Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.276.17ON61561529070.0
YEL062W (NPR2)6.17ON61561524680.0
Smik_5.256.17ON61561524070.0
Suva_5.56.17ON61962023710.0
ZYRO0C07876g6.17ON68149614060.0
TDEL0G045206.17ON67949513930.0
CAGL0L13288g6.17ON64667113760.0
Kpol_1045.726.17ON69570013710.0
KNAG0M011406.17ON59462913061e-173
SAKL0E01100g6.17ON71057612991e-171
KLLA0D01067g6.17ON66068012901e-170
KAFR0L003806.17ON54061712741e-169
TBLA0G010106.17ON71050912601e-165
Ecym_30216.17ON67450912531e-164
Kwal_56.224116.17ON68955812291e-160
TPHA0J003106.17ON67568112171e-159
ACR009W6.17ON68050012021e-156
KLTH0C11308g6.17ON69054812011e-156
NCAS0H008706.17ON61235610661e-137
NDAI0D008606.17ON6664557761e-93
TPHA0E036901.45ON817131742.3
KAFR0B035108.779ON623175732.9
ZYRO0F17578g1.45ON81041733.2
TDEL0C065701.45ON810129733.6
Skud_4.4908.450ON46194715.5
SAKL0H21450g4.93ON37494705.6
KNAG0C005101.45ON78033708.5
CAGL0H10186g3.270ON778132698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.27
         (615 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)  1124   0.0  
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   955   0.0  
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   931   0.0  
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    917   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   546   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   541   0.0  
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   534   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   532   0.0  
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   507   e-173
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   504   e-171
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   501   e-170
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   495   e-169
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   489   e-165
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   487   e-164
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   478   e-160
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   473   e-159
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   467   e-156
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   467   e-156
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   415   e-137
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   303   1e-93
TPHA0E03690 Chr5 (781473..783926) [2454 bp, 817 aa] {ON} Anc_1.4...    33   2.3  
KAFR0B03510 Chr2 complement(729872..731743) [1872 bp, 623 aa] {O...    33   2.9  
ZYRO0F17578g Chr6 (1461181..1463613) [2433 bp, 810 aa] {ON} high...    33   3.2  
TDEL0C06570 Chr3 (1206296..1208728) [2433 bp, 810 aa] {ON} Anc_1...    33   3.6  
Skud_4.490 Chr4 (878956..880341) [1386 bp, 461 aa] {ON} YDR229W ...    32   5.5  
SAKL0H21450g Chr8 complement(1877976..1879100) [1125 bp, 374 aa]...    32   5.6  
KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}...    32   8.5  
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    31   8.9  

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/615 (90%), Positives = 559/615 (90%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           QNQLLSKSEKDAVFFDLKALENSTITPSTAGA                 DKDAKDLRSSR
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
           LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360
           KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360

Query: 361 DSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSS 420
           DSPSLFV        IPSNPDSRTT                    VCKDWRQSQTSLSSS
Sbjct: 361 DSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSSS 420

Query: 421 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 480
           NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR
Sbjct: 421 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 480

Query: 481 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 540
           IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV
Sbjct: 481 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 540

Query: 541 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 600
           KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV
Sbjct: 541 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 600

Query: 601 ENYLNELGEFKVINS 615
           ENYLNELGEFKVINS
Sbjct: 601 ENYLNELGEFKVINS 615

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/615 (77%), Positives = 513/615 (83%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNT KNYIIPKPILCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           QNQLLSKSE+D VFFDLK LENST TPSTAG                  +KD KD+RSSR
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y+DL KDLGLP+S+FSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
           LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLS SDP LVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360
           KCVTLSDIFQFSNIYAPSSLIR FLTD LMASDCQSYV FPE+SK+S+LPL+K+L S D+
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360

Query: 361 DSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSS 420
           DSPS  V        IPSNPDSRTT                    + KDWRQSQTS SSS
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSS 420

Query: 421 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 480
           N+   +NRNRFLPTRSCLFDLYRSLSQG+TLK+WYESK+ ILKENNID+RRFITFGLE+R
Sbjct: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480

Query: 481 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 540
           IIYRCYSFPVM+N  SRE KEMT +I KD +N+D+ L+K+N +   S  GS+N+ Q  N+
Sbjct: 481 IIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNL 540

Query: 541 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 600
           K ERPSKVSFEMQR  SLATG++T+PKLSDEEE ILE SIR+AE+FD ICVLLSK KLEV
Sbjct: 541 KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV 600

Query: 601 ENYLNELGEFKVINS 615
           E+YLNELGEFKVINS
Sbjct: 601 ESYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/615 (76%), Positives = 507/615 (82%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKP+LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           QNQLLSKSEKD VFFDLKALENSTI PSTA                   DKDAKDLR+SR
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           YNDL KD  LPES+FSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
           LEDVPLSSVNL+KIIDVNWDPTMM+IVPYIDGLNSIAKISKLS SDPSLVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360
           KCVTLSDIFQFSNIYAPSS IR FLTD LMA+DCQ YV FPE+SK+SSLPL+KNL S D 
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 361 DSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSS 420
           DSPS  V        IPSNP SRTT                      +DWRQSQTS SSS
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSSS 420

Query: 421 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 480
           N+  ++NRNRFLPTRSCLFDLYRSLSQG+TLK+WYESK+ I+K+NNID+RRFITFGLE+R
Sbjct: 421 NIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480

Query: 481 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 540
           IIYR YS+PVML+V  RE KE   +I KDS N+  S +KK  + SFS++ SKN+   NN+
Sbjct: 481 IIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFNNI 540

Query: 541 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 600
           KS RPSKVSF+MQ+A SL TGE+TIPKLSD+EERILE S+RSAE+FD ICVLL K KLEV
Sbjct: 541 KSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEV 600

