Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.261.83ON59059029620.0
YEL063C (CAN1)1.83ON59059028040.0
Smik_5.241.83ON59059027650.0
Suva_5.41.83ON59059027540.0
NDAI0A006101.83ON56558021780.0
KNAG0C007901.83ON57951421550.0
NCAS0B085701.83ON53253320890.0
TPHA0B044801.83ON60351520690.0
TDEL0C061801.83ON58359620390.0
CAGL0J08184g1.83ON57258320270.0
Kpol_2000.651.83ON59554819730.0
TBLA0A054501.83ON60656319690.0
Smik_14.671.83ON57358319620.0
KAFR0D007001.83ON57457919610.0
NCAS0A006001.83ON54453519400.0
SAKL0C02684gsingletonON58854819360.0
SAKL0C02662g1.83ON54852319280.0
YNL270C (ALP1)1.83ON57354019280.0
KNAG0C05920singletonON59959219210.0
NDAI0F042001.83ON56656519080.0
Skud_14.701.83ON57357419080.0
KLTH0F02398g1.83ON55552218890.0
ZYRO0F16654g1.83ON58057918890.0
Kwal_33.134011.83ON55956018820.0
SAKL0C02640gsingletonON54856418760.0
KLLA0C02343g1.83ON58160318770.0
Suva_14.731.83ON49747918640.0
Kpol_2000.641.84ON61055318340.0
Smik_14.681.84ON61150818250.0
YNL268W (LYP1)1.84ON61159918240.0
TDEL0C061701.84ON57356818110.0
NDAI0F041901.84ON59958618090.0
TPHA0B044701.84ON59956818070.0
TBLA0A054601.84ON60859018020.0
CAGL0J08162g1.84ON59759118000.0
NCAS0A006101.84ON60759317890.0
Skud_14.711.84ON61259417880.0
Suva_14.751.84ON61159917880.0
KAFR0D039401.83ON59759817800.0
Kwal_33.134111.84ON56052917620.0
KLTH0F02420g1.84ON62156217540.0
KNAG0F004801.84ON59751917500.0
SAKL0C02728g1.84ON56255317420.0
Ecym_10871.83ON57056717410.0
Ecym_10881.84ON56752017300.0
KLLA0C02365g1.84ON57951917150.0
AFR667C1.84ON56351816510.0
ZYRO0F16632g1.84ON60751516120.0
AFR668W1.83ON55653015610.0
Kpol_358.3na 1ON5755239211e-116
SAKL0G14916gna 1ON5815328911e-112
CAGL0A01199gna 1ON6135268921e-111
Kwal_33.15545na 1ON5765388741e-109
TPHA0M00130singletonON6115148571e-106
Smik_6.473na 1ON6065148571e-106
YPL265W (DIP5)na 1ON6085168561e-106
KLLA0E16281gna 1ON6055698551e-106
KAFR0B06430singletonON5935198531e-106
Skud_16.12na 1ON6075758531e-106
NCAS0D02260na 1ON5975518511e-106
TBLA0A07060na 1ON6255068471e-105
Ecym_2480na 1ON5865138441e-105
KLTH0B01166gna 1ON5775028431e-104
TPHA0H028507.44ON6016058431e-104
Kwal_26.69407.44ON5705808351e-104
Suva_16.40na 1ON6065158351e-103
KNAG0L02470singletonON6385038351e-103
NDAI0I02660na 1ON5945748251e-102
NDAI0E038007.44ON6216128221e-101
KNAG0E003907.44ON5996028074e-99
KNAG0L02460singletonON5885088046e-99
SAKL0F09790gsingletonON5585528011e-98
Ecym_80357.44ON5635627983e-98
ZYRO0D17908gna 1ON5184997925e-98
SAKL0C01232gsingletonON6135208005e-98
TDEL0C00930singletonON5955737961e-97
Suva_2.6881.50ON6616127983e-97
KLTH0D01474g7.44ON6245197953e-97
CAGL0E05632g7.44ON5985437917e-97
TDEL0H040707.44ON5775507844e-96
NDAI0B052201.244ON6115837874e-96
Kwal_27.126811.244ON5935827856e-96
YOR348C (PUT4)7.44ON6275837877e-96
Kpol_367.77.44ON5845767838e-96
Skud_4.7841.50ON6635787862e-95
ZYRO0D03762g1.244ON6005747812e-95
SAKL0G14014g5.158ON6055547813e-95
Smik_4.7901.50ON6635267829e-95
AFR156W7.44ON5585267722e-94
TDEL0A08030singletonON5145037647e-94
CAGL0K05753g1.50ON6605447757e-94
Ecym_60211.244ON6005457701e-93
Smik_15.5327.44ON6315477721e-93
Kpol_543.791.244ON6055847701e-93
SAKL0B10956g7.44ON5725657671e-93
KLTH0B02046g5.158ON5895457663e-93
KLLA0A11770g5.158ON5815757653e-93
Kwal_33.154075.158ON5875527654e-93
SAKL0D00836gna 2ON6015917655e-93
TPHA0B010901.244ON6065567656e-93
KNAG0C02140singletonON5985717647e-93
YDR508C (GNP1)1.50ON6636127681e-92
NDAI0A006401.50ON6415707642e-92
Suva_8.4027.44ON6835837672e-92
NCAS0E022607.44ON5935987603e-92
Smik_16.1155.158ON6035197603e-92
TBLA0C01240singletonON6295327614e-92
CAGL0B01012g1.50ON6235337605e-92
Kwal_33.132041.50ON6075347595e-92
YBR068C (BAP2)3.284ON6095227588e-92
Suva_4.3073.284ON6095707588e-92
YGR191W (HIP1)5.158ON6035437579e-92
KAFR0C051607.44ON5845537569e-92
ACL135Wna 1ON5885277561e-91
KLTH0E15642g1.244ON5965847551e-91
NCAS0B085801.50ON6275237571e-91
SAKL0C01650g1.50ON6135307562e-91
Skud_11.2751.244ON6025987516e-91
Suva_7.4855.158ON6035137517e-91
TBLA0A05190na 3ON6675637541e-90
TBLA0A051801.50ON6765647541e-90
NCAS0A071105.158ON5925397482e-90
Skud_7.5255.158ON6035427482e-90
Skud_15.5157.44ON6265817502e-90
Smik_3.531.50ON6335317493e-90
TDEL0C065101.50ON6425247493e-90
Skud_3.381.50ON6335967484e-90
KAFR0D00510na 4ON6175177465e-90
Kwal_23.4026singletonON5345057397e-90
YCL025C (AGP1)1.50ON6335657451e-89
SAKL0D02970g3.284ON6015317421e-89
CAGL0B03773g5.158ON6055017421e-89
Suva_2.716singletonON6035677421e-89
Suva_3.1891.50ON6335977442e-89
NDAI0G060301.368ON5995807361e-88
Skud_2.1913.284ON6095207361e-88
NDAI0D021605.158ON5875307341e-88
KAFR0D00520na 3ON5985617342e-88
KNAG0G009005.158ON6135737343e-88
Ecym_47895.158ON5885557323e-88
KAFR0D04120na 3ON6485447364e-88
YKR039W (GAP1)1.244ON6025417324e-88
KAFR0E018505.158ON5605287277e-88
KAFR0D005001.50ON6175247318e-88
AGR319W5.158ON6266217311e-87
Smik_2.2013.284ON6095277282e-87
Smik_4.2843.284ON6046007282e-87
Ecym_10561.50ON6065237263e-87
KLLA0A06886gsingletonON5875747253e-87
NCAS0B079001.244ON6195357273e-87
KAFR0A011203.284ON5925357253e-87
KLLA0F23419g7.44ON5735747227e-87
AFR698C1.50ON6095137221e-86
SAKL0D04664g1.244ON5935387202e-86
Kpol_1010.325.158ON5995467202e-86
NDAI0C029505.158ON6095647193e-86
NDAI0A056203.284ON5715257163e-86
NCAS0D018705.158ON5955427175e-86
Kpol_2002.441.50ON6276017187e-86
TBLA0B077605.158ON6585067191e-85
YDR046C (BAP3)3.284ON6045967142e-85
TPHA0E036601.50ON6475267172e-85
Smik_11.3021.244ON5535417102e-85
KLTH0F01584g1.50ON5965117123e-85
TBLA0G031203.284ON6735397174e-85
NCAS0A004201.50ON6795957166e-85
TPHA0A002405.158ON6035137099e-85
KLLA0F27093gsingletonON5634747069e-85
KLTH0C05170g3.284ON5985797099e-85
ZYRO0F17446g1.50ON6335157119e-85
KLLA0A06930g1.244ON5875307089e-85
AGR038C3.284ON5805407071e-84
CAGL0H08393g3.284ON6125367091e-84
NCAS0A106803.284ON5935277081e-84
Suva_2.2033.284ON6045377081e-84
CAGL0L03267g1.244ON5976047071e-84
TDEL0F02830na 5ON5615367042e-84
Suva_11.2731.244ON6015847072e-84
KNAG0C005901.50ON6345167083e-84
Kwal_33.14276na 2ON5965297053e-84
AFR230C1.244ON6045887054e-84
Ecym_26643.285ON5755367034e-84
TPHA0A047005.158ON5695137025e-84
KLLA0C01606g1.50ON6205207056e-84
Kpol_2000.921.50ON6375227031e-83
KNAG0F002701.50ON6345157032e-83
Skud_6.2na 6ON5584966972e-83
Smik_13.1singletonON5235056933e-83
KNAG0J022003.284ON6075856993e-83
Kpol_543.78singletonON6055866984e-83
SAKL0C13992gsingletonON5525236937e-83
YOL020W (TAT2)1.368ON5925306959e-83
Skud_15.1381.368ON5925816941e-82
NCAS0A089201.368ON5995076951e-82
Skud_4.3003.284ON6045966951e-82
Kwal_8.590na 7ON6294836961e-82
ZYRO0G07172gna 5ON5675096912e-82
KLTH0B00154gna 7ON5565156892e-82
Ecym_27161.368ON5925276922e-82
Ecym_26623.284ON5895356904e-82
KAFR0C004003.284ON5825386904e-82
CAGL0D02178g1.368ON5775316878e-82
Suva_15.1481.368ON5925256871e-81
TBLA0C012101.368ON6005986871e-81
KAFR0D041401.50ON6375286901e-81
Kpol_534.221.368ON5925286862e-81
Kwal_27.105383.284ON6025386862e-81
KNAG0H011503.284ON6175316863e-81
TPHA0M012003.284ON6075916845e-81
Kwal_23.2817na 8ON5805436825e-81
NDAI0A01340singletonON5545086796e-81
YFL055W (AGP3)na 6ON5585446797e-81
CAGL0M00154gsingletonON5505286771e-80
KNAG0L00110na 6ON5715256763e-80
SAKL0D02926g3.285ON5835216764e-80
NCAS0J00140na 6ON5585406735e-80
Smik_15.1461.368ON5935796758e-80
SAKL0F16544gsingletonON5675486721e-79
KLLA0A10813g1.368ON5845306731e-79
NCAS0I015303.284ON5955316731e-79
KLTH0F01606gna 3ON6045576722e-79
Kwal_26.9612singletonON5435246673e-79
AEL030W1.368ON5825656678e-79
NDAI0A074903.284ON5965636671e-78
ZYRO0G12342g3.284ON6205236681e-78
KLTH0H13398g1.368ON5874256642e-78
NDAI0F043901.50ON6674986702e-78
Ecym_2663na 9ON5895246643e-78
SAKL0A09724gna 10ON5515296613e-78
Sklu_YGOB_Anc_1.3681.368ON5414616595e-78
KLLA0B14685gna 8ON5715756606e-78
AGR039Cna 9ON5865206616e-78
KLTH0F04048gsingletonON5835536608e-78
Ecym_8297na 11ON5695396581e-77
CAGL0L07546g3.284ON6346046612e-77
SAKL0D02948gna 9ON5945416582e-77
Smik_6.482na 12ON5585336536e-77
ZYRO0C18502g7.44ON5755686537e-77
ZYRO0A00308gsingletonON5645166511e-76
Suva_13.517singletonON5475526491e-76
KNAG0J022103.285ON5815156502e-76
TDEL0E05750singletonON5485186473e-76
Skud_2.1923.285ON6195676499e-76
Kwal_34.16254singletonOFF4814406381e-75
Kpol_1065.133.284ON5965266461e-75
Kwal_YGOB_34.162541.368ON4914406381e-75
AGR040C3.285ON5734366441e-75
KAFR0D04130na 4ON6444996492e-75
TPHA0A039603.284ON6156086453e-75
KAFR0F02250singletonON5545296387e-75
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.26
         (590 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...  1145   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...  1084   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...  1069   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...  1065   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   843   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              834   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            809   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   801   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   790   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   785   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   764   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   763   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   760   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   759   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   751   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   750   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   747   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   747   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            744   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            739   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   739   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   732   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   732   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   729   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   727   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   727   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   722   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   711   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   707   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   707   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   702   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   701   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   700   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   698   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   697   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              693   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   693   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   693   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   690   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   683   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   680   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                678   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   675   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   675   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   671   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   665   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   640   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   625   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   605   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   359   e-116
