V C FIE+YNE
Sbjct: 485 LNTGDGIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNE 525

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/314 (30%), Positives = 154/314 (49%), Gaps = 36/314 (11%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L E  +  + + +  +  G  +R+   T  N  SSRSH I  I L   
Sbjct: 266 RDDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCT 325

Query: 367 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 418
             +  L   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L       
Sbjct: 326 DLKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQN 382

Query: 419 --VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
             V    HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +AS+AKNI 
Sbjct: 383 MGVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNIS 442

Query: 477 ---NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKN 533
               + ++     KD +++N+  +L +    +   KS  G   + D   + ++     +N
Sbjct: 443 LVVKRNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSEN 502

Query: 534 EVQECKRE-IESLASKNSLLVKDK----------------LKSRETIQSQNSQMESLKAT 576
           +V + + E  E L  K+S++++D+                L+S+  IQ   SQ+   KA 
Sbjct: 503 KVLKLRLEHCEKLLDKDSMILQDQELVEIVDMLPPDVSTVLESK--IQGIESQLREHKAY 560

Query: 577 INHLKAQLDK-QHK 589
             HL+ QL   QH+
Sbjct: 561 AAHLEHQLQNLQHQ 574

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (54%), Gaps = 11/102 (10%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           ++ D VF P      ++EE A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 151 LNDAAGIIPRVLLKLFDTL---ELQQSDYVVKCSFIELYNEE 189
            ++  G+IP  +  +F  +    L    + VK S++E+YNE+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEK 240

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 391
           +L++  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 392 GALNQRAKEAGSINQSLLTLGRVINALVDRSG---HIPFRESKLTRLLQDSLGGNTKTAL 448
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 449 IATISPAKVTSEETCSTLEYASKA 472
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 74/158 (46%), Gaps = 17/158 (10%)

Query: 35  EELNITVAVRCRGRNEREIGMKS-SVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93
           +EL   + V CR R   E    S + ++NV +   +    I +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPALETLEDSDTSLINVNEFDDN--CGIQSMEVTKIHNTAQVHEFKF 438

Query: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 153
           DK+F    +   +F+EV G L Q  + GYN  +  YG T +GKT+TM          LN 
Sbjct: 439 DKIFDQKDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 154 AAGIIPRVLLKLFDT---LELQQSDYVVKCSFIELYNE 188
             GIIP  +  +F+    L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE 525

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 128/251 (50%), Gaps = 36/251 (14%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L E ++++  E +  +  G  +R+   T  N  SSRSH +  I ++  
Sbjct: 229 RDDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVF-- 286

Query: 367 HQDELFR---ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS- 422
             DE+     +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L   S 
Sbjct: 287 CTDEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESS 343

Query: 423 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
                 GHIP+R+SKLTR+LQ +L G++  A I T+     TS E+ +T+ +AS+AKNI 
Sbjct: 344 GLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNIS 403

Query: 477 ------------NKPQLGAFMMKDILVKNITME---------LAKIKSDLLSTKSKEGIY 515
                       +K QL   + K +  + IT++          + I SD    +  E + 
Sbjct: 404 LAVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLK 463

Query: 516 MSQDHYKNLNS 526
           M  +HY+ L +
Sbjct: 464 MKVEHYERLET 474

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 10/100 (10%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D VF P  + D ++E +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 151 LNDAAGIIPRVLLKLFDTLE--LQQSDYVVKCSFIELYNE 188
                GIIP  +  +FD +   L +  + V+ S++E+YNE
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNE 197

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 99/197 (50%), Gaps = 31/197 (15%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L E    ++ E +N + +G K R+ A T  N  SSRSH I  I L   
Sbjct: 274 RDDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTS 333

Query: 367 HQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 422
              +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L   S   
Sbjct: 334 DMKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKN 390

Query: 423 ------------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 458
                                   GHIP+R+SKLTRLLQ +L G++    I TI     +
Sbjct: 391 RSPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNES 450

Query: 459 SEETCSTLEYASKAKNI 475
           S ET +TL +AS+AKNI
Sbjct: 451 SAETLNTLRFASRAKNI 467

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 71/156 (45%), Gaps = 27/156 (17%)

Query: 39  ITVAVRCRG-RNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVF 97
           ITVA+R +   N  ++   S +V      T  K ++ +  G+           +  D VF
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLV------TDEKTIAHDDVGE-----------FKFDHVF 143

Query: 98  GPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGI 157
               S   I++ +  P+     +G+N T+  YGMT +GKTYTM G       E     G+
Sbjct: 144 NSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----EREQKDGL 198

Query: 158 IPRVLLKLFDTLELQQSD----YVVKCSFIELYNEE 189
           IP  +  LF  +  +  D    + +  S++E+YNE+
Sbjct: 199 IPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEK 234

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 103/181 (56%), Gaps = 8/181 (4%)

Query: 302 RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTI 361
           R  +  +D S    ++NL+   +T+      +L+  +K R  AST  N+ SSRSH+IF I
Sbjct: 492 RHKIHHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFII 551

Query: 362 TLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 418
            ++  ++   +E  R   +NL+DLAGSE ++ S   ++R KE   IN+SL  LG V+N+L
Sbjct: 552 KIHGINEGLGEE--RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSL 609

Query: 419 VDRSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 475
                   HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A K  + 
Sbjct: 610 GSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNST 669

Query: 476 K 476
           K
Sbjct: 670 K 670

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 14/103 (13%)

Query: 90  RYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 149
           +Y+ DKVF    +   IF+EV+  L Q  + G+N  +  YG T +GKT+TM         
Sbjct: 382 KYSFDKVFSQTDTNQEIFKEVS-ELIQSSLDGFNVCIFAYGQTGSGKTFTM--------- 431

Query: 150 ELNDAAGIIPRVLLKLFDTLELQQSD---YVVKCSFIELYNEE 189
            LN   GIIP     +FD ++    +   Y V C F+E+YN+E
Sbjct: 432 -LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDE 473

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 111/229 (48%), Gaps = 36/229 (15%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ I  L E     + E +  ++ G  +R+ + T+ N  SSRSH +  + L   
Sbjct: 260 RDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTH 319

Query: 367 HQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 422
           +  D     S + L DLAGSE   R+    +R KE   IN+SLL LG VI+ L   S   
Sbjct: 320 NVIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSN 376