Query: 601 ENYLNELGEFKVINS 615
           ENYLNELGEFK+INS
Sbjct: 601 ENYLNELGEFKIINS 615

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/620 (76%), Positives = 509/620 (82%), Gaps = 6/620 (0%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLK+HGINFNTIKNYIIPKPILCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           QNQLLSKSE+D VFFDLKA+ENS +TPSTAG                  DKDAKDLRS+R
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 181 -----YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235
                YND+ KDLGLPES+FSIQDLLMRIFQDLNNYSECLIPID+GNAVDIKIFPLLRPP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 236 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIR 295
           TTCVSLEDVPLSSVNLKKIIDVNWDPTMM IVPYIDGLNSIAKISK S SDPSLVIECIR
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 296 HLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNL 355
           HLIYYKCVTLSDIFQFSNIYAPSSLIR FLTD LMA+DCQSYV FPEISK+S+LPL+KN 
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360

Query: 356 DSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQT 415
           DS D+D  S  V        +PSNP+SRTT                    V KDWRQSQT
Sbjct: 361 DSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQT 420

Query: 416 SLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITF 475
           S SS+N  A   RN+FLPTRSCLFDLYRSLSQG+TLKSWYE K   LKENNID+RRFITF
Sbjct: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480

Query: 476 GLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSG 535
           GLER IIYRCYSFPVM++V SR+ KEMT +  K+  N+D SLKK++ + S SV GSK++ 
Sbjct: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540

Query: 536 QPNNVKSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSK 595
           Q  NVKSERPSKVSFEMQRA SLATG+  IPKLSDEE++ILE SIRSAE+FD ICVLL K
Sbjct: 541 Q-TNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599

Query: 596 SKLEVENYLNELGEFKVINS 615
           SK EVENYL+ELGEFKVINS
Sbjct: 600 SKQEVENYLSELGEFKVINS 619

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/496 (54%), Positives = 339/496 (68%), Gaps = 30/496 (6%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+ IKNYIIPKP LCHKL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           QNQ+LSK+E D ++FD K  +N+T       A                    ++ +  ++
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTK-----------SQGMALAK 183

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           YN++ KDL   +S FS+QDL+MRIFQDLNNYSECLIPIDEGNAVDIKIFPL  PP +C+S
Sbjct: 184 YNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCIS 243

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
           +EDVP+S+VNLK IIDVNWDPTM+ IVPYIDGLNSI+KI+KLS SD SLV+EC++HL+YY
Sbjct: 244 IEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYY 303

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK----NLD 356
            CV L+DIFQFSNIYAP+SLIR FLTD  +AS+CQS+V     S +S +P  +    +LD
Sbjct: 304 NCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLD 363

Query: 357 SADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQ-SQT 415
             D+                     SRTT                        + Q SQ+
Sbjct: 364 DMDQSK--------------NQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQS 409

Query: 416 SLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITF 475
           S SS+N     +  R LPT++CLFDLYR+LSQG T++ WY   +  +K+N+IDVRRFITF
Sbjct: 410 SFSSTNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITF 469

Query: 476 GLERRIIYRCYSFPVM 491
           G+ + +IYRC+SFPVM
Sbjct: 470 GVIKGLIYRCFSFPVM 485

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 14/109 (12%)

Query: 519 KKNQDASFSVVGSKNSGQPNNVKSERPSKVSFEM------------QRAGSLATGEATIP 566
           ++    S S +   N   P   K ER SKV+F+M            Q+  +     A + 
Sbjct: 575 REESHVSLSALSGDNVSHPK--KPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLD 632

Query: 567 KLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615
           +  + ++ IL  SI +A+  D ICV L K + EVE  L+ELG++K+INS
Sbjct: 633 RAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/495 (52%), Positives = 337/495 (68%), Gaps = 11/495 (2%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL++H INF+ IKNYIIPKP LCHKL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           QN +LSK+EKD +F+  K +E      + +                      ++   S +
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSK-----------SQAYASEK 169

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y+ +  D+   +S+FS++DL++R++QDLNNYSECLIPIDEGNAVDIKIFP++ PP + +S
Sbjct: 170 YHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNIS 229

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
           +EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+KLS SDP LVIECI+HLIYY
Sbjct: 230 IEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYY 289

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360
            CV L+DIFQFSNIYAP+S +RTFLTD +++++CQSYV   E S +  LP  +   SA  
Sbjct: 290 NCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATE 349

Query: 361 DSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSS 420
                            S   S ++                    + +  + SQ+S SS+
Sbjct: 350 SVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSN 409

Query: 421 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 480
           N   ++   R+LPT+SCLFDLYRSLSQG +L+ WY   +  ++ N IDVRRFITFG+   
Sbjct: 410 NTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVING 469

Query: 481 IIYRCYSFPVMLNVD 495
           +IYRCYS+P+M N++
Sbjct: 470 LIYRCYSYPIMKNLE 484

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 15/102 (14%)

Query: 529 VGSKNSGQPNNV----KSERPSKVSFEMQRA-GSLATG-EATIPKLSDEEERILE----- 577
           +GS   G  NN+     S+RPSKVSF+ Q+  G ++ G  ++  K+  +EE  LE     
Sbjct: 578 LGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRERD 637

Query: 578 ----NSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615
                S+ +A+S D ICV L  S+ +VE  +  LGE+K+INS
Sbjct: 638 LILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/671 (46%), Positives = 406/671 (60%), Gaps = 83/671 (12%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L+N GINF++IKNY+IPK  LCH+L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYG YRI CYPVT+NS IYAR           P++CETSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QNQLLSKSEKDAVFFDLK-ALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSS 179
           QNQ+LSKSE D + F+LK A +N  I   ++                       KD +  
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTT-------QQKD-KYE 172

Query: 180 RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCV 239
           R N++  ++    S+F+I DLLMR++QDLN YSECLIPID+GNAVDIK+FPLL PPT  +
Sbjct: 173 RLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYI 232