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   347   e-112
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   348   e-111
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   341   e-109
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     334   e-106
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   334   e-106
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   334   e-106
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   333   e-106
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   333   e-106
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   333   e-106
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              332   e-106
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   330   e-105
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   329   e-105
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   329   e-104
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   329   e-104
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   326   e-104
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   326   e-103
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             326   e-103
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   322   e-102
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     321   e-101
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   315   4e-99
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             314   6e-99
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   313   1e-98
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   311   3e-98
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   309   5e-98
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   312   5e-98
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   311   1e-97
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   311   3e-97
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   310   3e-97
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   309   7e-97
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   306   4e-96
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   307   4e-96
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   306   6e-96
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   307   7e-96
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   306   8e-96
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   307   2e-95
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   305   2e-95
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   305   3e-95
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   305   9e-95
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   301   2e-94
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            298   7e-94
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   303   7e-94
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   301   1e-93
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   301   1e-93
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   301   1e-93
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   300   1e-93
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   299   3e-93
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   299   3e-93
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   299   4e-93
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   299   5e-93
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   299   6e-93
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   298   7e-93
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   300   1e-92
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   298   2e-92
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   300   2e-92
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     297   3e-92
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   297   3e-92
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   297   4e-92
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   297   5e-92
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   296   5e-92
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   296   8e-92
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   296   8e-92
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   296   9e-92
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   295   9e-92
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   295   1e-91
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   295   1e-91
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   296   1e-91
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   295   2e-91
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   293   6e-91
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   293   7e-91
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   295   1e-90
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   295   1e-90
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   292   2e-90
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   292   2e-90
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   293   2e-90
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   293   3e-90
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   293   3e-90
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   292   4e-90
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      291   5e-90
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   289   7e-90
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   291   1e-89
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   290   1e-89
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   290   1e-89
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   290   1e-89
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   291   2e-89
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   288   1e-88
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   288   1e-88
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    287   1e-88
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   287   2e-88
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   287   3e-88
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   286   3e-88
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   288   4e-88
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   286   4e-88
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   284   7e-88
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      286   8e-88
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   286   1e-87
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   285   2e-87
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   285   2e-87
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   284   3e-87
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   283   3e-87
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   284   3e-87
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   283   3e-87
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   282   7e-87
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   282   1e-86
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   281   2e-86
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   281   2e-86
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    281   3e-86
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            280   3e-86
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   280   5e-86
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   281   7e-86
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   281   1e-85
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   279   2e-85
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   280   2e-85
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   278   2e-85
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   278   3e-85
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              280   4e-85
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   280   6e-85
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   277   9e-85
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   276   9e-85
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   277   9e-85
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   278   9e-85
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   277   9e-85
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   276   1e-84
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   277   1e-84
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   277   1e-84
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   277   1e-84
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   276   1e-84
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   275   2e-84
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   276   2e-84
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   277   3e-84
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   276   3e-84
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   276   4e-84
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   275   4e-84
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   275   5e-84
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   276   6e-84
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   275   1e-83
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   275   2e-83
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      273   2e-83
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    271   3e-83
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   273   3e-83
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   273   4e-83
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   271   7e-83
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   272   9e-83
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   271   1e-82
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   272   1e-82
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   272   1e-82
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   272   1e-82
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   270   2e-82
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   270   2e-82
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   271   2e-82
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   270   4e-82
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                270   4e-82
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   269   8e-82
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   269   1e-81
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   269   1e-81
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              270   1e-81
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   268   2e-81
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   268   2e-81
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              268   3e-81
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   268   5e-81
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   267   5e-81
