Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.276.17ON61561528300.0
YEL062W (NPR2)6.17ON61561524480.0
Smik_5.256.17ON61561524010.0
Suva_5.56.17ON61962023940.0
ZYRO0C07876g6.17ON68169914450.0
NCAS0H008706.17ON61263713680.0
CAGL0L13288g6.17ON64667013710.0
Kpol_1045.726.17ON69569813640.0
TDEL0G045206.17ON67949513561e-180
TPHA0J003106.17ON67567813081e-172
SAKL0E01100g6.17ON71057312941e-170
KLLA0D01067g6.17ON66068312881e-170
KNAG0M011406.17ON59463412791e-169
KAFR0L003806.17ON54061712701e-169
TBLA0G010106.17ON71049712761e-167
NDAI0D008606.17ON66667012681e-167
Ecym_30216.17ON67469012621e-166
Kwal_56.224116.17ON68955811981e-156
KLTH0C11308g6.17ON69069911801e-153
ACR009W6.17ON68050011681e-151
Skud_4.4908.450ON46194830.20
KAFR0B035108.779ON623175790.67
TPHA0C038502.476ON1056126752.2
KLTH0D09174g2.171ON1117138752.2
SAKL0H21450g4.93ON37499742.3
NCAS0A142907.374ON469161742.5
NCAS0A011106.211ON533116742.6
NDAI0K009008.761ON103880742.9
Kpol_479.88.609ON47794733.3
KAFR0A022902.591ON69087733.6
TPHA0E036901.45ON817130733.7
TDEL0A061108.665ON56885724.5
Kpol_2001.551.136ON914131724.9
Skud_12.474.39ON159960725.2
TDEL0C065701.45ON810129716.3
ZYRO0F17578g1.45ON81041716.3
Suva_7.323.544ON95867716.4
KAFR0C020003.497ON106646716.5
SAKL0A07304g6.107ON47158707.4
NDAI0A017507.374ON473164707.4
Kwal_14.16956.138ON28171698.0
CAGL0H10186g3.270ON778123708.2
KNAG0C005101.45ON78052708.2
Smik_11.3161.216ON409081709.2
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Skud_5.27
         (1848 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)  1094   0.0  
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   947   0.0  
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   929   0.0  
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    926   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   561   0.0  
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   531   0.0  
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   532   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   530   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   526   e-180
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   508   e-172
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   503   e-170
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   500   e-170
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   497   e-169
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   493   e-169
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   496   e-167
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   493   e-167
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   490   e-166
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   466   e-156
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   459   e-153
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   454   e-151
Skud_4.490 Chr4 (878956..880341) [1386 bp, 461 aa] {ON} YDR229W ...    37   0.20 
KAFR0B03510 Chr2 complement(729872..731743) [1872 bp, 623 aa] {O...    35   0.67 
TPHA0C03850 Chr3 complement(829920..833090) [3171 bp, 1056 aa] {...    33   2.2  
KLTH0D09174g Chr4 (762443..765796) [3354 bp, 1117 aa] {ON} simil...    33   2.2  
SAKL0H21450g Chr8 complement(1877976..1879100) [1125 bp, 374 aa]...    33   2.3  
NCAS0A14290 Chr1 complement(2813830..2815239) [1410 bp, 469 aa] ...    33   2.5  
NCAS0A01110 Chr1 complement(219722..221323) [1602 bp, 533 aa] {O...    33   2.6  
NDAI0K00900 Chr11 complement(199843..202959) [3117 bp, 1038 aa] ...    33   2.9  
Kpol_479.8 s479 complement(16333..17766) [1434 bp, 477 aa] {ON} ...    33   3.3  
KAFR0A02290 Chr1 (477162..479234) [2073 bp, 690 aa] {ON} Anc_2.5...    33   3.6  
TPHA0E03690 Chr5 (781473..783926) [2454 bp, 817 aa] {ON} Anc_1.4...    33   3.7  
TDEL0A06110 Chr1 (1069675..1070355,1070357..1071382) [1707 bp, 5...    32   4.5  
Kpol_2001.55 s2001 complement(149236..151980) [2745 bp, 914 aa] ...    32   4.9  
Skud_12.47 Chr12 (92122..96921) [4800 bp, 1599 aa] {ON} YLL021W ...    32   5.2  
TDEL0C06570 Chr3 (1206296..1208728) [2433 bp, 810 aa] {ON} Anc_1...    32   6.3  
ZYRO0F17578g Chr6 (1461181..1463613) [2433 bp, 810 aa] {ON} high...    32   6.3  
Suva_7.32 Chr7 (64195..67071) [2877 bp, 958 aa] {ON} YGL227W (REAL)    32   6.4  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....    32   6.5  
SAKL0A07304g Chr1 complement(646374..647789) [1416 bp, 471 aa] {...    32   7.4  
NDAI0A01750 Chr1 (388587..390008) [1422 bp, 473 aa] {ON} Anc_7.3...    32   7.4  
Kwal_14.1695 s14 (426641..427486) [846 bp, 281 aa] {ON} YBR231C ...    31   8.0  
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    32   8.2  
KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}...    32   8.2  
Smik_11.316 Chr11 complement(525589..537861) [12273 bp, 4090 aa]...    32   9.2  

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score = 1094 bits (2830), Expect = 0.0
 Identities = 559/615 (90%), Positives = 559/615 (90%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL
Sbjct: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61   ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            QNQLLSKSEKDAVFFDLKALENSTITPSTAGA                 DKDAKDLRSSR
Sbjct: 121  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
            YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
            LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY
Sbjct: 241  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 1080
            KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR
Sbjct: 301  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360

Query: 1081 DSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSS 1260
            DSPSLFV        IPSNPDSRTT                    VCKDWRQSQTSLSSS
Sbjct: 361  DSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSSS 420

Query: 1261 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 1440
            NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR
Sbjct: 421  NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 480

Query: 1441 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 1620
            IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV
Sbjct: 481  IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 540

Query: 1621 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 1800
            KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV
Sbjct: 541  KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 600

Query: 1801 ENYLNELGEFKVINS 1845
            ENYLNELGEFKVINS
Sbjct: 601  ENYLNELGEFKVINS 615

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
            SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
            Npr2/3 complex mediates downregulation of TORC1 activity
            upon amino acid limitation; SEA complex is a
            coatomer-related complex that associates dynamically with
            the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
            required for non-nitrogen-starvation (NNS)-induced
            autophagy; Iml1p interacts primarily with phosphorylated
            Npr2p; homolog of human NPRL2; target of Grr1p; required
            for growth on urea and proline
          Length = 615

 Score =  947 bits (2448), Expect = 0.0
 Identities = 476/615 (77%), Positives = 513/615 (83%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNT KNYIIPKPILCHKL
Sbjct: 1    MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61   ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            QNQLLSKSE+D VFFDLK LENST TPSTAG                  +KD KD+RSSR
Sbjct: 121  QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
            Y+DL KDLGLP+S+FSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181  YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
            LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLS SDP LVIECIRHLIYY
Sbjct: 241  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 1080
            KCVTLSDIFQFSNIYAPSSLIR FLTD LMASDCQSYV FPE+SK+S+LPL+K+L S D+
Sbjct: 301  KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360

Query: 1081 DSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSS 1260
            DSPS  V        IPSNPDSRTT                    + KDWRQSQTS SSS
Sbjct: 361  DSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSS 420

Query: 1261 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 1440
            N+   +NRNRFLPTRSCLFDLYRSLSQG+TLK+WYESK+ ILKENNID+RRFITFGLE+R
Sbjct: 421  NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480

Query: 1441 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 1620
            IIYRCYSFPVM+N  SRE KEMT +I KD +N+D+ L+K+N +   S  GS+N+ Q  N+
Sbjct: 481  IIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNL 540

Query: 1621 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 1800
            K ERPSKVSFEMQR  SLATG++T+PKLSDEEE ILE SIR+AE+FD ICVLLSK KLEV
Sbjct: 541  KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV 600

Query: 1801 ENYLNELGEFKVINS 1845
            E+YLNELGEFKVINS
Sbjct: 601  ESYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
            YEL062W (REAL)
          Length = 615

 Score =  929 bits (2401), Expect = 0.0
 Identities = 470/615 (76%), Positives = 507/615 (82%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKP+LCHKL
Sbjct: 1    MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61   ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            QNQLLSKSEKD VFFDLKALENSTI PSTA                   DKDAKDLR+SR
Sbjct: 121  QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
            YNDL KD  LPES+FSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181  YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
            LEDVPLSSVNL+KIIDVNWDPTMM+IVPYIDGLNSIAKISKLS SDPSLVIECIRHLIYY
Sbjct: 241  LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 1080
            KCVTLSDIFQFSNIYAPSS IR FLTD LMA+DCQ YV FPE+SK+SSLPL+KNL S D 
Sbjct: 301  KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 1081 DSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSS 1260
            DSPS  V        IPSNP SRTT                      +DWRQSQTS SSS
Sbjct: 361  DSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSSS 420