Query: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIY 299
           S+E VP+S VNL KI+DVNWDP M++I+PYI+G+N+I +IS+LS ++ SLVIECIRHL+Y
Sbjct: 233 SIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVY 292

Query: 300 YKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPL-------- 351
           Y+C+ L+DIF+FSN+YAP+S +R FL D  MA++CQSYV  P  SKM+ L L        
Sbjct: 293 YRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHS 352

Query: 352 SKNLDSADRD---SPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCK 408
           + N D   R+   S SL+           S P SR++                      K
Sbjct: 353 AFNGDIGSRNNSVSTSLYSFNGND-----SRPQSRSS------------SVDQSQTNFYK 395

Query: 409 DWRQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNID 468
           + +QS++S+S+ N     N ++ LPTRS LFDLYRSLSQG TLK WY   H I+++N ID
Sbjct: 396 NKKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRID 455

Query: 469 VRRFITFGLERRIIYRCYSFPVMLNVD---------------SRERKEMTRMILKDSLND 513
           VRRFITFG+ RRIIYRC ++ V+ + D               S E     +    DSL  
Sbjct: 456 VRRFITFGVLRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAA 515

Query: 514 DRSLKKKNQDASFSVVGSKNSGQPNNV--------------------KSERPSKVSFEMQ 553
           D +L    +  S   V SK + + +N                     +++R SKVSFE  
Sbjct: 516 DEALMNAYKKLSLK-VPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEAL 574

Query: 554 -------RAGS---LATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENY 603
                  R GS       E T  KLS  + RI+  ++  AE+ D ICVLL   +  V N 
Sbjct: 575 PEDRNGFRWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNI 634

Query: 604 LNELGEFKVIN 614
           L+ELGE K+IN
Sbjct: 635 LHELGELKLIN 645

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/700 (44%), Positives = 402/700 (57%), Gaps = 97/700 (13%)

Query: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLITFK 64
           F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL N+ INF++I++Y+IPKP LC+KL+T K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQNQL 124
           YG YRI+ YP+TIN  IYAR           PY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKSEKDAVFFDLKAL------ENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRS 178
           LSK+EKD  +FD KA+      ++S + P    +                        ++
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 179 S-----RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR 233
           S     +Y ++ + +   ES FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 234 PPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIEC 293
           PP   +S+EDVP+S VNLK+IIDVNWDPTM+ IVP+IDG+NSIAKI+KLS SD  LVIEC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 294 IRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK 353
           I+H IYY CV +SDIFQFSNIYAP+SL+R FLTD LMA++CQ+YV  PE S +  LPL  
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 354 ----NLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKD 409
                LDS   DS +L            S   SR                      +  +
Sbjct: 364 LSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGA------SSHNENSSLYSRSDLYLN 417

Query: 410 WRQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDV 469
             +S++S+SS N    +   + LPTRS LFDLYRSLSQG TLK WY+     ++ N ID+
Sbjct: 418 RHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDI 477

Query: 470 RRFITFGLERRIIYRCYSFPVMLNV----------DSRERKEMTRMILKDSLNDD----- 514
           R+FI FG+   ++YRC SFPV  N           D + RKE  +  L+  L+ D     
Sbjct: 478 RKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTS 537

Query: 515 ----------------------------------RSLKKKNQDASFSVVGSK-------- 532
                                              +LK + +++S   + S+        
Sbjct: 538 DIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQ 597

Query: 533 ---NSGQPNNVKSERP---SKVSFE----MQRAGSLATGEAT-------IPKLSDEEERI 575
               S  P +   +RP   SKVSF+    MQ + S  +G+ T       + KL  + E+I
Sbjct: 598 SLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSAS--SGDVTENEDINNLEKLRKQNEQI 655

Query: 576 LENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615
           L  ++ S E+ D ICVLL K + EVE  L  L +FKVINS
Sbjct: 656 LLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  507 bits (1306), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 284/629 (45%), Positives = 377/629 (59%), Gaps = 51/629 (8%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+++ INF+ IKNYIIPKP LCH+L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KYG YRIV YPV + S  YAR           PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           Q+Q+LS++E+D   F    L       ++A                   DK  +      
Sbjct: 121 QSQVLSRAERDDSLFKGDKLP---FDNNSAKNQAPLTHALISKTKSFSPDKKTEG----- 172

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239
                 D+ L     S+QDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL+ PPT+  +
Sbjct: 173 ------DIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHL 222

Query: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIY 299
           S+EDVP+  V LKKIID+NWDPTM+SI+P+I+G+NSI  I++LS SDP LVIECI+HLIY
Sbjct: 223 SIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIY 282

Query: 300 YKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSAD 359
           YKCV ++DIFQFSNIYAPSSLI  FLTD  MA DCQ YV  P+ S++  +PL  ++  + 
Sbjct: 283 YKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSR 342

Query: 360 RDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSS 419
            +                SN  S T                       K  ++S++SLSS
Sbjct: 343 NNKHK------------KSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNK--KRSESSLSS 388

Query: 420 SNLRA---NDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFG 476
                   +D+   + PTR  LFDLYRSLSQG TL+ WY +    ++ N IDVR+FI FG
Sbjct: 389 EGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFG 448

Query: 477 LERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQ 536
             ++IIYR  S+PV+     + R  +    +  S   +++   KN   S S +   +  +
Sbjct: 449 TIKKIIYRVLSYPVL----EKRRNSIIAKQMGKSKMAEKAPHSKNAFFSTSDIKFDDGDR 504

Query: 537 PNNVKSERPSKVSFEMQR-----------AGSLATGEATIPKLSDEEERILENSIRSAES 585
             N    R SKVSFE +R            G     +     L+ EE+  L  ++ + ES
Sbjct: 505 LFNSLYARFSKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLES 564