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              266   6e-81
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   266   7e-81
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   265   1e-80
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   265   3e-80
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   265   4e-80
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      263   5e-80
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   264   8e-80
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   263   1e-79
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   263   1e-79
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              263   1e-79
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   263   2e-79
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   261   3e-79
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   261   8e-79
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   261   1e-78
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   261   1e-78
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   260   2e-78
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   262   2e-78
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   260   3e-78
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   259   3e-78
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   258   5e-78
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   258   6e-78
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   259   6e-78
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   258   8e-78
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   258   1e-77
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   259   2e-77
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   258   2e-77
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   256   6e-77
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   256   7e-77
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   255   1e-76
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   254   1e-76
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   254   2e-76
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            253   3e-76
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   254   9e-76
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   250   1e-75
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   253   1e-75
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   250   1e-75
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   252   1e-75
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              254   2e-75
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              253   3e-75
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              250   7e-75
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   250   1e-74
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   250   2e-74
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   248   4e-74
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   248   2e-73
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   247   2e-73
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   248   4e-73
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   245   4e-73
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   246   7e-73
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   245   9e-73
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   246   2e-72
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   245   3e-72
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   244   5e-72
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   241   6e-72
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                241   2e-71
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   239   4e-71
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   241   4e-71
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   238   1e-70
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   238   4e-70
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   238   7e-70
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   237   1e-69
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              236   3e-69
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   235   7e-69
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   234   9e-69
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   233   2e-68
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   232   1e-67
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   232   1e-67
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   231   2e-67
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    230   4e-67
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   230   5e-67
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   230   5e-67
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   229   6e-67
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   229   2e-66
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   226   1e-65
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   225   3e-65
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   224   4e-65
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   224   5e-65
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   224   6e-65
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   223   1e-64
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   223   2e-64
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      223   2e-64
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   223   2e-64
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   222   5e-64
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   221   5e-64
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   226   6e-64
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   221   7e-64
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   221   8e-64
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   221   9e-64
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   221   1e-63
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   219   3e-63
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   224   4e-63
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   220   4e-63
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   217   5e-63
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              219   7e-63
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   223   9e-63
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   218   1e-62
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                218   2e-62
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   217   3e-62
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   216   4e-62
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   220   1e-61
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   219   2e-61
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   214   3e-61
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   216   5e-60
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   214   1e-59
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   210   1e-59
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   214   2e-59
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   213   3e-59
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   211   1e-58
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   206   2e-58
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   204   9e-58
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                204   2e-57
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   203   3e-57
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   202   6e-57
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   203   8e-56
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   203   9e-56
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   202   2e-55
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   197   3e-55
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   201   7e-55
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   196   2e-54
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   199   2e-54
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     188   1e-53
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   197   1e-53
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     187   1e-53
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   192   2e-53
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   195   6e-53
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   195   1e-52
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   188   1e-50
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   184   3e-49
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         140   2e-36
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   132   1e-34
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          97   2e-22
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      97   1e-21
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     97   3e-21
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          89   8e-20
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    84   3e-18
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      75   1e-15
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    60   3e-09
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      58   3e-09
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    39   0.044
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    38   0.056
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    38   0.066
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    36   0.34 
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    35   0.39 
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    35   0.43 
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    35   0.53 
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    35   0.68 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    35   0.70 
Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {O...    34   1.2  
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    34   1.3  
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    33   1.7  
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              32   2.1  
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    33   2.5  
Skud_15.31 Chr15 complement(54845..56590) [1746 bp, 581 aa] {ON}...    33   2.7  
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    33   3.0  
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    33   3.1  
TBLA0C00780 Chr3 complement(163188..164531) [1344 bp, 447 aa] {O...    33   3.1  
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    33   3.2  
ZYRO0G12782g Chr7 (1015954..1017684) [1731 bp, 576 aa] {ON} weak...    32   3.5  
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    32   3.8  
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    32   5.9  
TPHA0B04910 Chr2 (1154661..1155797) [1137 bp, 378 aa] {ON}             32   6.7  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...    32   7.9  
TPHA0F00170 Chr6 (21183..22853) [1671 bp, 556 aa] {ON} Anc_4.5 Y...    31   9.7  