Query: 423 ---------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 461
                                 HIP+R+SKLTRLLQ +L GN+    I TI P   T  E
Sbjct: 377 SKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAE 436

Query: 462 TCSTLEYASKAKNI-------KNKPQLG-AFMMKDILVKNITMELAKIK 502
           T +TL +AS+AKN+       KN   +  + + KD ++K +T  L K K
Sbjct: 437 TINTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 56/109 (51%), Gaps = 9/109 (8%)

Query: 83  TAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 142
           T   N   Y  D VF P      I++  A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 143 DEKLYNGELNDAAGIIPRVLLKLFDTLELQQSD--YVVKCSFIELYNEE 189
           D +       +  GI+P  +  LF+ +   ++D  Y V  S++E+YNE+
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEK 226

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 91/151 (60%), Gaps = 12/151 (7%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ------DELFRISKMNLVDLAGSE 386
           +L+   K + +A+T  N+ SSRSH++FTI ++  +       D +     +NLVDLAGSE
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASDGV-----LNLVDLAGSE 595

Query: 387 NINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS-GHIPFRESKLTRLLQDSLGGNTK 445
            I+ S     R +E  +IN+SL  LG VI AL  +   HIPFR SKLT LLQ SL G++K
Sbjct: 596 RIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSK 655

Query: 446 TALIATISPAKVTSEETCSTLEYASKAKNIK 476
           T +   +SP+    +ET ++L +ASK  + K
Sbjct: 656 TLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 74/156 (47%), Gaps = 23/156 (14%)

Query: 38  NITVAVRCRGRNEREIGMKSSV-VVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKV 96
           NI V  R R   E E+   S + V N  +  GS+ + I+              R+  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDRNS--------RFLFDKV 409

Query: 97  FGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAG 156
           F   AS   +FEEV G L Q  + GYN  +  YG T +GKTYTM          +ND  G
Sbjct: 410 FSSNASNRDVFEEV-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDG 458

Query: 157 IIPRVLLKLFDTLEL---QQSDYVVKCSFIELYNEE 189
           +IP  L  +FD   L   +  DY  +  FIE+YNE+
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQ 494

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 176/361 (48%), Gaps = 50/361 (13%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ I  L E    ++ E    +Q G K+R+ + T  N  SSRSH I  + L   
Sbjct: 244 RDDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNT 303

Query: 367 HQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 418
                  +S  ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI+ L       
Sbjct: 304 DLRSGETVSSTLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSK 360

Query: 419 -----------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 467
                       + + HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ 
Sbjct: 361 NGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIR 420

Query: 468 YASKAKN----IKNKPQL--GAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQ--- 518
           +AS+AKN    +  +P +  G++  KD  ++N+T +L K    ++  K +  +  S    
Sbjct: 421 FASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHND 480

Query: 519 DHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATIN 578
           D   + NS L   +N V +CK     L++   LL KD      TI+ ++S+M    A I+
Sbjct: 481 DSTVDPNSTLLKAENRVLKCK-----LSNCEKLLDKD------TIELEDSEM---VAIID 526

Query: 579 HLKAQLDKQHKAELEISGFNNKLQKMTEV---MQVALQDYKKRELDLNKKFETHISKEIK 635
            L   +D     E +  G  ++L++  E    ++  L ++ +RE    + F  H++  I+
Sbjct: 527 MLP--IDVGSVLETKFQGLESQLRQYKEYTKQLEFKLMNFDRRENVSAEPFTAHVNSVIQ 584

Query: 636 S 636
           S
Sbjct: 585 S 585

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 14/107 (13%)

Query: 88  AKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 147
           A  +T D+VF    +   I+E  + P+    ++G+N TV  YGMT +GKT+TMTG E   
Sbjct: 109 AGEFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE--- 165

Query: 148 NGELNDAAGIIPRVLLKLFDTLELQQ-----SDYVVKCSFIELYNEE 189
                D AG+IP  +  LF  + L+      S Y V  S++E+YNE+
Sbjct: 166 -----DEAGLIPLSVTYLFSKI-LEHSMRGTSKYEVVVSYLEIYNEK 206

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 97/167 (58%), Gaps = 14/167 (8%)

Query: 323 HITN-------ALEGLN-LLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YKKHQDELF 372
           HITN       + E +N +L+R LK R  A+T  N  SSRSH++F I L  Y     E  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 373 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--VDRSG-HIPFRE 429
               +NLVDLAGSE I+      +R +E  +IN+SL  LG VI+AL   D S  HIPFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 430 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476
           SKLT LLQ SL G++KT +   +SP   +  ET ++L +A+K  + K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 76/159 (47%), Gaps = 23/159 (14%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAK--RYT 92
           +EL   + V CR R   E    SS  + +   +       + TG   IT + ++K  ++T
Sbjct: 358 QELRGNIRVFCRLRPALENENYSSSSIEIEKFS-------DETGMQSITIKRDSKQHKFT 410

Query: 93  VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN 152
            D+ F    +   +F E+ G L Q  + GYN  +  YG T +GKT+TM          LN
Sbjct: 411 FDRCFSAQETNGDVFSEI-GQLIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 153 DAAGIIPRVLLKLFDTLE-LQQSDYV--VKCSFIELYNE 188
              GIIP  L  +F  +E L++  +V  +   F+E+YNE
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNE 498

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 104/363 (28%), Positives = 183/363 (50%), Gaps = 44/363 (12%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D  +G+ +  L E  + ++ + L  +  G  +R+   T  N  SSRSH I T+ L   
Sbjct: 271 RDDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACT 330

Query: 367 HQDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 422
              +L       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L   S
Sbjct: 331 ---DLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASS 384

Query: 423 ---------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 473
                     HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +AS+AK
Sbjct: 385 MHTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAK 444

Query: 474 NI-----KNKPQLGAFMMKDILVKNITMELAKIKSDLLSTK-SKEGIYMSQDHYKNLNSD 527
           N+     +N+ +L     KD L+ N+  +L + +  +   K ++E    + D Y  L  +
Sbjct: 445 NVSMTVKRNEAELA--HEKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-LRKE 501