Query: 586 FDNICVLLSKSKLEVENYLNELGEFKVIN 614
           FD ICV L +S++E+ N + ++GE++VIN
Sbjct: 565 FDKICVQLGRSRVEIANLIADIGEYRVIN 593

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  504 bits (1299), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 272/576 (47%), Positives = 364/576 (63%), Gaps = 37/576 (6%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+N+ INF+TIKNY+IPKP LC+KL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG YR+ CYPV +N+  YAR           PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTIT---PSTAGAXXXXXXXXXXXXXXXXXDK------ 171
           Q+Q+LSK+E D V+F LK+ E+ST +   P   G                  D       
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 172 DAKDLRSSRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPL 231
           + +     +Y+++  DL   +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 232 LRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVI 291
           L PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+K S SD  LVI
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 292 ECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPL 351
           EC++HLIYY CV L+DIFQFSNIYA +SLI  FLTD  +AS+CQ+YV   ++ ++  LP 
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDL-ELYRLPF 359

Query: 352 SK--NLDS--ADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVC 407
               NL S  + R   S            P+  +S                         
Sbjct: 360 ESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMRV 419

Query: 408 KDWRQSQTSLSSSNLRANDNRNR-FLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENN 466
           +D R  Q++  S+    ++  +R  LPT+SCLFDLYRSL QG T+K WY+    I+++N+
Sbjct: 420 RD-RSGQSTTGSA---VDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNH 475

Query: 467 IDVRRFITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKK---NQD 523
           IDVRRFITFG+ R +IYRCY++PVM N+ +    EM + +   S +D RSL++K    + 
Sbjct: 476 IDVRRFITFGIVRGLIYRCYAYPVMKNLGAL---EMLKTL--KSASDSRSLRRKLKFREK 530

Query: 524 ASFSVVGSKNSGQPNNVKSERPSKVSFEMQRAGSLA 559
            +F+          NNV S    KV  E    G+ A
Sbjct: 531 KNFT----------NNVFSTADIKVDLEHSPGGAPA 556

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 51/95 (53%), Gaps = 10/95 (10%)

Query: 530 GSKNSGQPNNVKSERPSKVSFEMQRAGSLATGE---------ATIPKLSDEEERILENSI 580
           GS+  G  + ++SE  SKV+FE  R+      +         + + K    EE +L  S+
Sbjct: 617 GSR-KGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVSNLLKEKRHEEFLLLKSV 675

Query: 581 RSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615
           +S ++FD IC+ L K + EVE  L E+G + +INS
Sbjct: 676 KSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  501 bits (1290), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 286/680 (42%), Positives = 386/680 (56%), Gaps = 85/680 (12%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L+N  I+F+TIKNYIIPKP LC+KL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG YRIVCYPV +N+  YAR           PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           Q+Q+LSKSE++ V+F LK+ +++    ST                    D  +      +
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHT---------DIKSTGDDGEK 171

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y ++ K+L   + S  I+DLLM++F DLNNYSECLIPIDEGN++DIK+FP+  PP++ +S
Sbjct: 172 YLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNIS 231

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
           +EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  +RSD  LV ECI+HL+YY
Sbjct: 232 VEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYY 291

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLS---KNLDS 357
            CV LSDIFQFSNIYAP+S I  FLT+  +A  CQ +V    + K S LP      N+  
Sbjct: 292 NCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSL-KQSLLPFEGRPNNIYP 350

Query: 358 ADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSL 417
             R   S                DS  T                        + ++  S 
Sbjct: 351 TGRKQASTSTVHSRRR-------DSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASE 403

Query: 418 SSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGL 477
           ++S     +   R LPTRSCLFDLY+SLSQG+T+K WY+    I+++N IDVR+ I FG+
Sbjct: 404 NTSLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGI 463

Query: 478 ERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKN--QDASFSVVGSKNSG 535
            RR+IYR  S+P++ NV + +   +  ++ K+      S   KN    A   VV +K  G
Sbjct: 464 TRRLIYRVNSYPIVKNVGTWDI--LKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEG 521

Query: 536 -----------------QPNNVKSERPS-------------------------------- 546
                            Q  ++K + P+                                
Sbjct: 522 NQSDKLDAADELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQ 581

Query: 547 KVSFEMQRAGSLATGEATIPKLSDEEER-----------ILENSIRSAESFDNICVLLSK 595
           KVSF+   AG   T    +P L D E+            IL  S+ +AE+FD +C  L K
Sbjct: 582 KVSFDFGTAGQQKT-VTEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKK 640

Query: 596 SKLEVENYLNELGEFKVINS 615
           S+ EVE  L +LG + ++NS
Sbjct: 641 SRHEVELLLKDLGHYNIVNS 660

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  495 bits (1274), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 275/617 (44%), Positives = 368/617 (59%), Gaps = 79/617 (12%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+ + INF++IKN++IPKP LCH+L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T +Y  YR+V YPV ++S  YAR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           Q+Q+LSKS++ + FF                                   KD +D+    
Sbjct: 121 QSQILSKSQRTSAFF-----------------------------------KDGEDV---- 141

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239
                      ++ FSIQDLLMR++QDLNNYSECLIPIDEGN ++IKIFP+L+PPT+  +
Sbjct: 142 --------DFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQI 193

Query: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIY 299
           S+EDVPLS VNL KI+D+NWDPTM+SI+P+IDG+NSI  IS LS SDP+LVIECI+HLIY
Sbjct: 194 SIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIY 253

Query: 300 YKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSAD 359
           Y CV ++DIFQFSNIYAPSSLI  FL D ++A +CQSYV  P  SK++ LPL+   D   
Sbjct: 254 YNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEI 313

Query: 360 RDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSS 419
            +S                      +                          QS ++LSS
Sbjct: 314 NNS---------------DMTQKALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSS 358