Query: 1261 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 1440
            N+  ++NRNRFLPTRSCLFDLYRSLSQG+TLK+WYESK+ I+K+NNID+RRFITFGLE+R
Sbjct: 421  NIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480

Query: 1441 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 1620
            IIYR YS+PVML+V  RE KE   +I KDS N+  S +KK  + SFS++ SKN+   NN+
Sbjct: 481  IIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFNNI 540

Query: 1621 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 1800
            KS RPSKVSF+MQ+A SL TGE+TIPKLSD+EERILE S+RSAE+FD ICVLL K KLEV
Sbjct: 541  KSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEV 600

Query: 1801 ENYLNELGEFKVINS 1845
            ENYLNELGEFK+INS
Sbjct: 601  ENYLNELGEFKIINS 615

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  926 bits (2394), Expect = 0.0
 Identities = 474/620 (76%), Positives = 509/620 (82%), Gaps = 5/620 (0%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLK+HGINFNTIKNYIIPKPILCHKL
Sbjct: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61   ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            QNQLLSKSE+D VFFDLKA+ENS +TPSTAG                  DKDAKDLRS+R
Sbjct: 121  QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 541  -----YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 705
                 YND+ KDLGLPES+FSIQDLLMRIFQDLNNYSECLIPID+GNAVDIKIFPLLRPP
Sbjct: 181  FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 706  TTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIR 885
            TTCVSLEDVPLSSVNLKKIIDVNWDPTMM IVPYIDGLNSIAKISK S SDPSLVIECIR
Sbjct: 241  TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 886  HLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNL 1065
            HLIYYKCVTLSDIFQFSNIYAPSSLIR FLTD LMA+DCQSYV FPEISK+S+LPL+KN 
Sbjct: 301  HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360

Query: 1066 DSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQT 1245
            DS D+D  S  V        +PSNP+SRTT                    V KDWRQSQT
Sbjct: 361  DSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQT 420

Query: 1246 SLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITF 1425
            S SS+N  A   RN+FLPTRSCLFDLYRSLSQG+TLKSWYE K   LKENNID+RRFITF
Sbjct: 421  SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480

Query: 1426 GLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSG 1605
            GLER IIYRCYSFPVM++V SR+ KEMT +  K+  N+D SLKK++ + S SV GSK++ 
Sbjct: 481  GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540

Query: 1606 QPNNVKSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSK 1785
            Q  NVKSERPSKVSFEMQRA SLATG+  IPKLSDEE++ILE SIRSAE+FD ICVLL K
Sbjct: 541  Q-TNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599

Query: 1786 SKLEVENYLNELGEFKVINS 1845
            SK EVENYL+ELGEFKVINS
Sbjct: 600  SKQEVENYLSELGEFKVINS 619

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar to
            uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
            Regulator of nitrogen permeases transcription is induced
            in response to proline and urea contains two PEST
            sequences
          Length = 681

 Score =  561 bits (1445), Expect = 0.0
 Identities = 317/699 (45%), Positives = 412/699 (58%), Gaps = 84/699 (12%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+ IKNYIIPKP LCHKL
Sbjct: 15   MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 75   LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSS- 537
            QNQ+LSK+E D ++FD K  +N+T       A                 +K  K L  S 
Sbjct: 135  QNQILSKAENDPIYFDFKLADNTTEQDGKLNA-----------------EKSFKGLTKSQ 177

Query: 538  -----RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRP 702
                 +YN++ KDL   +S FS+QDL+MRIFQDLNNYSECLIPIDEGNAVDIKIFPL  P
Sbjct: 178  GMALAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTP 237

Query: 703  PTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECI 882
            P +C+S+EDVP+S+VNLK IIDVNWDPTM+ IVPYIDGLNSI+KI+KLS SD SLV+EC+
Sbjct: 238  PNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECV 297

Query: 883  RHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK- 1059
            +HL+YY CV L+DIFQFSNIYAP+SLIR FLTD  +AS+CQS+V     S +S +P  + 
Sbjct: 298  KHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERL 357

Query: 1060 ---NLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDW 1230
               +LD  D+               + S  DS++                          
Sbjct: 358  RKFDLDDMDQSKNQ---ESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFN---------- 404

Query: 1231 RQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVR 1410
            ++SQ+S SS+N     +  R LPT++CLFDLYR+LSQG T++ WY   +  +K+N+IDVR
Sbjct: 405  QRSQSSFSSTNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVR 464

Query: 1411 RFITFGLERRIIYRCYSFPVM-----------------LNVDSRERK------------- 1500
            RFITFG+ + +IYRC+SFPVM                 LN  +++ K             
Sbjct: 465  RFITFGVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFS 524

Query: 1501 ----------------------EMTRMILKDSLN-------DDRSLKK---KNQDASFSV 1584
                                  E+ R + K   N       DD  L +   +    S S 
Sbjct: 525  TSDMKLGEGSKMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSA 584

Query: 1585 VGSKNSGQPNNVKSERPSKVSFEM------------QRAGSLATGEATIPKLSDEEERIL 1728
            +   N   P   K ER SKV+F+M            Q+  +     A + +  + ++ IL
Sbjct: 585  LSGDNVSHPK--KPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIIL 642

Query: 1729 ENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 1845
              SI +A+  D ICV L K + EVE  L+ELG++K+INS
Sbjct: 643  LESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
            YEL062W
          Length = 612

 Score =  531 bits (1368), Expect = 0.0
 Identities = 301/637 (47%), Positives = 399/637 (62%), Gaps = 26/637 (4%)
 Frame = +1

Query: 7    SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLIT 186
            ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+T
Sbjct: 10   NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 187  FKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQN 366
            FKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 70   FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 367  QLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSRYN 546
            Q+LSK+E D ++F       S   P+                       D  D   SR+ 
Sbjct: 130  QILSKAENDPIYF------KSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNND--GSRFE 181

Query: 547  DLTKDLGLPE---SSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTT-C 714
              T   G  E   + FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    
Sbjct: 182  --TDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHL 239

Query: 715  VSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLI 894
            +SLEDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+++DP LVIECI+HL+
Sbjct: 240  ISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLV 299

Query: 895  YYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSA 1074
            YY CV ++DIFQFSN+YAP+SLI +FLTDQ MA+ CQ+YV  P  SK+S LP   N +  
Sbjct: 300  YYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQ 359

Query: 1075 DRDSPSLFVXXXXXXXXIPSNP-DSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSL 1251
                              PS P  SRTT                    +    ++S+TSL
Sbjct: 360  ------------------PSTPKHSRTTSLSSSMSGSVNSHEHSYMDTI----QKSETSL 397

Query: 1252 SSSNLRANDNRNRF--LPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITF 1425
            S S+   N+       LPT++CLFDLYRSLS G TL+SWY+S   I+ ENN+DVR+FI F
Sbjct: 398  SLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKF 457

Query: 1426 GLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDA---SFSVVGSK 1596
            G+ R +IYRC+S+P    +  R   E  + I + +  D   L+ ++  +   S S  GS 
Sbjct: 458  GIIRGLIYRCHSYP----IPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSG 513

Query: 1597 NSGQPNNV--------------KSERPSKVSF-EMQRAGSLATGEATIPKLSDEEER-IL 1728
            +S  P+++              K ER SKVSF + ++  S+ T E   P    +EER +L
Sbjct: 514  SSASPSSINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVL 573

Query: 1729 ENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVI 1839
              SI S E+ D ICV L KS+ +VE +L+ELG +K+I
Sbjct: 574  LKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
            {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
            YEL062w nitrogen permease regulator
          Length = 646

 Score =  532 bits (1371), Expect = 0.0
 Identities = 308/670 (45%), Positives = 405/670 (60%), Gaps = 56/670 (8%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L+N GINF++IKNY+IPK  LCH+L
Sbjct: 1    MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            ITFKYG YRI CYPVT+NS IYAR           P++CETSPYEPAI RLGKMF+VLE 
Sbjct: 61   ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            QNQ+LSKSE D + F+LK+ + +    + +                       KD +  R
Sbjct: 121  QNQILSKSENDTIMFNLKSADKNFNIDNDSS------NYILGDDISSIMTTQQKD-KYER 173

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
             N++  ++    S+F+I DLLMR++QDLN YSECLIPID+GNAVDIK+FPLL PPT  +S
Sbjct: 174  LNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYIS 233

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
            +E VP+S VNL KI+DVNWDP M++I+PYI+G+N+I +IS+LS ++ SLVIECIRHL+YY
Sbjct: 234  IEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYY 293

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPL--------S 1056
            +C+ L+DIF+FSN+YAP+S +R FL D  MA++CQSYV  P  SKM+ L L        +
Sbjct: 294  RCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSA 353

Query: 1057 KNLDSADRD---SPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKD 1227
             N D   R+   S SL+           S P SR++                      K+
Sbjct: 354  FNGDIGSRNNSVSTSLYSFNGN-----DSRPQSRSSSVDQSQTNFY------------KN 396