Query: 528 LESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMES-LKATINHLKAQL-- 584
            ++ K ++Q C+R    L  K+   V+D  +  E ++     + + L++ I  L++QL  
Sbjct: 502 SDALKRKLQLCER----LLDKDEAAVQDD-QLVEIVEMLPPAVGALLESKIQGLQSQLRS 556

Query: 585 --DKQHKAELEISGFNNKLQKMT-----EVMQVALQDYKKRELDLNKKFETHISKEIKSL 637
             D   + E ++S  +++L         + +Q+ LQ+ ++   +L+K   T  +K + +L
Sbjct: 557 HRDYSSQLERQLSDLDSRLSSHQSTASDQSLQILLQEQQEELAELHKSL-TRKNKMLDAL 615

Query: 638 KTA 640
           ++A
Sbjct: 616 QSA 618

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 11/114 (9%)

Query: 79  DTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 138
           D    A  +   +  D VF P ++   +++++  P+     +GYN  +  YGMT +GKT+
Sbjct: 127 DEQTIAHNDVGEFKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTF 186

Query: 139 TMTGDEKLYNGELNDAAGIIPRVLLKLFDTL---ELQQSDYVVKCSFIELYNEE 189
           TM+G          + AG+I   +  +F  +    L    + V  S++E+YNE+
Sbjct: 187 TMSGTP--------EEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEK 232

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 100/189 (52%), Gaps = 23/189 (12%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   GI +  L E   ++  + +  ++ G K+++++ T+ N  SSRSH+I  + L   
Sbjct: 242 RDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIAT 301

Query: 367 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 422
             +  +   S ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI  L   S   
Sbjct: 302 DLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQH 358

Query: 423 ----------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 466
                            HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL
Sbjct: 359 RNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTL 418

Query: 467 EYASKAKNI 475
            +AS+AKN+
Sbjct: 419 RFASRAKNV 427

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 12/110 (10%)

Query: 84  AQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 143
           A  +   + +D++F    S   I+ E+  PL      GYN T+  YGMT +GKT+TM+G 
Sbjct: 102 AHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGT 161

Query: 144 EKLYNGELNDAAGIIPRVLLKLFDTLE----LQQSDYVVKCSFIELYNEE 189
           +        +  G+IP  +  LF+T+     L +  Y +  S++E+YNE+
Sbjct: 162 Q--------EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEK 203

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 101/195 (51%), Gaps = 29/195 (14%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L +     + E L+ + +G K+R+ + T+ N  SSRSH I  I L  K
Sbjct: 262 RDDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISK 321

Query: 367 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV------ 419
             +     I  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+ L       
Sbjct: 322 DIRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGS 378

Query: 420 ------------------DRSG-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSE 460
                               SG HIP+R+SKLTRLLQ +L G++    + TI  A  +S 
Sbjct: 379 HHTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSS 438

Query: 461 ETCSTLEYASKAKNI 475
           ET +TL +AS++KN+
Sbjct: 439 ETLNTLRFASRSKNV 453

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 66/130 (50%), Gaps = 27/130 (20%)

Query: 66  ITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCT 125
           I G K +S N  GD           +T D VF  G S   I+ +   PL    I+GYN T
Sbjct: 119 IHGDKVISHNDIGD-----------FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNAT 167

Query: 126 VLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTL------ELQQSDYVVK 179
           +  YGMT +GKT+TM+G E        +  G+IP  +  LF +L      E ++S+  V 
Sbjct: 168 IFAYGMTGSGKTFTMSGTE--------EEKGLIPLSVSYLFSSLLEKTNTENEKSE--VW 217

Query: 180 CSFIELYNEE 189
            S++E+YNE+
Sbjct: 218 VSYLEIYNEK 227

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 112/212 (52%), Gaps = 27/212 (12%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK- 365
           ++D   G+ + +L E  +++  + +  +  G ++R+   T  N  SSRSH I  + L + 
Sbjct: 268 RDDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRY 327

Query: 366 --KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINALV-- 419
             K   E    S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L   
Sbjct: 328 DLKTGSEA--TSTLSLCDLAGSER-----AVTQIVRRKEGAFINKSLLALGTVIAKLSML 380

Query: 420 ----------DRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 469
                       +GHIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +A
Sbjct: 381 GSQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFA 440

Query: 470 SKAKNIK---NKPQLGAFMMKDILVKNITMEL 498
           S+AKNI     K ++ +   KD +++N+  +L
Sbjct: 441 SRAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%), Gaps = 12/103 (11%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D VF  G     +++ +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 151 LNDAAGIIPRVLLKLFDTLELQQSD----YVVKCSFIELYNEE 189
                G+IP+ +  +FD +  +       Y VK S++E+YNE+
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEK 240

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 99/189 (52%), Gaps = 26/189 (13%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D  +G+ +  L E  + ++ + L  ++ G  +R+   T  N  SSRSH I TI   K 
Sbjct: 268 RDDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTI---KV 324

Query: 367 HQDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS 422
              EL       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L   S
Sbjct: 325 TCTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVS 381

Query: 423 G----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 466
           G                H+P+R+SKLTR+LQ +L G++    I TI        ET +T+
Sbjct: 382 GASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTI 441

Query: 467 EYASKAKNI 475
            +AS+AKN+
Sbjct: 442 RFASRAKNV 450

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (54%), Gaps = 11/102 (10%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  DKVF P  +   ++EE+  P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSG-------- 191

Query: 151 LNDAAGIIPRVLLKLFDTL---ELQQSDYVVKCSFIELYNEE 189
             D AG+I   + ++F  +    +    Y V+ S++E+YNE+
Sbjct: 192 TRDEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEK 233

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 110/216 (50%), Gaps = 31/216 (14%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK- 365
           ++D   G+ + +L E  + +  E +  +  G K+R+   T  N  SSRSH I  + L + 
Sbjct: 269 RDDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRC 328

Query: 366 --KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINALVDR 421
             K   E+   S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L   
Sbjct: 329 ELKTGTEV--TSTLSLCDLAGSER-----AVTQLVRRKEGAFINKSLLALGTVIAKLSAN 381

Query: 422 ----------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 465
                            GHIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T
Sbjct: 382 SAGSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNT 441