Query: 420 SNLRANDNR-NRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLE 478
           S  + ++ R  + LP++  LFDLYRSL+ G T+++WY+   + +KEN+IDVR+FI FG+ 
Sbjct: 359 SEGQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVI 418

Query: 479 RRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPN 538
            +IIYR + +P+M      E K     +L D  ND   L     D  F V       +  
Sbjct: 419 NKIIYRVHQYPIM------EHKTFKSPLLSDRQNDKIVL--STSDIKFDV-----GDRIL 465

Query: 539 NVKSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKL 598
           N    + SKV+F+  +      G +    L + E+ IL N++   ESFD IC  L KSK 
Sbjct: 466 NSIYNKLSKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICSKLGKSKN 523

Query: 599 EVENYLNELGEFKVINS 615
           EVE+ ++E+GE+  INS
Sbjct: 524 EVESIISEIGEYMTINS 540

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  489 bits (1260), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 260/509 (51%), Positives = 330/509 (64%), Gaps = 56/509 (11%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M  +F+GFVPIHT+FYS+FHPTEG+K++YEFPP NL+ + INF+TIKNYIIPKP LCHKL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KYG YR+V YPVTINS +YAR           P +CETSPYEP I RLGKMF+VLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QNQLLSKSEKDAVFFD----LKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDL 176
           QNQLLS++E D+V+FD    L + E  +I                        DK+   L
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIM---------------------HQDKNTSIL 159

Query: 177 RSSR----YNDLTKDLGLPE-------SSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVD 225
             SR    ++    DL L E       S+FS+QDL+MRIFQDLNNYSECLIPIDEGN+VD
Sbjct: 160 GFSRKRFSFSKRPTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVD 219

Query: 226 IKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRS 285
           IKIFP + PP+  +S EDVP++ V+L  ++DVNWDPTM+ IVP+ID +NSI++I+ LS S
Sbjct: 220 IKIFPSMVPPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNS 279

Query: 286 DPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISK 345
           D   V+ECIRHL+YY+ V LSDIFQF+NIYAP+S +R FLTD  +A+DCQ+YV  P+ S 
Sbjct: 280 DVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSN 339

Query: 346 MSSLPLSKNLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXX 405
              LPL K++++ D D  S           I  N D                        
Sbjct: 340 FGKLPLEKSINT-DLDEYSNSGSAIYPNNEILENDDRLRWPMYYKP-------------- 384

Query: 406 VCKDWRQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKEN 465
                R SQ+SLSS     N+  + +LPT+SCLFDLYRSLSQG  L  WY   ++++  N
Sbjct: 385 -----RNSQSSLSSGISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFN 439

Query: 466 NIDVRRFITFGLERRIIYRCYSFPVMLNV 494
            ID+RRFITFGL R ++YRCY+ P+M N 
Sbjct: 440 KIDIRRFITFGLVRGLLYRCYAIPIMKNA 468

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 29/41 (70%)

Query: 574 RILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 614
           R+L  S+R A++ D IC+ L K + EVE  L+E+G++ +IN
Sbjct: 669 RLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  487 bits (1253), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 241/509 (47%), Positives = 334/509 (65%), Gaps = 32/509 (6%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L+N GI+F+TIKNY+IPKP LC+KL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG+YR+VCYPV IN+  YAR           PYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QNQLLSKSEKDAVFF-----DLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKD 175
           Q+Q+LSK E+D +++     D+KA++ ++  P +                    +K    
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEK---- 176

Query: 176 LRSSRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235
                Y+++ K + + E   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP
Sbjct: 177 -----YHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPP 231

Query: 236 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIR 295
            +C S+EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK S SD  LV+EC++
Sbjct: 232 NSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVK 291

Query: 296 HLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNL 355
           HLIYY CV L D+FQFSNIYAP+S +  FLTD  +A +CQ YV   E S++  LP     
Sbjct: 292 HLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRP 351

Query: 356 DSADRDSPSL-FVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQ 414
           ++    +P+   +        I +NP   +                            S+
Sbjct: 352 NANHSRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSL----------PSE 401

Query: 415 TSLSSSNLRANDNR-------NRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNI 467
            S++ S+  +  N        NR LPTRSCLFDLYRSLSQG+T+K WY+    ++++N I
Sbjct: 402 PSITHSSKNSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRI 461

Query: 468 DVRRFITFGLERRIIYRCYSFPVMLNVDS 496
           DVRRFITFG+ R++IYRCYS+PV  ++ +
Sbjct: 462 DVRRFITFGVFRKLIYRCYSYPVAKSIGT 490

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 571 EEERILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615
           +++ +L  SI++ +SFD I + L  +K EVE  L   GE+ +INS
Sbjct: 630 QQQFLLLKSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  478 bits (1229), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 250/558 (44%), Positives = 334/558 (59%), Gaps = 30/558 (5%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M  +F GFVP+H I Y++FHPTEG+K++++FPP  L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG++R+VCYPV + +P YAR           PYDC TSPYE AI RLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           Q+Q+LSK+E   V+F LK  ++      T                      ++      +
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHK---HTNQEPVNDNELQGTLKNNEASQSESHGYAFEK 177

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y+++ KDL  P    S++DL+ +I++DLNNYSECLIPID GNAVDIK+FPLL PP++C+S
Sbjct: 178 YHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLS 237

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
            EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++KLS SD +LV+ECIRHL+YY
Sbjct: 238 FEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYY 297

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK------- 353
            CV L+DIFQF NIYAP+S +  FLT+  +A++CQ YV   E + +S LP  +       
Sbjct: 298 NCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTY 357

Query: 354 NLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQS 413
           N       S +L V        I    +S  T                     C +   S
Sbjct: 358 NNIPVRNSSSTLDVQRKGREMSI---KESSFTAGIDQSGRNQYTPQSHTSSIQCHNV--S 412