Query: 1228 WRQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDV 1407
             +QS++S+S+ N     N ++ LPTRS LFDLYRSLSQG TLK WY   H I+++N IDV
Sbjct: 397  KKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDV 456

Query: 1408 RRFITFGLERRIIYRCYSFPVMLNVD---------------SRERKEMTRMILKDSLNDD 1542
            RRFITFG+ RRIIYRC ++ V+ + D               S E     +    DSL  D
Sbjct: 457  RRFITFGVLRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAAD 516

Query: 1543 RSLKKKNQDASFSVVGSKNSGQPNNV--------------------KSERPSKVSFEMQ- 1659
             +L    +  S   V SK + + +N                     +++R SKVSFE   
Sbjct: 517  EALMNAYKKLSLK-VPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALP 575

Query: 1660 ------RAGS---LATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYL 1812
                  R GS       E T  KLS  + RI+  ++  AE+ D ICVLL   +  V N L
Sbjct: 576  EDRNGFRWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNIL 635

Query: 1813 NELGEFKVIN 1842
            +ELGE K+IN
Sbjct: 636  HELGELKLIN 645

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
            (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  530 bits (1364), Expect = 0.0
 Identities = 309/698 (44%), Positives = 402/698 (57%), Gaps = 87/698 (12%)
 Frame = +1

Query: 13   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLITFK 192
            F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL N+ INF++I++Y+IPKP LC+KL+T K
Sbjct: 4    FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 193  YGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQNQL 372
            YG YRI+ YP+TIN  IYAR           PY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 64   YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 373  LSKSEKDAVFFDLKALENSTITPST--------AGAXXXXXXXXXXXXXXXXXDKDAKDL 528
            LSK+EKD  +FD KA+ +S++   +        +G                    D+K  
Sbjct: 124  LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 529  RS---SRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR 699
             S    +Y ++ + +   ES FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 184  SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 700  PPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIEC 879
            PP   +S+EDVP+S VNLK+IIDVNWDPTM+ IVP+IDG+NSIAKI+KLS SD  LVIEC
Sbjct: 244  PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 880  IRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK 1059
            I+H IYY CV +SDIFQFSNIYAP+SL+R FLTD LMA++CQ+YV  PE S +  LPL  
Sbjct: 304  IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 1060 ----NLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKD 1227
                 LDS   DS +L            S   SR                      +  +
Sbjct: 364  LSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSR------GASSHNENSSLYSRSDLYLN 417

Query: 1228 WRQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDV 1407
              +S++S+SS N    +   + LPTRS LFDLYRSLSQG TLK WY+     ++ N ID+
Sbjct: 418  RHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDI 477

Query: 1408 RRFITFGLERRIIYRCYSFPVMLNV----------DSRERKEMTRMILKDSLNDD----- 1542
            R+FI FG+   ++YRC SFPV  N           D + RKE  +  L+  L+ D     
Sbjct: 478  RKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTS 537

Query: 1543 ----------------------------------RSLKKKNQDASFSVVGSK-------- 1596
                                               +LK + +++S   + S+        
Sbjct: 538  DIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQ 597

Query: 1597 ---NSGQPNNVKSERP---SKVSFEM--QRAGSLATGEAT-------IPKLSDEEERILE 1731
                S  P +   +RP   SKVSF+       S ++G+ T       + KL  + E+IL 
Sbjct: 598  SLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRKQNEQILL 657

Query: 1732 NSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 1845
             ++ S E+ D ICVLL K + EVE  L  L +FKVINS
Sbjct: 658  EALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
            YEL062W
          Length = 679

 Score =  526 bits (1356), Expect = e-180
 Identities = 259/495 (52%), Positives = 337/495 (68%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL++H INF+ IKNYIIPKP LCHKL
Sbjct: 1    MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61   LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            QN +LSK+EKD +F+  K +E      + +                      ++   S +
Sbjct: 121  QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNL-----------SKSQAYASEK 169

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
            Y+ +  D+   +S+FS++DL++R++QDLNNYSECLIPIDEGNAVDIKIFP++ PP + +S
Sbjct: 170  YHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNIS 229

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
            +EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+KLS SDP LVIECI+HLIYY
Sbjct: 230  IEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYY 289

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 1080
             CV L+DIFQFSNIYAP+S +RTFLTD +++++CQSYV   E S +  LP  +   SA  
Sbjct: 290  NCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATE 349

Query: 1081 DSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSS 1260
                             S   S ++                    + +  + SQ+S SS+
Sbjct: 350  SVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSN 409

Query: 1261 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 1440
            N   ++   R+LPT+SCLFDLYRSLSQG +L+ WY   +  ++ N IDVRRFITFG+   
Sbjct: 410  NTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVING 469

Query: 1441 IIYRCYSFPVMLNVD 1485
            +IYRCYS+P+M N++
Sbjct: 470  LIYRCYSYPIMKNLE 484

 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 15/102 (14%)
 Frame = +1

Query: 1585 VGSKNSGQPNNV----KSERPSKVSFEMQRA-GSLATG-EATIPKLSDEEERILEN---- 1734
            +GS   G  NN+     S+RPSKVSF+ Q+  G ++ G  ++  K+  +EE  LE     
Sbjct: 578  LGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRERD 637

Query: 1735 -----SIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 1845
                 S+ +A+S D ICV L  S+ +VE  +  LGE+K+INS
Sbjct: 638  LILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
            Anc_6.17 YEL062W
          Length = 675

 Score =  508 bits (1308), Expect = e-172
 Identities = 286/678 (42%), Positives = 391/678 (57%), Gaps = 64/678 (9%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M + F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+ IKNY+IPKP LCHKL
Sbjct: 1    MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +T KY  YRIV YP+ INS +YAR           PY+CETSPYEP + RLGKMF  LE 
Sbjct: 61   LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 361  QNQLLSKSEKDAVFFDLKAL-------------ENSTITPSTAGAXXXXXXXXXXXXXXX 501
            Q Q LSK EKD  +FD K +             +N+ ++ + +                 
Sbjct: 121  QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 502  XXDK-DAKDLRS--SRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAV 672
              DK ++K++    S+YN +   +   +   S+ D+LMR+FQDLN+YSEC IPID+GNA+
Sbjct: 181  TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 673  DIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSR 852
            DIK+FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+ LS 
Sbjct: 241  DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 853  SDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEIS 1032
            SD  LVIECIRH +YY CV LSDIFQFSNIYAP+S I  FLTD  +A++CQ YV  PE S
Sbjct: 301  SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 1033 KMSSLPLSKNLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXX 1212
             +S+LP  K          +           +  N +S+ +                   
Sbjct: 361  LLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYPNHD 420

Query: 1213 XVCKDWRQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKE 1392
             + ++ R+S++S SS N         +LPT+S LFDLYRSLSQG  L+ WY+     +++
Sbjct: 421  SIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRD 480

Query: 1393 NNIDVRRFITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDA 1572
            N ID+RRFI FG+ +RIIYRC+S+P+  N ++  +       LK+  N  + +K K+Q  
Sbjct: 481  NFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLN----DLKNLQNGPKIVKNKSQSY 536

Query: 1573 SFSVVGSKN------------------------------------SGQPN---NVKSERP 1635
            ++++  + +                                    +G+P    N + + P
Sbjct: 537  TYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQHP 596

Query: 1636 SKVSFEMQRAGSLATG-------EAT--IPKLSDEEERILENSIRSAESFDNICVLLSKS 1788
            SKV+F+ Q   +   G       EAT    +++  ++  L ++++SAE+ DNIC  L  S
Sbjct: 597  SKVAFKNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICSNLELS 656

Query: 1789 KLEVENYLNELGEFKVIN 1842
            + EVE  LNEL E+++IN
Sbjct: 657  REEVETLLNELTEYRIIN 674

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
            similar to uniprot|P39923 Saccharomyces cerevisiae
            YEL062W NPR2 Regulator of nitrogen permeases
            transcription is induced in response to proline and urea
            contains two PEST sequences
          Length = 710

 Score =  503 bits (1294), Expect = e-170
 Identities = 265/573 (46%), Positives = 360/573 (62%), Gaps = 14/573 (2%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+N+ INF+TIKNY+IPKP LC+KL
Sbjct: 1    MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +TFKYG YR+ CYPV +N+  YAR           PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61   LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPS----TAGAXXXXXXXXXXXXXXXXXDKDAKDL 528
            Q+Q+LSK+E D V+F LK+ E+ST + S      G+                  K+   +
Sbjct: 121  QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 529  RSS-----RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPL 693
                    +Y+++  DL   +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 181  EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 694  LRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVI 873
            L PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+K S SD  LVI
Sbjct: 241  LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 874  ECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEIS----KMS 1041
            EC++HLIYY CV L+DIFQFSNIYA +SLI  FLTD  +AS+CQ+YV   ++        
Sbjct: 301  ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFE 360