Query: 466 LEYASKAKNIK---NKPQLGAFMMKDILVKNITMEL 498
           + +AS+AKNI     K ++     KD +++N+  +L
Sbjct: 442 VRFASRAKNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 54/104 (51%), Gaps = 13/104 (12%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D VF    +   ++  +  P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 151 LNDAAGIIPRVLLKLFD-----TLELQQSDYVVKCSFIELYNEE 189
                G+IP  +  +FD     T +  +  Y VK S++E+YNE+
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEK 240

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 97/201 (48%), Gaps = 35/201 (17%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 367 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 418
           + ++   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L       
Sbjct: 356 NVKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNS 412

Query: 419 ------------------------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 454
                                      S HIP+R+SKLTRLLQ +L G++    I T+  
Sbjct: 413 VGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 455 AKVTSEETCSTLEYASKAKNI 475
               + ET +TL +AS+AKN+
Sbjct: 473 RNDAAAETMNTLRFASRAKNV 493

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 14/103 (13%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D VF    +   ++E  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 151 LNDAAGIIPRVLLKLFDTLELQQS-----DYVVKCSFIELYNE 188
           L    G+IP  +  LF  + ++QS      + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFTNI-MEQSMNGDKKFDVIISYLEIYNE 256

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 106/199 (53%), Gaps = 28/199 (14%)

Query: 314 IYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DELF 372
           I I+NL+  ++T+ LE L+  ++G   R +AS       SRS  I  IT+ ++    E+F
Sbjct: 189 ISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVKEVF 238

Query: 373 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD----------RS 422
           +     LVDL  S+ I++   L    +    INQS++TL  V  +L            RS
Sbjct: 239 KTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRPRS 298

Query: 423 G--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK---- 476
           G  +IP++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K +K    
Sbjct: 299 GNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNLFQ 358

Query: 477 -NKPQLGAFMMKDILVKNI 494
            NK    +  M D+L+K+ 
Sbjct: 359 QNKAGTNSKAMLDLLMKDF 377

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 47/105 (44%), Gaps = 11/105 (10%)

Query: 84  AQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 143
           A  N K + VD++F PGA        + G        GYN  ++ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFG- 122

Query: 144 EKLYNGELNDAAGIIPRVLLKLFDTLELQQS---DYVVKCSFIEL 185
                   N   G+I  V  ++F T+E       DY +  S IE+
Sbjct: 123 -------YNKGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEV 160

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 96/201 (47%), Gaps = 35/201 (17%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L E    +  E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTST 355

Query: 367 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 418
              +   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L       
Sbjct: 356 DVNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTS 412

Query: 419 VDR------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISP 454
           VD                         S HIP+R+SKLTRLLQ +L G++    I T+  
Sbjct: 413 VDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 455 AKVTSEETCSTLEYASKAKNI 475
               + ET +TL +AS+AKN+
Sbjct: 473 RNDAAAETMNTLRFASRAKNV 493

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D VF    +   ++E    P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 151 LNDAAGIIPRVLLKLFDTLELQQSD----YVVKCSFIELYNE 188
           L    G+IP  +  LF  +  Q  D    + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNE 256

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 98/207 (47%), Gaps = 41/207 (19%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L E    ++ + L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 367 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDR--- 421
             +D   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  D+   
Sbjct: 356 DVRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNS 412

Query: 422 ---------------------------------SGHIPFRESKLTRLLQDSLGGNTKTAL 448
                                            S HIP+R+SKLTRLLQ +L G++    
Sbjct: 413 VGSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTT 472

Query: 449 IATISPAKVTSEETCSTLEYASKAKNI 475
           I T+      + ET +TL +AS+AKN+
Sbjct: 473 ICTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 14/103 (13%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D VF    +   ++E+ + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 151 LNDAAGIIPRVLLKLFDTLELQQS-----DYVVKCSFIELYNE 188
           L    G+IP  +  LF  + ++QS      + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFTNI-MEQSMNGDKKFDVVISYLEIYNE 256

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 14/151 (9%)

Query: 331 LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENIN 389
           L L+ +G ++R+V ST+ N  SSRSH +  + +     D +   ++ + L DLAGSE   
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI----TDSMGSKARVLTLCDLAGSER-- 294

Query: 390 RSGALNQRA--KEAGSINQSLLTLG---RVINALVDRSGHIPFRESKLTRLLQDSLGGNT 444
              +++ R    E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN 
Sbjct: 295 --ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNG 352

Query: 445 KTALIATISPAKVTSEETCSTLEYASKAKNI 475
              ++ T+S +    E++  TL +A +A  +
Sbjct: 353 LVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 38.9 bits (89), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 40/87 (45%), Gaps = 18/87 (20%)

Query: 106 IFEEVAGPLFQ----DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRV 161
           IF     PL      D I G   T++ YG T +GKTYTM G +         A G I  V
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTK---------AEGGI--V 167

Query: 162 LLKLFDTLELQQSDYVVKCSFIELYNE 188
            L + D L     +  +  S++E+YNE
Sbjct: 168 QLSIRDLLTQLSKNCQITISYLEIYNE 194

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 83/144 (57%), Gaps = 5/144 (3%)

Query: 333 LLQRGLKHRQVASTKMNDFSSRSHTIFT--ITLYKKHQDELFRISKMNLVDLAGSENINR 390
           L++ G   R   ST MN+ SSRSH++F   IT + +   E     ++NLVDLAGSE + +
Sbjct: 527 LIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQE-HSTGRLNLVDLAGSERLQQ 585

Query: 391 SGALNQRA--KEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTAL 448
              +  +   KE  SIN+SL  L  VI+++  R  +IPFR SKLT LL++SL   +KT +
Sbjct: 586 QEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLM 645

Query: 449 IATISPAKVTSEETCSTLEYASKA 472
              ISP   +  ET ++L  A K 
Sbjct: 646 YVNISPNINSIRETINSLRLARKV 669

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 14/101 (13%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +T DK+FG       +F+++   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 151 LNDAAGIIPRV---LLKLFDTLELQQSDYVVKCSFIELYNE 188
           LN+  GII +    ++     L     +Y ++  FIE+YNE
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNE 473

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 92/185 (49%), Gaps = 19/185 (10%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  + E     A E +  +  G   R+   T  N  SSRSH I  + L   
Sbjct: 236 RDDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITT 295

Query: 367 HQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--- 422
           +  +     + ++L DLAGSE   ++    +R KE   IN+SLL LG VI+ L   S   
Sbjct: 296 NLLNGTTHFNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLSAESNAH 352