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/590 (95%), Positives = 564/590 (95%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60
           MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN
Sbjct: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60

Query: 61  GQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           GQDTFSMEENLQDEDEGEVQNAEVKRELKQRH                    PLANAGPV
Sbjct: 61  GQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPV 120

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT
Sbjct: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG
Sbjct: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360
           ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG
Sbjct: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY
Sbjct: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAV 540
           RGISRDELPFKAKLMPGLAYYSSFFM      QGFTAFAPKFNGSSFLAAYISIFLFIAV
Sbjct: 481 RGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAV 540

Query: 541 WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA
Sbjct: 541 WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/590 (89%), Positives = 550/590 (93%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60
           MTN K++A+IEEKHMYNEPVTTL HDVEASQTH RRGS+ LKDEKSKELYPLRSFPT VN
Sbjct: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60

Query: 61  GQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           G+DTFSME+ + DEDEGEVQNAEVKRELKQRH                    PL NAGPV
Sbjct: 61  GEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPV 120

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           GALI+YLFMGSLA+SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQVIQFWT+KVPLAAWISIFWV+ITIMNLFPVKYYGEFEFWVASIKV+AIIG
Sbjct: 181 FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISK+KNEGRFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360
           ELVGITAGEAANPRK+VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT++TSYVSTS
Sbjct: 301 ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS 360

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           PFI+AI+NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT+KG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVPYIAVF TA FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY
Sbjct: 421 GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAV 540
           RGISRDELPFKAKLMPGLAYY++ FM      QGFTAFAPKFNG SF AAYISIFLF+AV
Sbjct: 481 RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV 540

Query: 541 WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           WILF+CIFRCRFIWKI DVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA
Sbjct: 541 WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/590 (88%), Positives = 547/590 (92%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60
           MT+PKQ  EIEEKHMYNEPVTTL HDVEASQTHRRRGSL LKDEK+KELYPL SF T V+
Sbjct: 1   MTDPKQNTEIEEKHMYNEPVTTLFHDVEASQTHRRRGSLPLKDEKNKELYPLHSFSTRVD 60

Query: 61  GQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           G+DTFSM + ++DED+GEV+NAEVKRELKQRH                    PLANAGPV
Sbjct: 61  GEDTFSMGDVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPV 120

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           GALI+YLFMGSLA+SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQVI+FWT+KVPLAAWISIFWV+ITIMNLFPVKYYGEFEFWVASIKV+AIIG
Sbjct: 181 FALELSVVGQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISK+KNEGRFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360
           ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT ATSYVS S
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVS 360

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           PFI+AI+NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT+KG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVPYIAVF TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWL ISISHIRFMQALKY
Sbjct: 421 GVPYIAVFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAV 540
           RGISRDELPFKAKLMPGLAY+++ FM      QGFTAFAPKF+G  FLAAYISIFLF+A+
Sbjct: 481 RGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAI 540

Query: 541 WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           WILFE IFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA
Sbjct: 541 WILFEIIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/590 (86%), Positives = 541/590 (91%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60
           MT PKQ++E+EEKHMY EP  T  HDVEASQTH RRGSLSLKDEKSKELYPLRSFP GVN
Sbjct: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60

Query: 61  GQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           GQDTFSMEE++QDEDEGEVQNAEVKRELKQRH                    PL NAGPV
Sbjct: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPV 120

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           GALI+YLFMGSLA+SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA+T
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180

Query: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQVIQFWT+ VPLAAWISIFWV+IT MN+FPVKYYGEFEFWVASIKVIAIIG
Sbjct: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNE RFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360
           ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT ATSYVSTS
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           PFI+AI+NSGTKVLPHIFNAVILTTIISAANSNIYVGSR+LFGLSK+KLAPKF S+T+KG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVPYIAVFAT++FGALAYMETSTGG KVF WLLNITGVAGFFAWLFIS+SHIRFMQALKY
Sbjct: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAV 540
           RGISRDELPFKAKLMPGLAYY++FFM      QGFT+F P FNG +FLAAYIS+FLF+A+
Sbjct: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540

Query: 541 WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           WILFE IFRCRF+WKIEDVDIDSDRRDIEAIVWE+ EPKT WDKFWNVV 
Sbjct: 541 WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/580 (70%), Positives = 471/580 (81%), Gaps = 19/580 (3%)

Query: 11  EEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEEN 70
           +E+ + N  + +  ++++    HRR  S+              S P+ +      ++E  
Sbjct: 5   QEEPLKNGKIKSSSYELDDYPLHRRTNSV-------------HSIPSQI------TIESQ 45