Query: 1042 SLPLSKNLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVC 1221
            S P   ++ S+ + + S  +           N  +RT                       
Sbjct: 361  SRPNLLSMHSSRKQNSSSTIHTVGV-----RNSPNRTNSLDYPSELSTRRNNFSSSSASS 415

Query: 1222 KDWRQSQTSLSSSNLRANDNRNR-FLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENN 1398
                + ++  S++    ++  +R  LPT+SCLFDLYRSL QG T+K WY+    I+++N+
Sbjct: 416  LMRVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNH 475

Query: 1399 IDVRRFITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASF 1578
            IDVRRFITFG+ R +IYRCY++PVM N+ + E  +  +     S +D RSL++K      
Sbjct: 476  IDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLK-----SASDSRSLRRK------ 524

Query: 1579 SVVGSKNSGQPNNVKSERPSKVSFEMQRAGSLA 1677
             +   +     NNV S    KV  E    G+ A
Sbjct: 525  -LKFREKKNFTNNVFSTADIKVDLEHSPGGAPA 556

 Score = 51.6 bits (122), Expect = 5e-06
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 9/90 (10%)
 Frame = +1

Query: 1603 GQPNNVKSERPSKVSFEMQRAGSLATGE---------ATIPKLSDEEERILENSIRSAES 1755
            G  + ++SE  SKV+FE  R+      +         + + K    EE +L  S++S ++
Sbjct: 621  GSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVSNLLKEKRHEEFLLLKSVKSVDT 680

Query: 1756 FDNICVLLSKSKLEVENYLNELGEFKVINS 1845
            FD IC+ L K + EVE  L E+G + +INS
Sbjct: 681  FDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
            similar to uniprot|P39923 Saccharomyces cerevisiae
            YEL062W NPR2 Regulator of nitrogen permeases
            transcription is induced in response to proline and urea
            contains two PEST sequences
          Length = 660

 Score =  500 bits (1288), Expect = e-170
 Identities = 289/683 (42%), Positives = 388/683 (56%), Gaps = 68/683 (9%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L+N  I+F+TIKNYIIPKP LC+KL
Sbjct: 1    MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +TFKYG YRIVCYPV +N+  YAR           PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61   LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSS- 537
            Q+Q+LSKSE++ V+F LK+ +++    ST                      +  D++S+ 
Sbjct: 121  QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITI--------------SEHTDIKSTG 166

Query: 538  ----RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 705
                +Y ++ K+L   + S  I+DLLM++F DLNNYSECLIPIDEGN++DIK+FP+  PP
Sbjct: 167  DDGEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPP 226

Query: 706  TTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIR 885
            ++ +S+EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  +RSD  LV ECI+
Sbjct: 227  SSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIK 286

Query: 886  HLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLS--- 1056
            HL+YY CV LSDIFQFSNIYAP+S I  FLT+  +A  CQ +V    + K S LP     
Sbjct: 287  HLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSL-KQSLLPFEGRP 345

Query: 1057 KNLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQ 1236
             N+    R   S                DS  T                        + +
Sbjct: 346  NNIYPTGRKQASTSTVH-------SRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFR 398

Query: 1237 SQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRF 1416
            +  S ++S     +   R LPTRSCLFDLY+SLSQG+T+K WY+    I+++N IDVR+ 
Sbjct: 399  AHASENTSLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKL 458

Query: 1417 ITFGLERRIIYRCYSFPVMLN-----------------------------------VDSR 1491
            I FG+ RR+IYR  S+P++ N                                   VD++
Sbjct: 459  IMFGITRRLIYRVNSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTK 518

Query: 1492 ERKEMTRMI-----LKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNVKSERPS------ 1638
            E    +  +     L  SL    SLK+   +         +    NN  +E  S      
Sbjct: 519  EEGNQSDKLDAADELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSG 578

Query: 1639 ---KVSFEMQRAGSLATGEATIPKLSD-----------EEERILENSIRSAESFDNICVL 1776
               KVSF+   AG   T    +P L D           EEE IL  S+ +AE+FD +C  
Sbjct: 579  SHQKVSFDFGTAGQQKT-VTEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTK 637

Query: 1777 LSKSKLEVENYLNELGEFKVINS 1845
            L KS+ EVE  L +LG + ++NS
Sbjct: 638  LKKSRHEVELLLKDLGHYNIVNS 660

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
            Anc_6.17 YEL062W
          Length = 594

 Score =  497 bits (1279), Expect = e-169
 Identities = 282/634 (44%), Positives = 380/634 (59%), Gaps = 20/634 (3%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+++ INF+ IKNYIIPKP LCH+L
Sbjct: 1    MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +T KYG YRIV YPV + S  YAR           PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61   LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 361  QNQLLSKSEKDAVFF--DLKALENSTI---TPSTAGAXXXXXXXXXXXXXXXXXDKDAKD 525
            Q+Q+LS++E+D   F  D    +N++     P T                       +K 
Sbjct: 121  QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALI-------------------SKT 161

Query: 526  LRSSRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 705
               S       D+ L     S+QDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL+ PP
Sbjct: 162  KSFSPDKKTEGDIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPP 217

Query: 706  TTC-VSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECI 882
            T+  +S+EDVP+  V LKKIID+NWDPTM+SI+P+I+G+NSI  I++LS SDP LVIECI
Sbjct: 218  TSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECI 277

Query: 883  RHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKN 1062
            +HLIYYKCV ++DIFQFSNIYAPSSLI  FLTD  MA DCQ YV  P+ S++  +PL  +
Sbjct: 278  KHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTS 337

Query: 1063 LDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQ 1242
            +  +  +                   +S ++                       + ++S+
Sbjct: 338  VPGSRNNK--------------HKKSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSE 383

Query: 1243 TSLSSSNLRA---NDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRR 1413
            +SLSS        +D+   + PTR  LFDLYRSLSQG TL+ WY +    ++ N IDVR+
Sbjct: 384  SSLSSEGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRK 443

Query: 1414 FITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGS 1593
            FI FG  ++IIYR  S+PV+     + R  +    +  S   +++   KN   S S +  
Sbjct: 444  FIQFGTIKKIIYRVLSYPVL----EKRRNSIIAKQMGKSKMAEKAPHSKNAFFSTSDIKF 499

Query: 1594 KNSGQPNNVKSERPSKVSFEMQR-----------AGSLATGEATIPKLSDEEERILENSI 1740
             +  +  N    R SKVSFE +R            G     +     L+ EE+  L  ++
Sbjct: 500  DDGDRLFNSLYARFSKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGAL 559

Query: 1741 RSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 1842
             + ESFD ICV L +S++E+ N + ++GE++VIN
Sbjct: 560  DNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
            Anc_6.17 YEL062W
          Length = 540

 Score =  493 bits (1270), Expect = e-169
 Identities = 275/617 (44%), Positives = 369/617 (59%), Gaps = 2/617 (0%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+ + INF++IKN++IPKP LCH+L
Sbjct: 1    MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +T +Y  YR+V YPV ++S  YAR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61   LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            Q+Q+LSKS++ + FF                                   KD +D+    
Sbjct: 121  QSQILSKSQRTSAFF-----------------------------------KDGEDV---- 141

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 717
                       ++ FSIQDLLMR++QDLNNYSECLIPIDEGN ++IKIFP+L+PPT+  +
Sbjct: 142  --------DFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQI 193

Query: 718  SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIY 897
            S+EDVPLS VNL KI+D+NWDPTM+SI+P+IDG+NSI  IS LS SDP+LVIECI+HLIY
Sbjct: 194  SIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIY 253

Query: 898  YKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSAD 1077
            Y CV ++DIFQFSNIYAPSSLI  FL D ++A +CQSYV  P  SK++ LPL+   D   
Sbjct: 254  YNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEI 313

Query: 1078 RDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSS 1257
             +S               S    ++                           QS ++LSS
Sbjct: 314  NNSDMTQKALSSSRSSFSSYFSHKSAYARVSETAHH---------------HQSTSTLSS 358

Query: 1258 S-NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLE 1434
            S   + N  + + LP++  LFDLYRSL+ G T+++WY+   + +KEN+IDVR+FI FG+ 
Sbjct: 359  SEGQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVI 418

Query: 1435 RRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPN 1614
             +IIYR + +P+M      E K     +L D  ND   +     D  F V       +  
Sbjct: 419  NKIIYRVHQYPIM------EHKTFKSPLLSDRQND--KIVLSTSDIKFDV-----GDRIL 465

Query: 1615 NVKSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKL 1794
            N    + SKV+F+  +      G +    L + E+ IL N++   ESFD IC  L KSK 
Sbjct: 466  NSIYNKLSKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICSKLGKSKN 523

Query: 1795 EVENYLNELGEFKVINS 1845
            EVE+ ++E+GE+  INS
Sbjct: 524  EVESIISEIGEYMTINS 540

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
            Anc_6.17 YEL062W
          Length = 710