Query: 423 ------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 470
                        HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +AS
Sbjct: 353 DSSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFAS 412

Query: 471 KAKNI 475
           +AKN+
Sbjct: 413 RAKNV 417

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 84  AQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 143
           A  +   +  D VFGP A+ + +F E+ G L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 144 EKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEE 189
              +N  +    G    V  ++ +  + +Q    V  S++E+YNE+
Sbjct: 179 ---HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEK 219

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/207 (31%), Positives = 104/207 (50%), Gaps = 17/207 (8%)

Query: 312 NGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DE 370
           NG  ++NL+   +   LE L +L       Q    + N+   RSHTI  +++ K+++ DE
Sbjct: 191 NGFQVENLRTTQVL-TLEELKILINICLLNQ--KERHNNLIQRSHTIMEVSIEKRNKLDE 247

Query: 371 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DRSGHI--- 425
              +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN LV  +R G I   
Sbjct: 248 SITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTD 307

Query: 426 --------PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477
                   P++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+   
Sbjct: 308 ISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANT 367

Query: 478 KPQLGAFMMKDILVKNITMELAKIKSD 504
            P++  F +      +I +   K+K D
Sbjct: 368 NPRINRFGLNSKATMDIFLTDMKLKED 394

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 68/129 (52%), Gaps = 25/129 (19%)

Query: 73  SINTTGDTGITA----QMNAKRYTVDKVFGPGASQDLIFE--EVAGPLFQDFIKGYNCTV 126
           SIN T DT +T     Q+   +Y  DKVF   AS D   E  E      +  ++GYN ++
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVF---ASNDTGVEHQEFIESNLESLLQGYNTSI 107

Query: 127 LVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSD------YVVKC 180
           + YG + TGK++ + G+++          G+I ++L KLF+ ++ +  +      Y VK 
Sbjct: 108 VTYGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKF 158

Query: 181 SFIELYNEE 189
           SF+E+Y E+
Sbjct: 159 SFLEVYQEK 167

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 96/201 (47%), Gaps = 35/201 (17%)

Query: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366
           ++D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 367 H-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL----VDR 421
             +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L    ++ 
Sbjct: 356 DLESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINP 412

Query: 422 SGH----IP-----------------------FRESKLTRLLQDSLGGNTKTALIATISP 454
           +G      P                       +R+SKLTRLLQ +L G++    I T+  
Sbjct: 413 TGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 455 AKVTSEETCSTLEYASKAKNI 475
               + ET +TL +AS+AKN+
Sbjct: 473 RNDAAAETINTLRFASRAKNV 493

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (55%), Gaps = 12/102 (11%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  D VF    +   ++E  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 151 LNDAAGIIPRVLLKLF-DTLELQQSD---YVVKCSFIELYNE 188
           L    G+IP  +  LF + +EL  +    + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNE 256

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 73/159 (45%), Gaps = 23/159 (14%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAK--RYT 92
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 93  VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN 152
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM          LN
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 153 DAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 188
              GIIP  L  +F   + L+     Y +   FIE+YNE
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNE 497

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 311 SNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363
           S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 73/159 (45%), Gaps = 23/159 (14%)

Query: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAK--RYT 92
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 93  VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELN 152
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM          LN
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 153 DAAGIIPRVLLKLF---DTLELQQSDYVVKCSFIELYNE 188
              GIIP  L  +F   + L+     Y +   FIE+YNE
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNE 497

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%)

Query: 305 MTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363
           +  +  S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 521 IRHDSDSQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 106/215 (49%), Gaps = 16/215 (7%)

Query: 313 GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DEL 371
           G+ + NL++ H+ +  E L    + +    V ++K ++   R++TIF I + K  + DE 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 372 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRS--------- 422
              S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I +L   S         
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 423 ---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 479
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 480 QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGI 514
           Q+  F + +    +I +E  K+K +    +  E +
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESV 419

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 12/97 (12%)

Query: 96  VFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAA 155
           +F   ++ DLI   +   +  + ++GYN  ++ YG   +GKTY+      LY  +++D+ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 156 GIIPRVLLKLFDTLELQQSD------YVVKCSFIELY 186
           G+   +   LF  +    +D      ++VK SF+E++
Sbjct: 143 GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVW 179

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 61/119 (51%), Gaps = 19/119 (15%)

Query: 75  NTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTST 134
           NTTGDT  T Q        DKVF   A+Q  + + +  P   D + GYN T+L YG + +
Sbjct: 67  NTTGDTHSTFQF-------DKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 135 GKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQ----SDYVVKCSFIELYNEE 189
           GK+Y++ G +        D  GI+P +   LF TLE ++    +++ V     E+Y E+
Sbjct: 120 GKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEK 170

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 75/139 (53%), Gaps = 17/139 (12%)

Query: 353 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 409
           SRSH +F + + ++++  ++ + S + L+DL G+E  ++     L+Q + +   +NQS+ 
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKK--LNQSIE 291

Query: 410 TLGRVINAL----------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 459
            L   + +L             S    +RES+LT +L+DSLGGN KT +I T   + V +
Sbjct: 292 ALKNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 351

Query: 460 EETCSTLEYASKAKNIKNK 478
             T STL++    + I N+
Sbjct: 352 --TLSTLKFGDSIRQINNR 368

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 75/139 (53%), Gaps = 17/139 (12%)

Query: 353 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 409
           SRSH +F + + ++++ D++ + S + LVDL G+E  ++     L+Q A     +NQS+ 
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDA--LKKLNQSIE 290

Query: 410 TLGRVINAL----------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 459
            L   + +L             S    +RES+LT +L+DSLGGN KT +I T   + V +
Sbjct: 291 ALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 350

Query: 460 EETCSTLEYASKAKNIKNK 478
             T STLE+    + I NK
Sbjct: 351 --TLSTLEFGDSIRQINNK 367

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%), Gaps = 8/80 (10%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  DKVF   A+Q+ + + +  P+  D + GYN TV+ YG + +GK+Y++ G +      
Sbjct: 75  FQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK------ 128

Query: 151 LNDAAGIIPRVLLKLFDTLE 170
             ++ GI+P +   LFDTLE
Sbjct: 129 --ESEGILPNICKTLFDTLE 146

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 124/250 (49%), Gaps = 31/250 (12%)