Query: 71  LQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMG 130
            ++   G+++ AEVKRELKQRH                    PL NAGPVGALIAYLFMG
Sbjct: 46  EEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMG 105

Query: 131 SLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190
           +L +SVTQSLGEMATFIPVTSSFTVFSQRFLSP+FGAANGYMYWFSWAITFALELSVVGQ
Sbjct: 106 TLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQ 165

Query: 191 VIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVC 250
           +IQFWT  VP+ AWISIFWVL+  MN+FPV++YGEFEFWVASIKV+AI+GFLIYC CMVC
Sbjct: 166 IIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVC 225

Query: 251 GAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310
           GAGVTGPVGFRYWRNPG  GPGII+KN NE +FLGWVSSLINAAFT+QGTELVGITAGEA
Sbjct: 226 GAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285

Query: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSG 370
           ANPRK+VPRAIKKVVFRIL FYIGSL FIGLLVPYNDPKLT   SYV+ SPFI++IQNSG
Sbjct: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSG 345

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFAT 430
           T +LPHIFNAVIL+TIISAANSN+YVGSRI+FGLSK+KLAP+ LSRT+K GVP+++V  T
Sbjct: 346 TPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFT 405

Query: 431 AVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
            +FGALAYMETSTGG+  F WLLNITGVAGFF+WLFISISH+RFMQAL+YRGISRD+LPF
Sbjct: 406 GLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPF 465

Query: 491 KAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRC 550
           KAK MPGLAYY+ FFM      QGFT+F P F+G  FLAAYIS FLFIA+WI+F+  FRC
Sbjct: 466 KAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525

Query: 551 RFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           R IWKIEDVDID+DRRDIE +VWED  P TFWDKFWNVVA
Sbjct: 526 RLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/514 (77%), Positives = 439/514 (85%)

Query: 77  GEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSV 136
           G V +AEVKRELKQRH                    PL  AGPVGALI+Y+FMG+L +SV
Sbjct: 66  GYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSV 125

Query: 137 TQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT 196
           TQSLGEMATFIPVTSSFTVF+QRFLSP+ GAA GYMYWFSWA+TFALELSV+GQVIQ+WT
Sbjct: 126 TQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT 185

Query: 197 HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTG 256
           + VPLAAWISIFWV+IT  N+FPVKYYGE EFW+A IKVIAI+GFL+YC CMVCGAGVTG
Sbjct: 186 YAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTG 245

Query: 257 PVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
           PVGFRYWRNPG WGPGIISK+KNE RFLGWVSSLIN AFT+QGTELVGI+AGEAANPRK 
Sbjct: 246 PVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKA 305

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPH 376
           VPRAIKKVVFRIL FYIGSL FIGLLVPYND  L    SYV++SPFI+AI+NSGT VLPH
Sbjct: 306 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPH 365

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
           IFNAVI  TI+SA NSN+YVGSRILFGLSKNKLAPK LSRT+KGGVP+IAV  T+V GAL
Sbjct: 366 IFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGAL 425

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           AYMETSTGG   F WLLNIT VAGFF WLFIS+SHIRFMQALKYRGISRD+LPFKA LMP
Sbjct: 426 AYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMP 485

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKI 556
           GLAYY+SF M      QGFTAFAPKF+GS F AAYISIFLFI +W LF+ IFRCRFI K+
Sbjct: 486 GLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKV 545

Query: 557 EDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           EDVDID+DRRDIEA+VWED EPKT WDKFWN++A
Sbjct: 546 EDVDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/533 (74%), Positives = 447/533 (83%), Gaps = 3/533 (0%)

Query: 58  GVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANA 117
           G + QD+  M+E ++ E   EV+   V+RELKQRH                    PL NA
Sbjct: 3   GGHNQDS-KMKEEIR-EISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNA 60

Query: 118 GPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GPVGALIAYLFM +LA+SVTQSLGEMATFIPVTSSFTVFSQRF+SPAFGAANGYMYWFSW
Sbjct: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSW 120

Query: 178 AITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIA 237
            ITFALELSVVGQVIQFWT  VPLAAWISIFWVL+T MN+FPVKYYGEFEFWVA +KV+A
Sbjct: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180

Query: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
           I+GFLIYCFCMVCGAGVTGPVGFRYWR+PGA+GPGII+K+KN+ RFLGWVSSLINAAFTF
Sbjct: 181 IMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV 357
           QGTELVGITAGEAANPRKTVPRAIKKVVFRIL FYI SL FIGLLVPY+D KLT   SYV
Sbjct: 241 QGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYV 300

Query: 358 STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417
           S SPFI+AI+NSGT VLPHIFNAVI+ TIISA NSNIYVGSRI++GLS ++LAP  LSRT
Sbjct: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360

Query: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477
           ++ GVP++AV  T++FGALAYMETSTGG K F WLLNITGVAGFF WLFIS+SHIRFMQA
Sbjct: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420

Query: 478 LKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLF 537
           L+ RGISRD+LPFKAK MPGLAYY  FFM      QGFT+F P +NG  FL AYIS+F+F
Sbjct: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMF 479

Query: 538 IAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           IA+WI F+  FRCR IW++EDVDID+DRR +E  VW + EP+ FWDKFWNVVA
Sbjct: 480 IAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/515 (75%), Positives = 438/515 (85%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           EG V+ AEVKR+LKQRH                    PL NAGPVGALIAYLFM ++ FS
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
           VTQSLGEMATFIPVTSSFTVFS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+IQFW
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 196 THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
           TH VPL+AWI I+WV++TIMNLFPVK+YGEFEFWVASIKV+AIIGFLIYC CMVCGAGVT
Sbjct: 209 THAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT 268

Query: 256 GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
           GPVGFRYWRNPG WGPGIISK+ NEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 269 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 328

Query: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLP 375
           TVPRAIKKV FRIL FYI SL FIGLLVPY+D KLT   SY+S SPFI+AI+NSGTK+LP
Sbjct: 329 TVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILP 388

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGA 435
           HIFNAVIL+TIISA NSN+YVGSRILFGL+K KLAPK+   TS+GGVPY +VF T+ FGA
Sbjct: 389 HIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGA 448

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           LA++E S+GG K F WLLNI  VAGFFAWL ISI+H+RFMQALK+RGISRD+LPFKA+ M
Sbjct: 449 LAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFM 508

Query: 496 PGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWK 555
           P LAYYS FFM      QGFTAFAP FNGS F+AAYISIFLF  +W+ F+  FR + +W 
Sbjct: 509 PHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWT 568