Query: 414 QTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFI 473
             SL +S      N   F  ++SCLFD+YRSLSQG+T+K WY++    ++   IDVRRFI
Sbjct: 413 DASLGNS--EGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFI 470

Query: 474 TFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKN 533
           TFG+   ++YRCYSFP+M NV   E  +   +   DS  + + L             S N
Sbjct: 471 TFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWL-------------SGN 517

Query: 534 SGQPNNVKSERPSKVSFE 551
           S   NNV S    ++  E
Sbjct: 518 SEPTNNVLSAAEIRIGLE 535

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 46/80 (57%), Gaps = 7/80 (8%)

Query: 542 SERPSKVSFEMQRAGSLATGE----ATIPKLSDE---EERILENSIRSAESFDNICVLLS 594
           S+  + V+F+++R  + AT E      + +L ++   +E +L  S+R  E+FD IC  L 
Sbjct: 609 SDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVENFDKICTRLG 668

Query: 595 KSKLEVENYLNELGEFKVIN 614
           + + EVE  L +LG + V++
Sbjct: 669 RDREEVEKMLEDLGPYNVVH 688

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  473 bits (1217), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 289/681 (42%), Positives = 391/681 (57%), Gaps = 74/681 (10%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M + F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+ IKNY+IPKP LCHKL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRIV YP+ INS +YAR           PY+CETSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QNQLLSKSEKDAVFFDLKAL-------------ENSTITPSTAGAXXXXXXXXXXXXXXX 167
           Q Q LSK EKD  +FD K +             +N+ ++ + +                 
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 168 XXDK-DAKDLRS--SRYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAV 224
             DK ++K++    S+YN +   +   +   S+ D+LMR+FQDLN+YSEC IPID+GNA+
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 225 DIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSR 284
           DIK+FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+ LS 
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 285 SDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEIS 344
           SD  LVIECIRH +YY CV LSDIFQFSNIYAP+S I  FLTD  +A++CQ YV  PE S
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 345 KMSSLPLSKNLDSADRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXX 404
            +S+LP  K          +           +  N +S+ +                   
Sbjct: 361 LLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYPNHD 420

Query: 405 XVCKD-WRQSQTSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILK 463
            + ++  R   +  S +N   + NRN +LPT+S LFDLYRSLSQG  L+ WY+     ++
Sbjct: 421 SIYENRRRSESSFSSGNNDEMHQNRN-YLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIR 479

Query: 464 ENNIDVRRFITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQD 523
           +N ID+RRFI FG+ +RIIYRC+S+P+  N ++  +       LK+  N  + +K K+Q 
Sbjct: 480 DNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLND----LKNLQNGPKIVKNKSQS 535

Query: 524 ASFSVVGSKN------------------------------------SGQPN---NVKSER 544
            ++++  + +                                    +G+P    N + + 
Sbjct: 536 YTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQH 595

Query: 545 PSKVSFEMQRAGSLATG-------EATIPKLSDE----EERILENSIRSAESFDNICVLL 593
           PSKV+F+ Q   +   G       EAT  K S E    ++  L ++++SAE+ DNIC  L
Sbjct: 596 PSKVAFKNQSYDNDLPGLMNNLGIEAT--KFSREININDKIYLLDALQSAENLDNICSNL 653

Query: 594 SKSKLEVENYLNELGEFKVIN 614
             S+ EVE  LNEL E+++IN
Sbjct: 654 ELSREEVETLLNELTEYRIIN 674

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  467 bits (1202), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 230/500 (46%), Positives = 319/500 (63%), Gaps = 14/500 (2%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M + F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+TIKNY+IPK  LC+KL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFK+G+YR+VCYPV I +P YAR           PYD  TSPYEPAI RL KM +VLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           Q+Q+LSK E+D V++ LK  E      + A                      A+   +++
Sbjct: 128 QSQMLSKVERDPVYYQLKTGE------TKAAEQKTEESDSKAKTHNLDKKSRAQHNATTK 181

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y+++ K +   E +  I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C+S
Sbjct: 182 YHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLS 241

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
            EDVP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S S   LV+ECI+HL+YY
Sbjct: 242 FEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYY 301

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSK--NLDSA 358
            CV L D+FQFSNIYAP++L+R FL D ++  +CQ YV   E  ++  LP     N   +
Sbjct: 302 DCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHS 361

Query: 359 DRDSPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLS 418
              + S             +  DS ++                      KD+  ++    
Sbjct: 362 RNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNR---- 417

Query: 419 SSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLE 478
           S NL +N  R   LPTR  LFDLYRSL+QG+TLK WY++ ++ ++EN IDVRR I FG+ 
Sbjct: 418 SRNLESNCKRT--LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVF 475

Query: 479 RRIIYRCYSFPVMLNVDSRE 498
            R+IYRCYS+PV  ++ + E
Sbjct: 476 HRLIYRCYSYPVAKSIGTLE 495

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  467 bits (1201), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 244/548 (44%), Positives = 338/548 (61%), Gaps = 21/548 (3%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60
           M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG +R+VCYPV + +P YAR           PYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSSR 180
           Q+Q+LSK+E  +V+F LKA  N+    +T  A                 +       S++
Sbjct: 121 QSQILSKAENSSVYFQLKA-RNTQKHGNTETAKGTEQPSSLDIGEIAQPENQG--YASAK 177

Query: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y ++ KDL  P    +I DL+ +I++DLN+YSECLIPID GNAVDIK+FPLL PP++C S
Sbjct: 178 YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFS 237

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300
           +EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++K S SD +LV+ECI+HLIYY
Sbjct: 238 IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297

Query: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPL----SKNLD 356
            CV L+DIFQFSNIYA ++ +  FLT+  +A++CQ YVA+ E + + +LP     S++  
Sbjct: 298 NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQ 357