 Score =  496 bits (1276), Expect = e-167
 Identities = 257/497 (51%), Positives = 324/497 (65%), Gaps = 4/497 (0%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M  +F+GFVPIHT+FYS+FHPTEG+K++YEFPP NL+ + INF+TIKNYIIPKP LCHKL
Sbjct: 1    MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +T KYG YR+V YPVTINS +YAR           P +CETSPYEP I RLGKMF+VLEE
Sbjct: 61   LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 361  QNQLLSKSEKDAVFFD----LKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDL 528
            QNQLLS++E D+V+FD    L + E  +I                         K   DL
Sbjct: 121  QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSF-----SKRPTDL 175

Query: 529  RSSRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPT 708
              S Y D         S+FS+QDL+MRIFQDLNNYSECLIPIDEGN+VDIKIFP + PP+
Sbjct: 176  SLSEYPDNESG-----SNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPS 230

Query: 709  TCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRH 888
              +S EDVP++ V+L  ++DVNWDPTM+ IVP+ID +NSI++I+ LS SD   V+ECIRH
Sbjct: 231  ISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRH 290

Query: 889  LIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLD 1068
            L+YY+ V LSDIFQF+NIYAP+S +R FLTD  +A+DCQ+YV  P+ S    LPL K+++
Sbjct: 291  LVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSIN 350

Query: 1069 SADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTS 1248
            + D D  S           I  N D                             R SQ+S
Sbjct: 351  T-DLDEYSNSGSAIYPNNEILENDDRLRWPMYYKP-------------------RNSQSS 390

Query: 1249 LSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFG 1428
            LSS     N+  + +LPT+SCLFDLYRSLSQG  L  WY   ++++  N ID+RRFITFG
Sbjct: 391  LSSGISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFG 450

Query: 1429 LERRIIYRCYSFPVMLN 1479
            L R ++YRCY+ P+M N
Sbjct: 451  LVRGLLYRCYAIPIMKN 467

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 18/41 (43%), Positives = 29/41 (70%)
 Frame = +1

Query: 1720 RILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 1842
            R+L  S+R A++ D IC+ L K + EVE  L+E+G++ +IN
Sbjct: 669  RLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
            YEL062W
          Length = 666

 Score =  493 bits (1268), Expect = e-167
 Identities = 284/670 (42%), Positives = 389/670 (58%), Gaps = 58/670 (8%)
 Frame = +1

Query: 7    SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLIT 186
            ++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL    I+F+ IKNYIIPK  LC+KL+T
Sbjct: 11   NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 187  FKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQN 366
            FKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQN
Sbjct: 71   FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 367  QLLSKSEKDAVFFD-------------------------LKALENSTITPSTAGAXXXXX 471
            Q+LSK+E D ++F                          L   EN+  +     +     
Sbjct: 131  QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNRI 190

Query: 472  XXXXXXXXXXXXDKDAKDLRSSRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIP 651
                             +   + YN + + L    S  S+QDL+MRI+QDLNNYSECLIP
Sbjct: 191  LEENSNSNSNSNSNSNGNENDNNYNTIEQYLN-NNSRISVQDLIMRIYQDLNNYSECLIP 249

Query: 652  IDEGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSI 828
            ID+GN VDIKIFPLL+PP    +S+EDVP+S V+L KI DVNWDPTM+ ++P+I+G+N I
Sbjct: 250  IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309

Query: 829  AKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQS 1008
            +KISKLS S P LVIECI+HLIYY CV ++DIFQFSN Y+ +SLI TFLTD  MA+ CQ+
Sbjct: 310  SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369

Query: 1009 YVAFPEISKMSSLPLSKNLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXX 1188
            YV  P  SK++ LP     +++ + S S +          PS   S T+           
Sbjct: 370  YVVLPLGSKLTRLPFHIETETSVQSS-SAYRHHHNRHEKTPSFGSSITSNNGRSSFS--- 425

Query: 1189 XXXXXXXXXVCKDWRQSQTSLSSSNLRANDN--RNRFLPTRSCLFDLYRSLSQGRTLKSW 1362
                        D +QS+TSL+SSN  +N N      LPT+  LF+LYRSL+Q   LK+W
Sbjct: 426  ----------ADDRKQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNW 475

Query: 1363 YESKHAILKENNIDVRRFITFGLERRIIYRCYSFPVMLN--VDSRERKEMTRMILKDS-L 1533
            Y+  +  + ENNID+R+FI FG+ + +IYRC+S+P+++   V + E  + T   +  S +
Sbjct: 476  YKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITPVVSAPESAKSTSPFVSSSGI 535

Query: 1534 NDDRSLKKKNQDASFSVVGSKNSGQPNN-----------------VKSERPSKVSFEMQ- 1659
            +     K+  Q    S      S  P++                  K +  SKVSF  + 
Sbjct: 536  SSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLEKGKNHSKVSFSDKI 595

Query: 1660 ---------RAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYL 1812
                      A S    + +  +L+ ++  IL +SI + ++ D ICV L + + ++E +L
Sbjct: 596  AFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDSISNMDNMDKICVKLGRPRSQIEEWL 655

Query: 1813 NELGEFKVIN 1842
            +E G++KVIN
Sbjct: 656  SEFGDYKVIN 665

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
            similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  490 bits (1262), Expect = e-166
 Identities = 274/690 (39%), Positives = 392/690 (56%), Gaps = 75/690 (10%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L+N GI+F+TIKNY+IPKP LC+KL
Sbjct: 1    MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +TFKYG+YR+VCYPV IN+  YAR           PYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61   LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            Q+Q+LSK E+D +++ LK  +   +  ++                     + A +    +
Sbjct: 121  QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFE----K 176

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
            Y+++ K + + E   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C S
Sbjct: 177  YHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFS 236

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
            +EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK S SD  LV+EC++HLIYY
Sbjct: 237  VEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYY 296

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 1080
             CV L D+FQFSNIYAP+S +  FLTD  +A +CQ YV   E S++  LP     ++   
Sbjct: 297  DCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHS 356

Query: 1081 DSPSL-FVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSS 1257
             +P+   +        I +NP   +                            S+ S++ 
Sbjct: 357  RNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSL----------PSEPSITH 406

Query: 1258 SNLRANDNR-------NRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRF 1416
            S+  +  N        NR LPTRSCLFDLYRSLSQG+T+K WY+    ++++N IDVRRF
Sbjct: 407  SSKNSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRF 466

Query: 1417 ITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVG-- 1590
            ITFG+ R++IYRCYS+PV  ++ + +   + R       N+  S K  N +  FS     
Sbjct: 467  ITFGVFRKLIYRCYSYPVAKSIGTLDM--LKRFDYASLPNNFMSPKNNNSNNVFSTADIC 524

Query: 1591 --------------------------------SKNSGQPN---------NVKSERPSKVS 1647
                                            S N   PN          +  E  +  +
Sbjct: 525  VDFGEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASAN 584

Query: 1648 FEMQRAGSLATGEATI-----PKLSDEE-------------------ERILENSIRSAES 1755
             + ++  S  +G A +      +LS+++                   + +L  SI++ +S
Sbjct: 585  VDNRKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDS 644

Query: 1756 FDNICVLLSKSKLEVENYLNELGEFKVINS 1845
            FD I + L  +K EVE  L   GE+ +INS
Sbjct: 645  FDKIAIKLEINKQEVEELLKATGEYNIINS 674

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
            YEL062W (NPR2) - Non-membrane-embedded, PEST
            sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  466 bits (1198), Expect = e-156
 Identities = 248/558 (44%), Positives = 332/558 (59%), Gaps = 7/558 (1%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M  +F GFVP+H I Y++FHPTEG+K++++FPP  L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1    MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +TFKYG++R+VCYPV + +P YAR           PYDC TSPYE AI RLGKMF VLEE
Sbjct: 61   LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            Q+Q+LSK+E   V+F LK  ++   T                         ++      +
Sbjct: 121  QSQILSKAENSHVYFQLKTRDSHKHTNQEP---VNDNELQGTLKNNEASQSESHGYAFEK 177

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
            Y+++ KDL  P    S++DL+ +I++DLNNYSECLIPID GNAVDIK+FPLL PP++C+S
Sbjct: 178  YHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLS 237

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
             EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++KLS SD +LV+ECIRHL+YY
Sbjct: 238  FEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYY 297

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK------- 1059
             CV L+DIFQF NIYAP+S +  FLT+  +A++CQ YV   E + +S LP  +       
Sbjct: 298  NCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTY 357

Query: 1060 NLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQS 1239
            N       S +L V        I    +S  T                     C     +
Sbjct: 358  NNIPVRNSSSTLDVQRKGREMSI---KESSFTAGIDQSGRNQYTPQSHTSSIQC----HN 410

Query: 1240 QTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFI 1419
             +  S  N     N   F  ++SCLFD+YRSLSQG+T+K WY++    ++   IDVRRFI
Sbjct: 411  VSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFI 470