Query: 556 IEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +E+VDID+DRRD++AI+WED  PKTFWDKFW+VVA
Sbjct: 569 VEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/596 (66%), Positives = 461/596 (77%), Gaps = 19/596 (3%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQ------THRRRGSLSLKDEKSKELYPLRS 54
           M N KQ+   E   + N    + ++D ++S        HR++  +S K     E  P   
Sbjct: 1   MWNAKQDVSEEGYELGN---FSGMNDEDSSSGQAGAINHRKKSVVS-KTTAVDESLP--- 53

Query: 55  FPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPL 114
                 G  +  +E +     EG+V  AEVKR LKQRH                    PL
Sbjct: 54  ------GLSSSDLESSDDFVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPL 107

Query: 115 ANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYW 174
           +NAGPVG LIAYLFM +L +SV QSLGEMATFIPVTS+FTVFS RFLSPAFGAA+GYMYW
Sbjct: 108 SNAGPVGGLIAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYW 167

Query: 175 FSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIK 234
           FSWAITFALELSVVGQ+I+FWT  VP+AAWI+IFWVL+T+ NLFPVKYYGEFEFW+A IK
Sbjct: 168 FSWAITFALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIK 227

Query: 235 VIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAA 294
           VIA++GF+IYC CMVCGAG+TGPVGFRYWRNPGAWGPGIISK+KNEGRFLGWVSSLINAA
Sbjct: 228 VIALVGFIIYCLCMVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAA 287

Query: 295 FTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT 354
           FT+QGTELVGITAGEAANPRK+VPRAIKKVVFRIL FY    +FIGLLVPYNDPKL  + 
Sbjct: 288 FTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSD 347

Query: 355 SYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
           SYVS+SPFI+AI+NSGTKVLPHIFNAV+LTTIISA NSN+YVGSRI++GL+K KLAP F 
Sbjct: 348 SYVSSSPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFF 407

Query: 415 SRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
            RT+  GVPY AVF T+ FGALAYME STGG   F WLLNITGVAGFF W+ IS  HIRF
Sbjct: 408 GRTNAAGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRF 467

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISI 534
           MQALKYRGISRD+LPFKAK MP LAYY+ FFM      QGFTAFAP F+G  F AAY+S+
Sbjct: 468 MQALKYRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSV 527

Query: 535 FLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           FLFIA+W+  +  FRCR   ++++VDID+DRRDIEA+VW+D  PKT WDKFWN+VA
Sbjct: 528 FLFIAIWLGAQIWFRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/583 (65%), Positives = 453/583 (77%), Gaps = 16/583 (2%)

Query: 8   AEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSM 67
           ++++EK +  + + T++   ++   +   G L  +  K+                 + + 
Sbjct: 6   SDLKEKSVIQD-IDTIIDGNDSDSHNSNTGELGRRKRKTSV---------------SSTQ 49

Query: 68  EENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
            E+L  E +  +++ +VKR LKQRH                    PLANAGPVGAL+AYL
Sbjct: 50  YEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYL 109

Query: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
           FMG++ FSVTQSLGEMATFIPVTSSF+VF+QRFLSPA GAANGYMY+ SW  TFALELSV
Sbjct: 110 FMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169

Query: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
           VGQ+IQFWT KVPLAAWISIFWVL+T  N+FPVK+YGEFEFW+ASIKV+A++GFLIY  C
Sbjct: 170 VGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLC 229

Query: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
           +VCGAG TGP+GFRYWRNPGA GPGIIS N  E RFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 230 IVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367
           GEAANPRK VPRAI+KV+ RIL FYIGSL FIGL VPYNDPKLT   SYVS+SPFI+ IQ
Sbjct: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQ 349

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
           N+GT+VLPHIFNAVILTTIISA NSN+YVGSRILF ++KN LAPKFL++T+  GVPY++V
Sbjct: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
            A + FG+L+YME STGG K F WLLNITGVAGFFAWL IS SH+RFMQALK+RGISRD+
Sbjct: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547
           LP+KA  MP LAYY+ FFM      QGFT+FAP F+G  F+AAYIS+ LF+  W  F+  
Sbjct: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIY 529

Query: 548 FRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           FRCR IWK+EDVDID+DRR+IE++VWED  PKT WDKFW+ VA
Sbjct: 530 FRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/548 (71%), Positives = 449/548 (81%), Gaps = 7/548 (1%)

Query: 43  DEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXX 102
           D  S+ L+       G +G  + S +E+    D+G VQ+AEVKRELKQRH          
Sbjct: 55  DGSSRHLH-------GSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTI 107

Query: 103 XXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                     PL NAGPVG+LIAYLFM ++ FSVTQSLGEMATFIPVTSSFTVFS RF+S
Sbjct: 108 GTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFIS 167

Query: 163 PAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKY 222
           P+ GAANGYMYWFSWAITFALELSVVGQ+IQFWT  VPL+AWI I+W ++TIMN+FPVK+
Sbjct: 168 PSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKF 227

Query: 223 YGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGR 282
           YGEFEFWVASIKVIAI+GFLIYC CMVCGAGVTGPVGFRYWRNPG WGPGIIS    EGR
Sbjct: 228 YGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGR 287

Query: 283 FLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLL 342
           FLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPRAIKKV FRIL FYI SL FIGLL
Sbjct: 288 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLL 347

Query: 343 VPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILF 402
           VP++DPKL+   SYVS+SPFI+AIQNSGTKVLPHIFNAVIL+TIISA NSNIYVGSR++F
Sbjct: 348 VPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMF 407

Query: 403 GLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFF 462
           GL+K KLAP++   T+K GVPYIAV  T+ FGALA++E S+GG K F WLLNI GVAGFF
Sbjct: 408 GLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFF 467

Query: 463 AWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF 522
           AWL ISI+H+RF+Q L++RGISRD+LPFKA LMP LAYY+ FFM      QGFTAFAP F
Sbjct: 468 AWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAPTF 527

Query: 523 NGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFW 582
           NGS F+AAYIS+FLF  +W+ F+  FRC+  W +++VDID+DRRDI+AI+WED  PKTFW
Sbjct: 528 NGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAPKTFW 587

Query: 583 DKFWNVVA 590
           D+FW+VVA
Sbjct: 588 DRFWDVVA 595

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/563 (70%), Positives = 450/563 (79%), Gaps = 7/563 (1%)