Query: 357 SADRD-SPSLFVXXXXXXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQT 415
              RD S +  +         P   +S  +                       +   +  
Sbjct: 358 GNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASF 417

Query: 416 SLSSSNLRANDNRNRFLP--TRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFI 473
             S + L+      + +P  ++SCLFDLYRSL+QG+T++ WY++    ++   IDVRRFI
Sbjct: 418 GNSDAGLKG-----KLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFI 472

Query: 474 TFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQ------DASFS 527
           TFG+   +IYR YS+PV+ N+   E  E             + L K NQ       A+  
Sbjct: 473 TFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADI 532

Query: 528 VVGSKNSG 535
            +G +N+G
Sbjct: 533 RIGLENAG 540

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 52/87 (59%), Gaps = 11/87 (12%)

Query: 538 NNVKSERPSKVSFEMQRAGSLATGEATIPKLSD---------EEERILENSIRSAESFDN 588
           N++ S+  +KV+F++++  +LAT  A   + S+          EE IL  S+RS  +FD 
Sbjct: 606 NSMGSDIKNKVAFDVRK--TLATSSADERRRSEILRSIEEKRNEELILLKSVRSVHNFDK 663

Query: 589 ICVLLSKSKLEVENYLNELGEFKVINS 615
           IC LL K +  VE+ L+ELG + V++S
Sbjct: 664 ICTLLGKDRERVESMLSELGPYNVLHS 690

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  415 bits (1066), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 202/356 (56%), Positives = 260/356 (73%), Gaps = 14/356 (3%)

Query: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLIT 62
           ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+T
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  FKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQN 122
           FKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 QLLSKSEKDAVFF--DLKALE-NSTITPSTAGAXXXXXXXXXXXXXXXXXDKDAKDLRSS 179
           Q+LSK+E D ++F  D    E  +TI P  + +                  +   D    
Sbjct: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDG--SRFETDFFGE 187

Query: 180 RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTC 238
             + +TK        FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    
Sbjct: 188 EEDGVTK--------FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHL 239

Query: 239 VSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLI 298
           +SLEDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+++DP LVIECI+HL+
Sbjct: 240 ISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLV 299

Query: 299 YYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKN 354
           YY CV ++DIFQFSN+YAP+SLI +FLTDQ MA+ CQ+YV  P  SK+S LP   N
Sbjct: 300 YYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN 355

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  303 bits (776), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 188/455 (41%), Positives = 268/455 (58%), Gaps = 47/455 (10%)

Query: 193 SSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNL 251
           S  S+QDL+MRI+QDLNNYSECLIPID+GN VDIKIFPLL+PP    +S+EDVP+S V+L
Sbjct: 225 SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284

Query: 252 KKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQF 311
            KI DVNWDPTM+ ++P+I+G+N I+KISKLS S P LVIECI+HLIYY CV ++DIFQF
Sbjct: 285 TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344

Query: 312 SNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADRDSPSLFVXXXX 371
           SN Y+ +SLI TFLTD  MA+ CQ+YV  P  SK++ LP     +++ + S S +     
Sbjct: 345 SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSS-SAYRHHHN 403

Query: 372 XXXXIPSNPDSRTTXXXXXXXXXXXXXXXXXXXXVCKDWRQSQTSLSSSNLRANDNR--N 429
                PS   S T+                       D +QS+TSL+SSN  +N N    
Sbjct: 404 RHEKTPSFGSSITSNNGRSSFS-------------ADDRKQSETSLNSSNDPSNSNLIST 450

Query: 430 RFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERRIIYRCYSFP 489
             LPT+  LF+LYRSL+Q   LK+WY+  +  + ENNID+R+FI FG+ + +IYRC+S+P
Sbjct: 451 AHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYP 510

Query: 490 VMLN--VDSRERKEMTR-MILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV------ 540
           +++   V + E  + T   +    ++     K+  Q    S      S  P++       
Sbjct: 511 IVITPVVSAPESAKSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRD 570

Query: 541 -----------KSERPSKVSFEMQ----------RAGSLATGEATIPKLSDEEERILENS 579
                      K +  SKVSF  +           A S    + +  +L+ ++  IL +S
Sbjct: 571 KLMKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDS 630

Query: 580 IRSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 614
           I + ++ D ICV L + + ++E +L+E G++KVIN
Sbjct: 631 ISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

 Score =  200 bits (509), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 89/133 (66%), Positives = 107/133 (80%)

Query: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLIT 62
           ++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL    I+F+ IKNYIIPK  LC+KL+T
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 63  FKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQN 122
           FKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQN
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 123 QLLSKSEKDAVFF 135
           Q+LSK+E D ++F
Sbjct: 131 QILSKAENDPIYF 143

>TPHA0E03690 Chr5 (781473..783926) [2454 bp, 817 aa] {ON} Anc_1.45
           YCL030C
          Length = 817

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 54/131 (41%), Gaps = 26/131 (19%)

Query: 212 SECLIPIDEGNAVDIKIFPLLRPPTTCVSLEDVPLSSVNL--KKIIDVNWDPTMMSIVPY 269
           SE L+  DE    D     LL      V  + V L  VNL  KKI++V            
Sbjct: 614 SEVLVVCDENADADFVASDLLSQAEHGVDSQ-VILVGVNLSEKKILEVQ----------- 661

Query: 270 IDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQL 329
            D ++  A  ++L R D  +V +CI H     C +  + F  SN YAP  LI       L
Sbjct: 662 -DAVDRQA--NELPRVD--IVRKCIAHSTIILCESYEEAFGMSNKYAPEHLI-------L 709

Query: 330 MASDCQSYVAF 340
              + Q YV+ 
Sbjct: 710 QIENAQKYVSL 720

>KAFR0B03510 Chr2 complement(729872..731743) [1872 bp, 623 aa] {ON}
           Anc_8.779 YMR239C
          Length = 623