Query: 1420 TFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKN 1599
            TFG+   ++YRCYSFP+M NV   E  +   +   DS  + + L             S N
Sbjct: 471  TFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWL-------------SGN 517

Query: 1600 SGQPNNVKSERPSKVSFE 1653
            S   NNV S    ++  E
Sbjct: 518  SEPTNNVLSAAEIRIGLE 535

 Score = 45.4 bits (106), Expect = 4e-04
 Identities = 25/80 (31%), Positives = 46/80 (57%), Gaps = 7/80 (8%)
 Frame = +1

Query: 1624 SERPSKVSFEMQRAGSLATGE----ATIPKLSDE---EERILENSIRSAESFDNICVLLS 1782
            S+  + V+F+++R  + AT E      + +L ++   +E +L  S+R  E+FD IC  L 
Sbjct: 609  SDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVENFDKICTRLG 668

Query: 1783 KSKLEVENYLNELGEFKVIN 1842
            + + EVE  L +LG + V++
Sbjct: 669  RDREEVEKMLEDLGPYNVVH 688

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar to
            uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
            Regulator of nitrogen permeases transcription is induced
            in response to proline and urea contains two PEST
            sequences
          Length = 690

 Score =  459 bits (1180), Expect = e-153
 Identities = 271/699 (38%), Positives = 380/699 (54%), Gaps = 84/699 (12%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1    MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +TFKYG +R+VCYPV + +P YAR           PYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61   LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            Q+Q+LSK+E  +V+F LKA  N+    +T  A                 +       S++
Sbjct: 121  QSQILSKAENSSVYFQLKA-RNTQKHGNTETAKGTEQPSSLDIGEIAQPENQG--YASAK 177

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
            Y ++ KDL  P    +I DL+ +I++DLN+YSECLIPID GNAVDIK+FPLL PP++C S
Sbjct: 178  YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFS 237

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
            +EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++K S SD +LV+ECI+HLIYY
Sbjct: 238  IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSA-- 1074
             CV L+DIFQFSNIYA ++ +  FLT+  +A++CQ YVA+ E + + +LP  +    +  
Sbjct: 298  NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQ 357

Query: 1075 ----DRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQ 1242
                DR S    +         P   +S  +                       +   + 
Sbjct: 358  GNIRDRSSNGT-LDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDAS 416

Query: 1243 TSLSSSNLRANDNRNRFLP--TRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRF 1416
               S + L     + + +P  ++SCLFDLYRSL+QG+T++ WY++    ++   IDVRRF
Sbjct: 417  FGNSDAGL-----KGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRF 471

Query: 1417 ITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQ------DASF 1578
            ITFG+   +IYR YS+PV+ N+   E  E             + L K NQ       A+ 
Sbjct: 472  ITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAAD 531

Query: 1579 SVVGSKNSG---------------QPNNVKSERPSKVSFEMQRAGSLATGEATIPKL--- 1704
              +G +N+G                   V S+   K++   ++   +A G   I K+   
Sbjct: 532  IRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGR 591

Query: 1705 -----------------------------------SDEEERILENSIRSAE--------- 1752
                                               S  +ER     +RS E         
Sbjct: 592  NSEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELIL 651

Query: 1753 --------SFDNICVLLSKSKLEVENYLNELGEFKVINS 1845
                    +FD IC LL K +  VE+ L+ELG + V++S
Sbjct: 652  LKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  454 bits (1168), Expect = e-151
 Identities = 230/500 (46%), Positives = 319/500 (63%), Gaps = 2/500 (0%)
 Frame = +1

Query: 1    MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 180
            M + F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+TIKNY+IPK  LC+KL
Sbjct: 8    MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 181  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 360
            +TFK+G+YR+VCYPV I +P YAR           PYD  TSPYEPAI RL KM +VLEE
Sbjct: 68   VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 361  QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 540
            Q+Q+LSK E+D V++ LK  E       T  +                    A+   +++
Sbjct: 128  QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSR------AQHNATTK 181

Query: 541  YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 720
            Y+++ K +   E +  I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C+S
Sbjct: 182  YHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLS 241

Query: 721  LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 900
             EDVP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S S   LV+ECI+HL+YY
Sbjct: 242  FEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYY 301

Query: 901  KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK--NLDSA 1074
             CV L D+FQFSNIYAP++L+R FL D ++  +CQ YV   E  ++  LP     N   +
Sbjct: 302  DCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHS 361

Query: 1075 DRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLS 1254
               + S             +  DS ++                      KD+  ++    
Sbjct: 362  RNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNR---- 417

Query: 1255 SSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLE 1434
            S NL +N  R   LPTR  LFDLYRSL+QG+TLK WY++ ++ ++EN IDVRR I FG+ 
Sbjct: 418  SRNLESNCKRT--LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVF 475

Query: 1435 RRIIYRCYSFPVMLNVDSRE 1494
             R+IYRCYS+PV  ++ + E
Sbjct: 476  HRLIYRCYSYPVAKSIGTLE 495

>Skud_4.490 Chr4 (878956..880341) [1386 bp, 461 aa] {ON} YDR229W
            (REAL)
          Length = 461

 Score = 36.6 bits (83), Expect = 0.20
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 8/94 (8%)
 Frame = +1

Query: 1585 VGSKNSGQPNNVKSERPSKVSFEMQRAGSLATGEATIPKLS--------DEEERILENSI 1740
            VGS N+   +++   R SKV  + +RA S+ +G +TI  L          E +  L +  
Sbjct: 57   VGSVNNDHLDDMNHLRSSKVYSKARRASSITSGTSTINDLQTLITKRDVKETQEALSSLF 116

Query: 1741 RSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 1842
            R++ ++ N  +  S++  E+ + L  + + K  N
Sbjct: 117  RNSNAYSNSLLKTSQNGAEIAHSLENIAKLKGCN 150

>KAFR0B03510 Chr2 complement(729872..731743) [1872 bp, 623 aa] {ON}
            Anc_8.779 YMR239C
          Length = 623

 Score = 35.0 bits (79), Expect = 0.67
 Identities = 35/175 (20%), Positives = 76/175 (43%), Gaps = 12/175 (6%)
 Frame = +1

Query: 658  EGNAVDIK--IFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIA 831
            +GN ++I+  +  L++P    V+ ++V L   N    +D+N    + S++ Y        
Sbjct: 419  KGNLLNIREWLRKLVQPTINDVTKKEVSLEETNE---LDINAKRRLYSLIGYAALKLQYV 475

Query: 832  KISKLSRSDPSLVIEC------IRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMA 993
             + K +++DP+ ++EC      I      + + L+ I    ++ +   ++  +   +   
Sbjct: 476  TVQKPTKNDPNCIVECRIGDGTILGKGIARNMKLAGIKAAEDVLSKKDIVEKYANIRASI 535

Query: 994  SDCQSYV---AFPEISKMSSLPLSKNLDSADRDSPSLFVXXXXXXXXIP-SNPDS 1146
               +S V   +FP   +  S   S + +  +RD+  +F          P +NPDS
Sbjct: 536  PRSESVVSNNSFPNKRRKVSASASNDSEQNERDTQRVFFQKESDFPSTPTTNPDS 590

>TPHA0C03850 Chr3 complement(829920..833090) [3171 bp, 1056 aa] {ON}
            Anc_2.476 YMR086W
          Length = 1056

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 9/126 (7%)
 Frame = +1

Query: 1486 SRERKEMTRMI-----LKDSLNDDRS----LKKKNQDASFSVVGSKNSGQPNNVKSERPS 1638
            S +RKEM R+I     L++S+ND  S    L+K N   S S   +++  Q NN+     +
Sbjct: 463  SPKRKEMRRLISDSILLEESMNDTNSELSTLEKNNSSKSESDFNNQSDIQ-NNIDDNNST 521

Query: 1639 KVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYLNE 1818
             ++   +R   ++   +    L+DE++ IL       + FD+      +S +E EN + E
Sbjct: 522  GIAPIDKRISRISVTSSDYASLNDEKKEIL-------KLFDDFNNGAQESDVEDEN-VKE 573

Query: 1819 LGEFKV 1836
            + E K+
Sbjct: 574  VEEDKL 579

>KLTH0D09174g Chr4 (762443..765796) [3354 bp, 1117 aa] {ON} similar to
            uniprot|Q12271 YOR109w Saccharomyces cerevisiae INP53
            Phosphatidylinositol 4,5-bisphosphate 5- phosphatase
          Length = 1117

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 31/138 (22%), Positives = 64/138 (46%)
 Frame = +1

Query: 1252 SSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGL 1431
            S S L A+D++  +   R+ +  +  ++    T K + + K +  +E N      +    
Sbjct: 843  SDSQLIASDHKPVYAAYRAQVNFVDETVKMDLTKKLYMQYKESHPEEYNNTTVALVDIDY 902

Query: 1432 ERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQP 1611
            E++  +   S    L  +S    +++ + L ++  D  S+ + +  +S S + S NSG  
Sbjct: 903  EKKNGHGAKSSSTQLFAES----DISLVDLDENRADVGSITRSSSISSSSEMSSLNSGTL 958