Query: 33  HRRRGSL-SLKDEKSKELYPL-RSFPTGVNGQDTFSMEENLQDED---EGEVQNAEVKRE 87
           HR RGS   ++  KS E   L ++    V      +   ++ +ED    G V+ A+VKRE
Sbjct: 46  HRHRGSEGEVEYAKSDEDATLTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKRE 105

Query: 88  LKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFI 147
           LK RH                    P+ NAGPVG+LIAY+FMG+L FSVTQSLGEMATFI
Sbjct: 106 LKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFI 165

Query: 148 PVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISI 207
           PVTSSFTVF+ RF+S  FGAA GYMYWFSWAITFALELSVVGQVI+FWT KVPLAAWISI
Sbjct: 166 PVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISI 225

Query: 208 FWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPG 267
           FWVLI IMN FPVK YGEFEFWVASIKVIAIIGF+IYC CMVCGAG+TGPVGFRYWR+PG
Sbjct: 226 FWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPG 285

Query: 268 AWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327
            WGPGIISK+KNE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAIKKV  R
Sbjct: 286 PWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVR 345

Query: 328 ILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTII 387
           IL FYI SL FIGLLVPYNDPKL+   SYVS SPFI+AIQNSGTKVLPHIFNAVILTTII
Sbjct: 346 ILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTII 405

Query: 388 SAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDK 447
           SAANSN+YVGSRIL+GLS  KLAPKF  +T + GVP+IAV  TA FGALAYMETS GG  
Sbjct: 406 SAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQN 464

Query: 448 VFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMX 507
            F WLLNITGVAGFFAWL ISISHIRFMQ LK+RG+SRD+LP+KA LMPGLAYY +FF+ 
Sbjct: 465 AFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVT 524

Query: 508 XXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRD 567
                QGFTAFAPKF+ ++FL AYIS FLF+ ++I+ +C FR R    ++DVDID+DRRD
Sbjct: 525 LIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDDVDIDTDRRD 584

Query: 568 IEAIVWEDHEPKTFWDKFWNVVA 590
           I+ ++WE+  P+TFWDKFW V+A
Sbjct: 585 IDTVIWEEG-PQTFWDKFWAVIA 606

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/583 (63%), Positives = 452/583 (77%), Gaps = 20/583 (3%)

Query: 17  NEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDT---FSMEENLQD 73
           NE V   +  V   + +      S+   K +EL   R      +GQDT    + + ++ +
Sbjct: 2   NESVDMRMSKVSQYEIN------SISTIKEEELICAR-----YDGQDTEEAVAGKSSINN 50

Query: 74  EDEGEVQNA-----EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           +   E + +     EVKR+LKQRH                    PLA+AGPVGALI+YLF
Sbjct: 51  DSAKETETSPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLF 110

Query: 129 MGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188
           MG++ +SVTQSLGEMATFIPVTSSF+VF+QRFLSPA GA NGYMYW SW  TFALELSV+
Sbjct: 111 MGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVL 170

Query: 189 GQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
           GQ+IQ+WT  VPL AWI IFW L+T+MN+FPVKYYGEFEF +ASIKVIA++GF+ + FC+
Sbjct: 171 GQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCI 230

Query: 249 VCGAGVTG-PVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
           VCGAG +G P+GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 231 VCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITA 290

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367
           GEAANPR+ VPRAIKKVV RIL FYI SL FIGLLVPYNDPKL    ++VS+SPF+++I+
Sbjct: 291 GEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIE 350

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
           NSGTKVLP IFNAV+L TI+SA NSN+Y+GSR+L+ LSKN LAP+FLS  +KGGVPY AV
Sbjct: 351 NSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAV 410

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
            +T+ FG LA++ETS G  KVF WLLNITGVAGFFAWL IS+SHIRFMQA+K RGISRD+
Sbjct: 411 LSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDD 470

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547
           LP++A++MP LAYY+SFF+      QGFTAFAP F    F+AAYIS+FLFIA+W+LF+  
Sbjct: 471 LPYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVW 530

Query: 548 FRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           F+CRF+WK++DVDIDSDRRDIE  VW + E KT W   W++++
Sbjct: 531 FKCRFVWKLQDVDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/579 (66%), Positives = 455/579 (78%), Gaps = 17/579 (2%)

Query: 22  TLLHDVEASQTHRRRG----SLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEG 77
           TL    ++    R+ G    S   +D+  K++  ++         D  S  E+ +  + G
Sbjct: 3   TLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQ-------TDASSTTEDEEMLNSG 55

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVT 137
            V +AEVKRELKQRH                    PL ++GPVG+LIAY+F+G+L ++VT
Sbjct: 56  SVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVT 115

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTH 197
           QSLGEMATFIPVTSSFTVF+ RFLSP+ GAA GYMYWFSWA+TFALELSVVGQ++ +WT 
Sbjct: 116 QSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF 175

Query: 198 KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP 257
            VP+AAWISIFWV++T +N+FPVK+YGE EFWVA++KV+AI+GFLIYC CMVCGAGVTGP
Sbjct: 176 AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP 235

Query: 258 VGFRYWRNPGAWGPGI------ISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
           VGFRYWRNPG WG G+      ISKNKN GRFLGW +SLINAAFT+QGTELVGITAGEAA
Sbjct: 236 VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAA 295

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGT 371
           NPRKTVPRAIKKVVFRIL FYIGSL FIGLLVP++DPKL+   SYVS+SPFI+AI+NSGT
Sbjct: 296 NPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIENSGT 355

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
           K+LP IFNA+IL TIISA NSNIYVGSRILF L+K  LAPK LSRT+K GVP+++V ATA
Sbjct: 356 KILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATA 415

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           VFG LAYMET+ GG  VF+WL+NIT +AGF+AWLFI ISHIRFMQ LK+RGISRD+LPFK
Sbjct: 416 VFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFK 475

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCR 551
           A LMPGLAYY+ F M      QGFTAF P F+ S F AAYIS+ LF  +W  F+  F+CR
Sbjct: 476 ANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCR 535

Query: 552 FIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +IWK+EDVDIDS+RRD+E I+WED EPKTFWDKFWNVVA
Sbjct: 536 WIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/535 (69%), Positives = 430/535 (80%), Gaps = 6/535 (1%)

Query: 59  VNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAG 118
           V+  DT +    L D+ E   +  +VKRELK+RH                    PL  AG
Sbjct: 13  VDSNDTPTTISTLDDDQE---KQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAG 69