Query: 312 NGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 371
           +G +I++L + H+T+ +E  + L+ G K+     + ++   S+    F +    + +D++
Sbjct: 195 HGDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCIDR-KDDV 249

Query: 372 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDR----SGHIPF 427
            R S +  +DL GS+ + +  A    + +    NQ +  L  +I  L +     S H  F
Sbjct: 250 TRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--F 307

Query: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ-----LG 482
           ++S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P      L 
Sbjct: 308 KDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLN 364

Query: 483 AFMMKDILVKNITME----LAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE- 537
           A    D+LV+++ ++    LAKI  +LL T+ K    +  ++    NS   S +N +QE 
Sbjct: 365 AKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKT---LKTENDSTTNSTSNSLENALQEN 419

Query: 538 --CKREIESL 545
              K ++ESL
Sbjct: 420 SKLKLQLESL 429

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN-G 149
           Y  D +F   + +   ++ +   L  D  KGYN T++ YG TS+GK++ + GD    N G
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 150 ELNDAA 155
            +N  A
Sbjct: 146 LINHIA 151

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 74/137 (54%), Gaps = 13/137 (9%)

Query: 353 SRSHTIFTITLYKKHQD-ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 411
           S+SH +F + + +++++ ++ R S + L+DL G+E  ++   +         +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 412 GRVINAL----------VDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 461
             ++  L          V  S    +RES+LT +L+DSLGGN KT +I T   + V++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 462 TCSTLEYASKAKNIKNK 478
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 15/102 (14%)

Query: 69  SKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLV 128
           + E S  TTGDT  T       +  DKVF   A+Q+ + + +  P   D + GYN T++ 
Sbjct: 60  TSEPSHETTGDTYST-------FKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIIT 112

Query: 129 YGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLE 170
           YG + +GK+Y++ G +        +  GI+P +   LF+TLE
Sbjct: 113 YGPSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLE 146

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 19/118 (16%)

Query: 75  NTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTST 134
           N TG    T Q        DKVF   A+Q  + + +  P  +D + GYN T+L YG + +
Sbjct: 66  NATGSPHSTFQF-------DKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFS 118

Query: 135 GKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTL----ELQQSDYVVKCSFIELYNE 188
           GK+Y++ G +  YN       G++P +   LF+TL    E + +++ V     E+Y E
Sbjct: 119 GKSYSLLGSQ--YN------EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYME 168

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 76/139 (54%), Gaps = 17/139 (12%)

Query: 353 SRSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 409
           S+SH +F + + ++++ E + + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKK--LNQSIE 290

Query: 410 TLGRVI---------NALVDRSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTS 459
            L  ++         +A   ++ H   +RES+LT +L+DSLGGN K  +I T   + V +
Sbjct: 291 ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT 350

Query: 460 EETCSTLEYASKAKNIKNK 478
             T STLE+    + I NK
Sbjct: 351 --TISTLEFGDNIRQIINK 367

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 82/163 (50%), Gaps = 18/163 (11%)

Query: 316 IQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRI 374
           I+NL++ ++ +  E  + L  G  +R      M   +SRS+ +  I L +   +D+L + 
Sbjct: 239 IENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQLMKC 293

Query: 375 SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRE----- 429
           S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN L + +G  P+ +     
Sbjct: 294 SSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE-TGTSPYDQQINGK 352

Query: 430 ------SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 466
                 S L  ++   +GGN KT  I+TISP      ET  TL
Sbjct: 353 KSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 76  TTGDTGITAQMNAKRYTVDKVFGPGASQ-DLIFEEVAGPLFQDFIKGYNCTVLVYGMTST 134
           TTG+T          + VDKVF     Q DL+  ++      +   G+N +++ +G + T
Sbjct: 45  TTGNT---------EFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGT 95

Query: 135 GKTYTMTGDEKL 146
           GK++TM G+  L
Sbjct: 96  GKSFTMFGNNSL 107

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 110/233 (47%), Gaps = 27/233 (11%)

Query: 353 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 411
           SRS     IT+ ++++ +E  + S + L+DLA S+ ++++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 412 GRVINALVD--------RSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 463
            +V+  L +         S     R S+L + LQ ++GG++KT  +   S  K   E T 
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTV 343

Query: 464 STLEYASKAKNIKNKP-----QLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQ 518
            TL   S+ ++I N P      L +  + D+ +KN++      + D   T+ K   Y+ +
Sbjct: 344 ITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS-----TREDSYLTRIK---YL-E 394

Query: 519 DHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQME 571
           D    L   ++ +KN+V   K    SL  KN  L+      R++ Q+Q S  E
Sbjct: 395 DEVSKLGGTIQQNKNQVSTNK----SLTEKNMKLMDQLELYRKSQQTQKSGSE 443

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 21/141 (14%)

Query: 52  EIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVA 111
           E G  S  + + P + G K    +   DT         ++  +KV+  G  Q  + E++ 
Sbjct: 38  EDGAGSLSLQDFPQVAG-KATFFSDANDTN--------KFRFNKVYDVGVRQQEVCEDII 88

Query: 112 GPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLEL 171
           G    + + G+N +++ +G   +GKTYTM G++           GI+ R+   +FD L+ 
Sbjct: 89  GDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH--------EEGIVQRMCQSIFDQLDK 140

Query: 172 QQSD----YVVKCSFIELYNE 188
              D      +  +F EL+ E
Sbjct: 141 LHEDSGNESTISINFFELFAE 161

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 91/190 (47%), Gaps = 23/190 (12%)

Query: 312 NGI----YIQNLQEFHITNALEGLNLLQRGLK-HRQVASTKMNDFSSRSHTIFTITLYKK 366
           NGI    +++NL    I      L+ LQ+  K   Q +S  +N  +++     +I + K 
Sbjct: 198 NGIKGDKHVKNLSHIQIA----SLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKI 253

Query: 367 H------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 420
           H      +D+L+++S ++ +DL G +   +   +     E   +N  + +   +I  L D
Sbjct: 254 HLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSD 312

Query: 421 RSGHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETCSTLEYASKAKN 474
               +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+
Sbjct: 313 PKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKS 371