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 76/175 (43%), Gaps = 15/175 (8%)

Query: 220 EGNAVDIK--IFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIA 277
           +GN ++I+  +  L++P    V+ ++V L   N    +D+N    + S++ Y        
Sbjct: 419 KGNLLNIREWLRKLVQPTINDVTKKEVSLEETNE---LDINAKRRLYSLIGYAALKLQYV 475

Query: 278 KISKLSRSDPSLVIEC------IRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMA 331
            + K +++DP+ ++EC      I      + + L+ I    ++ +   ++  +   +   
Sbjct: 476 TVQKPTKNDPNCIVECRIGDGTILGKGIARNMKLAGIKAAEDVLSKKDIVEKYANIRASI 535

Query: 332 SDCQSYV---AFPEISKMSSLPLSKNLDSADRDSPSLFVXXXXXXXXIP-SNPDS 382
              +S V   +FP   +  S   S + +  +RD+  +F          P +NPDS
Sbjct: 536 PRSESVVSNNSFPNKRRKVSASASNDSEQNERDTQRVFFQKESDFPSTPTTNPDS 590

>ZYRO0F17578g Chr6 (1461181..1463613) [2433 bp, 810 aa] {ON} highly
           similar to uniprot|P00815 Saccharomyces cerevisiae
           YCL030C
          Length = 810

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 281 KLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI 321
           +L R D  +V++CI H     C +  + F+ SN YAP  LI
Sbjct: 663 QLPRKD--IVVKCIAHSAIILCGSYDEAFKISNQYAPEHLI 701

>TDEL0C06570 Chr3 (1206296..1208728) [2433 bp, 810 aa] {ON} Anc_1.45
           YCL030C
          Length = 810

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 52/129 (40%), Gaps = 26/129 (20%)

Query: 212 SECLIPIDEGNAVDIKIFPLLRPPTTCVSLEDVPLSSVNL--KKIIDVNWDPTMMSIVPY 269
           SE L+  DE   VD     LL      +  + V L  VNL  KKI  V            
Sbjct: 607 SEVLVICDEDADVDFVASDLLSQAEHGIDSQ-VILLGVNLSDKKIQQVQ----------- 654

Query: 270 IDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQL 329
            D ++  A   KL R D  +V +CI H     C +  + F  SN YAP  LI       L
Sbjct: 655 -DAVHEQA--VKLPRVD--IVRKCIAHSAIITCGSYEEAFDISNQYAPEHLI-------L 702

Query: 330 MASDCQSYV 338
             ++ Q YV
Sbjct: 703 QITNAQDYV 711

>Skud_4.490 Chr4 (878956..880341) [1386 bp, 461 aa] {ON} YDR229W
           (REAL)
          Length = 461

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 529 VGSKNSGQPNNVKSERPSKVSFEMQRAGSLATGEATIPKLS--------DEEERILENSI 580
           VGS N+   +++   R SKV  + +RA S+ +G +TI  L          E +  L +  
Sbjct: 57  VGSVNNDHLDDMNHLRSSKVYSKARRASSITSGTSTINDLQTLITKRDVKETQEALSSLF 116

Query: 581 RSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 614
           R++ ++ N  +  S++  E+ + L  + + K  N
Sbjct: 117 RNSNAYSNSLLKTSQNGAEIAHSLENIAKLKGCN 150

>SAKL0H21450g Chr8 complement(1877976..1879100) [1125 bp, 374 aa]
           {ON} some similarities with uniprot|P40356 Saccharomyces
           cerevisiae YGL025C PGD1 Subunit of the Mediator global
           transcriptional cofactor complex which is part of the
           RNA polymerase II holoenzyme and plays an essential role
           in basal and activated transcription direct target of
           the Cyc8p-Tup1p transcriptional corepressor
          Length = 374

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 224 VDIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVP----YIDGLNSIAKI 279
           + + I   L P TT   LED   S    K+ I      T  SI+P    + D LNS+AKI
Sbjct: 26  LSMGILESLSPKTTLSELEDKLSSDGAHKEAIQQQIATTQESILPIRLCFNDFLNSVAKI 85

Query: 280 SKLSRSDPS---LVIECIRHLIYYKCVTLSDIFQ 310
            ++    P    L+I      +Y +   LSD ++
Sbjct: 86  DQVDNKTPQERFLLIRSKLLEVYSRIQALSDDYE 119

>KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}
           Anc_1.45 YCL030C
          Length = 780

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 289 LVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI 321
           +V +CI H    KC +  + F  SN YAP  LI
Sbjct: 639 IVRKCISHSTIIKCDSYEEAFDMSNQYAPEHLI 671

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 56/132 (42%), Gaps = 31/132 (23%)

Query: 259 WDPTMMSIVPYIDGL----NSIAKISKLS---RSDPSLVIECIRHLIYYKCVTLS----- 306
           WD  M+   P ++ +    N  ++++KL    + +P++  + IR   + KC+  S     
Sbjct: 357 WDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKEEPTIYKQGIRPKSFKKCIGGSHEEFS 416

Query: 307 -----DIFQF--------------SNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMS 347
                D  +F              ++ Y P+ L++  + D+L   +C       E S + 
Sbjct: 417 SGRQQDALEFFTYFVDELDKKLFKNSDYNPNDLMKFMMEDRLQCQECHGVKYSTETSNVI 476

Query: 348 SLPLSKNLDSAD 359
            LPL ++ D+ D
Sbjct: 477 QLPLQESNDAQD 488

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,277,311
Number of extensions: 2602177
Number of successful extensions: 9376
Number of sequences better than 10.0: 52
Number of HSP's gapped: 9671
Number of HSP's successfully gapped: 82
Length of query: 615
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 499
Effective length of database: 40,180,143
Effective search space: 20049891357
Effective search space used: 20049891357
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)