Query: 1612 NNVKSERPSKVSFEMQRA 1665
            N V+ E PS+ +  + RA
Sbjct: 959  NPVRKEAPSRSTTSLGRA 976

>SAKL0H21450g Chr8 complement(1877976..1879100) [1125 bp, 374 aa]
           {ON} some similarities with uniprot|P40356 Saccharomyces
           cerevisiae YGL025C PGD1 Subunit of the Mediator global
           transcriptional cofactor complex which is part of the
           RNA polymerase II holoenzyme and plays an essential role
           in basal and activated transcription direct target of
           the Cyc8p-Tup1p transcriptional corepressor
          Length = 374

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 7/99 (7%)
 Frame = +1

Query: 655 DEGNAVDIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVP----YIDGLN 822
           +  + + + I   L P TT   LED   S    K+ I      T  SI+P    + D LN
Sbjct: 21  NSNSKLSMGILESLSPKTTLSELEDKLSSDGAHKEAIQQQIATTQESILPIRLCFNDFLN 80

Query: 823 SIAKISKLSRSDPS---LVIECIRHLIYYKCVTLSDIFQ 930
           S+AKI ++    P    L+I      +Y +   LSD ++
Sbjct: 81  SVAKIDQVDNKTPQERFLLIRSKLLEVYSRIQALSDDYE 119

>NCAS0A14290 Chr1 complement(2813830..2815239) [1410 bp, 469 aa] {ON}
            Anc_7.374
          Length = 469

 Score = 33.1 bits (74), Expect = 2.5
 Identities = 38/161 (23%), Positives = 62/161 (38%)
 Frame = +1

Query: 1333 LSQGRTLKSWYESKHAILKENNIDVRRFITFGLERRIIYRCYSFPVMLNVDSRERKEMTR 1512
            L  G ++ SW+      ++  N    + I+F L+RR+IY  + FP     D     ++T 
Sbjct: 294  LKDGESIDSWFTR----IRGKNYS--KPISFALKRRVIYNYFEFP----ADDSSVFDITT 343

Query: 1513 MILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNVKSERPSKVSFEMQRAGSLATGEAT 1692
               +D  N D + +  +             G+P N K            R G+  TG + 
Sbjct: 344  KKPQDRFNQDSNHEYGDDSMDVDETDVDADGEPGNSK------------RVGT--TGRSA 389

Query: 1693 IPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYLN 1815
             P      E +L   I+     DN+  +   +  EV N LN
Sbjct: 390  -PVDLFSLEALLGAGIQVTPGPDNVSYIAGSALSEVLNSLN 429

>NCAS0A01110 Chr1 complement(219722..221323) [1602 bp, 533 aa] {ON}
            Anc_6.211 YGL071W
          Length = 533

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 30/116 (25%), Positives = 47/116 (40%), Gaps = 3/116 (2%)
 Frame = +1

Query: 1489 RERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNVKSERPSKVSFEMQRAG 1668
            +E+K    M+   + N +  LKK N+         K S QP +  +  PS  S  +    
Sbjct: 286  KEKKNARSMVSSQTANKNNKLKKFNEQNIL-----KKSTQPLSTSNTSPSLGSDFIDNTN 340

Query: 1669 SLATG---EATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYLNELGE 1827
             L TG   +  +P L+ +      N I  A   DN  + LS +    +N   +L E
Sbjct: 341  ILTTGNGDDFVLPILTPDYAVHKNNKINPAPLLDNNLLPLSNNTNSNDNMTTDLLE 396

>NDAI0K00900 Chr11 complement(199843..202959) [3117 bp, 1038 aa] {ON}
            Anc_8.761 YMR231W
          Length = 1038

 Score = 33.1 bits (74), Expect = 2.9
 Identities = 24/80 (30%), Positives = 41/80 (51%)
 Frame = +2

Query: 1133 QTRTPELRLLVRTAKFPKTHH*IPHFHQFVRIGGSHKPLFQAQIFVLMTTVIGFYQQGRA 1312
            +T +P+L  + R AK PK  H I H    ++ G +  PL    I   ++ ++  Y  G+ 
Sbjct: 94   KTGSPQLINIYRLAKLPKDEH-IYHSRIILKSGANTFPLSVVSISKDLSCIVVGYVDGKV 152

Query: 1313 YLIFIDLSRKDER*NRGTSR 1372
             LI  D++R     +RG+S+
Sbjct: 153  LLIRGDIAR-----DRGSSQ 167

>Kpol_479.8 s479 complement(16333..17766) [1434 bp, 477 aa] {ON}
            complement(16333..17766) [1434 nt, 478 aa]
          Length = 477

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +1

Query: 1543 RSLKKKNQDASFSVVGSKNSGQPNNVKSERPSKVSFEMQRAGSLATGEATIPKLSDEEER 1722
            + L K+NQ +S S      S +  N +S    K S E     SLAT + +IP   D+ +R
Sbjct: 349  KKLSKQNQPSSSS------SQESLNTESANKEKFSLEPTLITSLATLDISIPVNKDQTKR 402

Query: 1723 ILENSIRSAESFDNICVLLSKSKL-EVENYLNEL 1821
             +E      + F+   + +++  + +V+N + ++
Sbjct: 403  TIEELREKLKDFEKRQIEVTEKNINKVQNQIEKM 436

>KAFR0A02290 Chr1 (477162..479234) [2073 bp, 690 aa] {ON} Anc_2.591
            YMR032W
          Length = 690

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 3/87 (3%)
 Frame = +1

Query: 1537 DDRSLKKKNQDASFSVVGSKNSGQPNNVKSERPSKVSFEMQRAGSLATGEATIPKLSDEE 1716
            +D+  K     AS S     +S  P +  S  P K SFE     S+AT  +++    D++
Sbjct: 435  EDKPTKLSGHPASSSSSSGSSSSNPTDFTSNIPKKQSFE-----SMATSVSSMANTIDDK 489

Query: 1717 ERILE---NSIRSAESFDNICVLLSKS 1788
            +R  +   ++ R  +S  NI  L   S
Sbjct: 490  QRFAKSWNSTNRKRKSMSNISSLTGNS 516

>TPHA0E03690 Chr5 (781473..783926) [2454 bp, 817 aa] {ON} Anc_1.45
            YCL030C
          Length = 817

 Score = 32.7 bits (73), Expect = 3.7
 Identities = 40/130 (30%), Positives = 54/130 (41%), Gaps = 2/130 (1%)
 Frame = +1

Query: 634  SECLIPIDEGNAVDIKIFPLLRPPTTCVSLEDVPLSSVNL--KKIIDVNWDPTMMSIVPY 807
            SE L+  DE    D     LL      V  + V L  VNL  KKI++V            
Sbjct: 614  SEVLVVCDENADADFVASDLLSQAEHGVDSQ-VILVGVNLSEKKILEVQ----------- 661

Query: 808  IDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQL 987
             D ++  A  ++L R D  +V +CI H     C +  + F  SN YAP  LI       L
Sbjct: 662  -DAVDRQA--NELPRVD--IVRKCIAHSTIILCESYEEAFGMSNKYAPEHLI-------L 709

Query: 988  MASDCQSYVA 1017
               + Q YV+
Sbjct: 710  QIENAQKYVS 719

>TDEL0A06110 Chr1 (1069675..1070355,1070357..1071382) [1707 bp, 568
            aa] {ON} Anc_8.665 YOR239W Ribosomal frameshifting
          Length = 568

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1597 NSGQPNNVKSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVL 1776
            ++G+PN+VK E+    SFE       ++G A        EE I E S+ +      I V 
Sbjct: 25   SAGKPNSVKDEKNEAGSFEEAYKPQESSGPAAQDVQETTEEPIAEVSVPAEHDKSEIKVE 84

Query: 1777 LS--KSKLEVENYLNELGEFKVINS 1845
             S  KS  +VE   +E+ E K +++
Sbjct: 85   KSDEKSDTKVEETSSEVKEAKELSA 109

>Kpol_2001.55 s2001 complement(149236..151980) [2745 bp, 914 aa] {ON}
            complement(149236..151980) [2745 nt, 915 aa]
          Length = 914

 Score = 32.3 bits (72), Expect = 4.9
 Identities = 36/131 (27%), Positives = 56/131 (42%), Gaps = 3/131 (2%)
 Frame = +1

Query: 1246 SLSSSNLRANDNRNRFLPTRSCLFDLYR---SLSQGRTLKSWYESKHAILKENNIDVRRF 1416
            S S+SN +   N  +    +  LFD  R   + S+GRTL + YE+  A L +  + V  F
Sbjct: 117  SRSNSNNKKTSNFKKVFKDK--LFDNSRRSSASSEGRTLFNTYEAFVANLTQEKLKVDDF 174