Query: 475 IKNKPQLGAF 484
           IKN   +  F
Sbjct: 372 IKNPLIMNVF 381

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/108 (20%), Positives = 52/108 (48%), Gaps = 13/108 (12%)

Query: 59  VVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDF 118
           VV+N+  +  +++ +     +   T +++++ +  D +F   + Q+   E +     +D 
Sbjct: 37  VVLNLSSLKANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDL 93

Query: 119 IKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLF 166
             GYN + + YG +++GK+ T+           N+  G+I  +  +LF
Sbjct: 94  FDGYNQSFITYGKSNSGKSDTL----------FNEKDGLIRLLFEQLF 131

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 72  VSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGM 131
           +++N++ + G     N  R+  DK+F P    D I   ++     D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQYRF--DKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 132 TSTGKTYTMTG 142
           T TGKTYT+ G
Sbjct: 99  TGTGKTYTLYG 109

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 69/134 (51%), Gaps = 13/134 (9%)

Query: 354 RSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSE--------NINRSGALNQRAKEAGSI 404
           RS TI  I L +  +DE L   S +  VDLAGS+         I R  A ++  +   S+
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAA-SKYNRVMDSL 323

Query: 405 NQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCS 464
           N  + TL    +  +++S    +R S LTR+L D L GN KT LI + S  K    ET S
Sbjct: 324 NSMVYTLANSESISINKS---IYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFS 380

Query: 465 TLEYASKAKNIKNK 478
           TL ++S A ++ N+
Sbjct: 381 TLGFSSYASSMSNQ 394

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 8/102 (7%)

Query: 89  KRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 148
           + +++DKVF P ASQ  +   + GP+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 149 GELNDAAGIIPRVLLKLFDTLELQQSDYV-VKCSFIELYNEE 189
                + G++ R+L K+F  +   +   V    S +EL N++
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDK 136

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 92/204 (45%), Gaps = 33/204 (16%)

Query: 302 RSPMTQNDQSN--GIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 359
           R P+  + ++   G+Y Q     +I +  E   +++    +++ +  KM+   S SH + 
Sbjct: 192 RKPLKSHHETKKFGLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVI 251

Query: 360 TITLYKKHQDELFRI------SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGR 413
             ++     ++L R+      S +   DL GS    +        +    +N S+  L  
Sbjct: 252 RCSV-----EQLDRVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLES 306

Query: 414 VINALVD--RSGH------------------IPFRESKLTRLLQDSLGGNTKTALIATIS 453
           V+N+++   +  H                  +P+++S+LT L+Q++LGGN++T ++    
Sbjct: 307 VVNSVLQNQQKNHLYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCF 366

Query: 454 PAKVTSEETCSTLEYASKAKNIKN 477
             K   EET +TL +  + +NI N
Sbjct: 367 DDKSHHEETIATLRFGVQLQNILN 390

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 91  YTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 150
           +  +KV+  G     I + ++  + +D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 151 LNDAAGII 158
             D+ GII
Sbjct: 141 --DSDGII 146

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 105/234 (44%), Gaps = 31/234 (13%)

Query: 302 RSPMT---QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDF--SSRSH 356
           R P+    +  Q +  Y ++L    +T+  E +N +     +R   S    ++   S+SH
Sbjct: 163 RRPLKLHHETKQDDEYYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSH 222

Query: 357 TIFTITLYKKHQDE-LFRISKMNLVDLAGSENINRSG--ALNQRAKEAGSINQSLLTLGR 413
            I  I + +++ +E + +   ++  DLA  + I++    +L   + E   +N    TL  
Sbjct: 223 LITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKN 282

Query: 414 VINALVDRS----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 469
            I ++ + S      IP++ S LT+LL     GN KT +I T S  K    ET  TL+  
Sbjct: 283 SIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMG 342

Query: 470 SKAKNIK-----NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQ 518
            K ++I      NK  L +    D++V+++              KSKE  YM++
Sbjct: 343 LKLESISSNVHMNKHALNSKKKLDLIVEDM--------------KSKEANYMNR 382

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 8/85 (9%)

Query: 106 IFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKL 165
           ++  + G L  +  +GY+  V+ YG   TGK+    G +  Y G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 166 FDTLELQQSD--YVVKCSFIELYNE 188
           +D ++   +D  + V  S IE++ E
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLE 153

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 74  INTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTS 133
           + T  DT +  ++  + ++  KV    A++   F E+A  +  D + G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 134 TGKTYTMTGDEKLYNGELNDA---AGIIPRVLLKLFDTLELQQ-SDYVVKCSFIELY 186
              +  M G +   + E  D+   +G++ +    +F+ ++    S+Y V  S  E+Y
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVY 189

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 10/56 (17%)

Query: 117 DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQ 172
           +  +G +C+++ YG ++TGKT+ +           +   GIIP  + +L+  LE Q
Sbjct: 75  ELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLYIYLEAQ 120

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 30/153 (19%)

Query: 336 RGLKHRQVAS-TKMNDF--------SSRSHTIFTITL--YKKHQDELFRISKMNLVDLAG 384
           +GLK   V+S  ++ D+        +S  HT   I+L     H+D  FR   +  VDL  
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDS-FRKCCIEFVDLCA 224

Query: 385 SENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNT 444
            E++                 Q + +L  V++   D    I   +S+  +LL +S+GGN 
Sbjct: 225 QEDVL----------------QLVCSLVAVLSN--DNDKKIGKEKSQFCKLLSNSIGGNR 266

Query: 445 KTALIATISPAKVTSEETCSTLEYASKAKNIKN 477
           KT  I   S  +   + +  TLE+  K   + N
Sbjct: 267 KTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

>AEL270W Chr5 (132790..134703) [1914 bp, 637 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR179C (HDA3)
          Length = 637

 Score = 35.4 bits (80), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 6/72 (8%)

Query: 522 KNLNSDLESHKNEVQECKREIESLASK---NSLLVKDKLKSRETIQSQNSQMESLKATIN 578
           +N  +  ESHK  +   K+++E   SK   N+ LV + LK+    Q++  Q+E L+A I+
Sbjct: 436 QNQTAIFESHKEALSTIKKQLEDAISKKQRNNTLVDEYLKNS---QNERDQLEVLEADIS 492

Query: 579 HLKAQLDKQHKA 590
            L  QLD +H+ 
Sbjct: 493 DLLGQLDGRHQG 504

>Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W
           (TID3) - Product of gene unknown [contig 159] FULL
          Length = 676

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 843 IKKTVDTSSNSMNESISVMKGQVEESENA-ISLLKNNTKFNDQFKQLIS 890
           +KK +DT+SN+M++++S +K Q  E+E+A +SLL    ++    + LI+
Sbjct: 421 LKKALDTTSNNMDQAVSRLKAQKIETESAYMSLLDVGKQYESSVENLIA 469

>KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {ON}
           weakly similar to uniprot|P33420 Saccharomyces
           cerevisiae YPL174C NIP100 Large subunit of the dynactin
           complex which is involved in partitioning the mitotic
           spindle between mother and daughter cells putative
           ortholog of mammalian p150(glued)
          Length = 819

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 3/51 (5%)

Query: 534 EVQECKREIESLASKNSL-LVKDKLKSRETIQSQNSQMESLKATINHLKAQ 583
           E+ ECK  +ESLASK++   + DKL    T    N+++ES KAT+  LK++
Sbjct: 224 ELDECKHVVESLASKSADNQIIDKLTEENT--DLNARVESFKATVEELKSE 272

>ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} similar
           to uniprot|Q756L3 Ashbya gossypii AER241W AER241Wp and
           weakly similar to uniprot|P32380 Saccharomyces
           cerevisiae YDR356W SPC110 Inner plaque spindle pole body
           (SPB) component
          Length = 835

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 19/174 (10%)

Query: 523 NLNSDLESHKNEVQECKREI---ESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINH 579
           NLN  + + + E  E K +    ESL S N     D L  R+ +Q+  +Q+E  + T   
Sbjct: 402 NLNQRISALRKECDEWKSKYQRNESLDS-NHRKAFDSL--RQELQTTKTQLEETRKTAQQ 458

Query: 580 LKAQL-----DKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEI 634
           L+ Q+         +    I     ++QK+   +Q   Q  K    D +++ +     E 
Sbjct: 459 LQTQVIENTTKNSERTSQRIKDKETQIQKLESELQFCKQQLK----DGSRRLQA----EE 510

Query: 635 KSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDC 688
           +  +     +L N++ KN F+ T ++  + ++K E + L+ET   + EL    C
Sbjct: 511 ERCRETFESELQNLEMKNGFERTKLEREITLLKEERVALIETHDRELELWKSKC 564

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 62/135 (45%), Gaps = 18/135 (13%)

Query: 321 EFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI------ 374
           E  I +A+E   LL    K+  V S  +N     S T   + L +  Q   F        
Sbjct: 367 EIDIDDAIE---LLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSD 423

Query: 375 ---SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDRSGHI--PFR 428
              S+  +VD+ G++++ +S  +  +  E   +N SLLTLG+ IN L +D    +  P  
Sbjct: 424 KTNSEFTIVDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLA 480

Query: 429 ESKLTRLLQDSLGGN 443
           E  + R L++S  GN
Sbjct: 481 EFLIRRALKNSRLGN 495

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2.649
           YKL012W
          Length = 606

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 711 RIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN-HHIDSTYENIEKKTNQ 769
           R E +++   +A + +D S    + +Q L+N+ F+NN + + N H +  T+E++ K+   
Sbjct: 306 RTELRDYLNGVAFSPNDGS--LLSWQQLLQNYLFENNKRFVANKHFVVLTHEDVLKEYLD 363

Query: 770 FVENFKMTLNDHLEENK 786
            V+ ++  L D L+E K
Sbjct: 364 IVDTYETKLRDALKEEK 380

>KLLA0F08305g Chr6 (773720..774685) [966 bp, 321 aa] {ON} similar to
           uniprot|P12686 Saccharomyces cerevisiae YGR084C MRP13
           Mitochondrial ribosomal protein of the small subunit
          Length = 321

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 19/98 (19%)

Query: 710 IRIEFQNFYKNIAENLSDI---SEENNNLKQYLKNHFFKNNHQELLNH-HIDSTYENIEK 765
           + ++  NF +NI  NL  I   +   N L+ +L     KN  Q LL+   +D  + + E 
Sbjct: 212 VEVKLPNFARNIEINLPSIDVSTASQNQLRTFLT----KNTTQYLLSRTALD--FGSTEA 265

Query: 766 KTNQFVENFKMTL---------NDHLEENKKLIMQNMT 794
           K  QFVEN++  L         + ++ + K+L+ Q  T
Sbjct: 266 KLQQFVENYQAVLAQNSVADIYDKYVSQYKQLLTQKAT 303

>KAFR0A08490 Chr1 complement(1700790..1704548) [3759 bp, 1252 aa] {ON}
            Anc_1.100 YNL257C
          Length = 1252

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 522  KNLNSDLESHKNEVQECKREIESLASKNSLLVKDKL---KSRETIQSQNSQMESLKATIN 578
            KN N+DL S++N+ +E +RE+     +N LLV+ K+     +E +Q        +K T N
Sbjct: 1159 KNFNNDLTSNENKYRESRRELA--LKRNDLLVELKILQNMEKELVQGDYKSF-LIKETEN 1215

Query: 579  HLKAQLDKQHKAE 591
              KAQL  +H  E
Sbjct: 1216 CKKAQLHYEHIWE 1228

>Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON}
           (19685..21463) [1779 nt, 593 aa]
          Length = 592

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 711 RIEFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQF 770
           RI+F+   K +A+N SD+S++  +L  +L+     +    L++  +DST + +EK+    
Sbjct: 501 RIKFEEQTKQLADNRSDLSKQITDLNSHLEK-LSVSKKLVLISEQVDSTIKVVEKEEQTA 559

Query: 771 VENFKMTLNDHLEENKKLIMQNMTNATSA 799
            E      N  L++ K L ++ +TNA  A
Sbjct: 560 AEEAD---NKELQKKKNLELEALTNAAPA 585

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,205,365
Number of extensions: 4316659
Number of successful extensions: 23572
Number of sequences better than 10.0: 1460
Number of HSP's gapped: 23679
Number of HSP's successfully gapped: 2269
Length of query: 998
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 878
Effective length of database: 39,721,479
Effective search space: 34875458562
Effective search space used: 34875458562
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)