Query: 1417 ITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSK 1596
                LE R   +   F  ++    +E   +T     +S  DD S+   N     SV+ + 
Sbjct: 175  YK-RLESRFFEK---FDTLIKDLEKEGIILTHQRSFESATDDLSINNINNQKQLSVIRTN 230

Query: 1597 NSGQPNNVKSE 1629
                 N+  SE
Sbjct: 231  ELESRNDFYSE 241

>Skud_12.47 Chr12 (92122..96921) [4800 bp, 1599 aa] {ON} YLL021W
            (REAL)
          Length = 1599

 Score = 32.3 bits (72), Expect = 5.2
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +1

Query: 1480 VDSRERKEMTRMILKDSLNDD--RSLKKKNQDASFSVVGSKNSGQPNNVKSERPSKVSFE 1653
            VD  +  + T M LK ++  +  +S KKKN D    ++    +  P +VK E P  + F+
Sbjct: 771  VDDDDDDDFTYMALKQTMKREGSKSEKKKNSDLPARIIEIDFNESPESVKIESPESMKFQ 830

>TDEL0C06570 Chr3 (1206296..1208728) [2433 bp, 810 aa] {ON} Anc_1.45
            YCL030C
          Length = 810

 Score = 32.0 bits (71), Expect = 6.3
 Identities = 41/129 (31%), Positives = 52/129 (40%), Gaps = 2/129 (1%)
 Frame = +1

Query: 634  SECLIPIDEGNAVDIKIFPLLRPPTTCVSLEDVPLSSVNL--KKIIDVNWDPTMMSIVPY 807
            SE L+  DE   VD     LL      +  + V L  VNL  KKI  V            
Sbjct: 607  SEVLVICDEDADVDFVASDLLSQAEHGIDSQ-VILLGVNLSDKKIQQVQ----------- 654

Query: 808  IDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQL 987
             D ++  A   KL R D  +V +CI H     C +  + F  SN YAP  LI       L
Sbjct: 655  -DAVHEQAV--KLPRVD--IVRKCIAHSAIITCGSYEEAFDISNQYAPEHLI-------L 702

Query: 988  MASDCQSYV 1014
              ++ Q YV
Sbjct: 703  QITNAQDYV 711

>ZYRO0F17578g Chr6 (1461181..1463613) [2433 bp, 810 aa] {ON} highly
           similar to uniprot|P00815 Saccharomyces cerevisiae
           YCL030C
          Length = 810

 Score = 32.0 bits (71), Expect = 6.3
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +1

Query: 841 KLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI 963
           +L R D  +V++CI H     C +  + F+ SN YAP  LI
Sbjct: 663 QLPRKD--IVVKCIAHSAIILCGSYDEAFKISNQYAPEHLI 701

>Suva_7.32 Chr7 (64195..67071) [2877 bp, 958 aa] {ON} YGL227W (REAL)
          Length = 958

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 4/67 (5%)
 Frame = +1

Query: 1471 MLNVDSRERKEMTRMILKDSLNDDRSLK---KKNQDASFSVVGSKNS-GQPNNVKSERPS 1638
            +L+V S E  E + +++   L ++  ++   KKN   S SV GS +S G  NN  S RP+
Sbjct: 407  VLSVTSTESAENSNIVVGYKLVENELMETNIKKNASRS-SVTGSNSSLGGGNNASSNRPT 465

Query: 1639 KVSFEMQ 1659
              SF M+
Sbjct: 466  SNSFTME 472

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score = 32.0 bits (71), Expect = 6.5
 Identities = 19/46 (41%), Positives = 26/46 (56%)
 Frame = +1

Query: 1678 TGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYLN 1815
            T +AT  KLSDE+  +L  S+ S       CV L + K+ +ENY N
Sbjct: 695  TLKATTEKLSDEDSLLLLQSVAS-------CVKLEQEKMILENYSN 733

>SAKL0A07304g Chr1 complement(646374..647789) [1416 bp, 471 aa] {ON}
            similar to uniprot|P53172 Saccharomyces cerevisiae
            YGL056C SDS23 Spindle pole body protein and similar to
            YBR214W uniprot|P38314 Saccharomyces cerevisiae YBR214W
            SDS24 Nuclear protein with similarity to S. pombe Sds23,
            suppresses dis2 mutations
          Length = 471

 Score = 31.6 bits (70), Expect = 7.4
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 919  DIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADRDSPS 1092
            D F   ++Y  SSL RT L   +     + ++  P+ S ++S P+S N +SA    PS
Sbjct: 342  DSFPIFHVYPTSSLART-LAKIVATKAHRLWIVQPDSSAVTSSPVSSNSNSASASDPS 398

>NDAI0A01750 Chr1 (388587..390008) [1422 bp, 473 aa] {ON} Anc_7.374
            YBL056W
          Length = 473

 Score = 31.6 bits (70), Expect = 7.4
 Identities = 40/164 (24%), Positives = 65/164 (39%), Gaps = 2/164 (1%)
 Frame = +1

Query: 1333 LSQGRTLKSWYESKHAILKENNIDVRRFITFGLERRIIYRCYSFPVMLNV--DSRERKEM 1506
            L+ G ++  W+E   A  K++N      I+F L+R++IY  Y FP   +   D   +K  
Sbjct: 294  LNDGESVNDWFERVRA--KKHNTP----ISFELKRKVIYNYYEFPTDESAIFDITTKKPQ 347

Query: 1507 TRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNVKSERPSKVSFEMQRAGSLATGE 1686
             R     + N  R       D       +   G  N   +++P + +    R G      
Sbjct: 348  ERFTQDSNNNAHRHNYHDEDDMEIDETDADADGD-NEGSNDKPKRAT---DRNG------ 397

Query: 1687 ATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYLNE 1818
              I  LS   E +L   I+     DNI  +   +  EV N L++
Sbjct: 398  -PIDLLS--LEALLGAGIQVQSGPDNISYIAGNALSEVLNSLSK 438

>Kwal_14.1695 s14 (426641..427486) [846 bp, 281 aa] {ON} YBR231C
            (AOR1) - Actin Overexpression Resistant [contig 237] FULL
          Length = 281

 Score = 31.2 bits (69), Expect = 8.0
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +1

Query: 1525 DSLNDDRSLKKKNQDASFSVVGSKNSGQPNNVKSERPSKVSFEMQRAGSLATGEATIPKL 1704
            D L ++ S + +    S S++G  + GQP N   E    +S + + AG +   +  +PK 
Sbjct: 106  DELQEESSRRLRE---SSSIMGEAD-GQPRNGLQEEQILISRKYEFAGEVMQEKKWVPKS 161

Query: 1705 SDEEERILENS 1737
            S E +  L+NS
Sbjct: 162  SAEAQEYLKNS 172

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
            similar to uniprot|P38237 Saccharomyces cerevisiae
            YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 31.6 bits (70), Expect = 8.2
 Identities = 24/123 (19%), Positives = 51/123 (41%), Gaps = 24/123 (19%)
 Frame = +1

Query: 781  PTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLS----------DIFQ 930
            P++  + P  +  + + K+    + +P++  + IR   + KC+  S          D  +
Sbjct: 366  PSLNVVYPANNLKSQLTKLRTALKEEPTIYKQGIRPKSFKKCIGGSHEEFSSGRQQDALE 425

Query: 931  F--------------SNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLD 1068
            F              ++ Y P+ L++  + D+L   +C       E S +  LPL ++ D
Sbjct: 426  FFTYFVDELDKKLFKNSDYNPNDLMKFMMEDRLQCQECHGVKYSTETSNVIQLPLQESND 485

Query: 1069 SAD 1077
            + D
Sbjct: 486  AQD 488

>KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}
           Anc_1.45 YCL030C
          Length = 780

 Score = 31.6 bits (70), Expect = 8.2
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +1

Query: 808 IDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI 963
           ID +        L+     +V +CI H    KC +  + F  SN YAP  LI
Sbjct: 620 IDEIQRAVHEQALALPRVEIVRKCISHSTIIKCDSYEEAFDMSNQYAPEHLI 671

>Smik_11.316 Chr11 complement(525589..537861) [12273 bp, 4090 aa] {ON}
            YKR054C (REAL)
          Length = 4090

 Score = 31.6 bits (70), Expect = 9.2
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +1

Query: 598  LLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNW 777
            +  ++ Q++ N ++    ++E  +V   + P L PP     LE    S + LKK ID   
Sbjct: 1146 IAQKLEQEVKNINDLSQSLNESWSVRKPVSPTLTPPEALKILESFSDSVIKLKKKIDSIS 1205

Query: 778  DPTMMSIVPYI--DGLNSIAK 834
            +   M ++P +  D L  IA+
Sbjct: 1206 NAAKMLLIPIVLNDQLAHIAE 1226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 168,230,763
Number of extensions: 3724351
Number of successful extensions: 11391
Number of sequences better than 10.0: 44
Number of HSP's gapped: 11345
Number of HSP's successfully gapped: 74
Length of query: 616
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 500
Effective length of database: 40,180,143
Effective search space: 20090071500
Effective search space used: 20090071500
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)