Query: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           P+GALIAYLFMG++ FSVTQSLGEM TFIPVT+SFTVF+QRFLSPAFGAANGYMYWFSWA
Sbjct: 70  PIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWA 129

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
           +TFALELSVVGQ+IQFWT  VPLAAWISI WVL+TI NLFPV+ YGE EFW+AS+KV+AI
Sbjct: 130 MTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAI 189

Query: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           +GF+IY  C++CGAGVTGPVGFRYW+NPG WG GIIS N NE RF GWVSSLINAAFTFQ
Sbjct: 190 LGFIIYGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS 358
           GTELVGITAGE   PRKTVP+AIKKVVFRIL FYIGSLL IGLLVPYNDPKL    SYVS
Sbjct: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVS 309

Query: 359 TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTS 418
           +SPFI+ IQN+GTK+LPHIFNAVIL TIISA NSN+Y+GSRIL+GL+KNK APKF + TS
Sbjct: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369

Query: 419 KGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQAL 478
           K GVPY+ V  T++FG+LAYMET+TGGDK F WLLNI GVAGFFAWL IS SHIRFM+AL
Sbjct: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429

Query: 479 KYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFI 538
           K RGISR++LP+KA LMP LAYY+ FFM      QGFT+FAPKF  ++F AAYIS+FLFI
Sbjct: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFI 489

Query: 539 AVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWED---HEPKTFWDKFWNVVA 590
             W+ F+  F+CR +WK++DVD+D+DRRDIE  VW D    + K +WD+FWN VA
Sbjct: 490 IFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/548 (68%), Positives = 437/548 (79%), Gaps = 7/548 (1%)

Query: 43  DEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXX 102
           DEK++ +  +    TG       S   ++   DEG VQ+AEVKR LK RH          
Sbjct: 48  DEKTRVVSQVSPMRTG-------SPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTI 100

Query: 103 XXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                     PLA+AGPVGALIAY+FMG++A+ VTQSLGEMATFIPVTSSFTVF+QRFLS
Sbjct: 101 GTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLS 160

Query: 163 PAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKY 222
           PAFG ANGY+YWFSW ITFALELSVVGQ+IQFWT  VPL AWI+IFWV++T  NLFPVKY
Sbjct: 161 PAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKY 220

Query: 223 YGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGR 282
           YGE EFW+A IKV+AI+GF+IY F MVCGAG TGPVGFRYWRNPG WGPGIISK+ NEGR
Sbjct: 221 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 280

Query: 283 FLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLL 342
           FLGWVSSLINAAFT+QGTELVGITAGE+ NPR+TVPRAI KV FRIL FYI SLLFIGLL
Sbjct: 281 FLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLL 340

Query: 343 VPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILF 402
           VP+NDPKL    SY+S+SPF++AI+NSGTKVLPHIFNAVIL+TIISA NSNIYVGSR+L+
Sbjct: 341 VPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLY 400

Query: 403 GLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFF 462
           GL+KNKLAPK  +R +K GVPYI+V  TA FG LAY+  S    KVF+WLLNIT +AGFF
Sbjct: 401 GLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFF 460

Query: 463 AWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF 522
           AWLFIS++HIRFMQ LK R +SR++LPFKAK MP  AYYS+FF+      QGFTAFAPKF
Sbjct: 461 AWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFAPKF 520

Query: 523 NGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFW 582
           N S+F AAYIS+FLF+A+W++F+  FR RFI    DVDID+DRRDI+ IVWE+  PK  W
Sbjct: 521 NVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEEETPKNAW 580

Query: 583 DKFWNVVA 590
           DKFW  +A
Sbjct: 581 DKFWAAMA 588

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/523 (68%), Positives = 420/523 (80%)

Query: 68  EENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           E+ +  E  G V+  +VKR LK RH                    PL+NAGPVGALIAY+
Sbjct: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85

Query: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
           F+G+LA+SVTQSLGEMATFIPVTSSFTVF+QRFLSPA G+ANGY+YW SWAITFALELSV
Sbjct: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145

Query: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
           VGQ+IQFWT  VPL AWI+IFWV++TI NLFPVKYYGE EFW+A IKV+AI+GF+IY F 
Sbjct: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205

Query: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
           MVCGAG TGPVGFRYWRNPG WGPGIISK+ NEGRFLGWVSSLI+AAFT+QGTELVGITA
Sbjct: 206 MVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367
           GEAANPRKTVPRAI KV FRIL FYI SLLFIGLLVP+NDPKL    SY+S+SPF++AI+
Sbjct: 266 GEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIE 325

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
           NSGTKVLPHIFNAVIL+TIISA NSN+YVGSRI + ++ N LAPK+L+ T+K G+PY AV
Sbjct: 326 NSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAV 385

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
             T+V G LAY+E+S+G   VF WLLNIT VAGFF W+ ISISHIRFMQALK++GISRD+
Sbjct: 386 LTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDD 445

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547
           LPFKAK MP  AYY++FF+      QGFTAFAPKF  S F  AYIS+ LF   WI F+  
Sbjct: 446 LPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIW 505

Query: 548 FRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           FR     K ED+D+D+DRR+I+ +VWE+ +P+  W+KFW  +A
Sbjct: 506 FRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/540 (65%), Positives = 432/540 (80%), Gaps = 6/540 (1%)

Query: 57  TGVNGQDTFSMEENLQDEDEGEVQNA-----EVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
           +G N     + E  ++D+   E +++     EVKR+LKQRH                   
Sbjct: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIG 93

Query: 112 XPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGY 171
            PLA+AGPVGALI+YLFMG++ +SVTQSLGEM TFIPVTSSF+VF+QRFLSPA GA NGY
Sbjct: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153

Query: 172 MYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVA 231
           MYW SW  TFALELSV+G+VIQ+WT  VPLAAWI IFW L+T MN+FPVKYYGEFEF +A
Sbjct: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213

Query: 232 SIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSL 290
           SIKVIA++GF+I+ FC+VCGAG + GP+GFRYWRNPGAWGPGIIS +KNEGRFLGWVSSL
Sbjct: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           INAAFT+QGTELVGITAGEAANPRK +PRAIKKVV RIL FYI SL FIGLLVPYNDPKL
Sbjct: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333

Query: 351 TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLA 410
                +VS+SPF+++I+NSGTKVLP IFNAV+L TI+SA NSN+Y+GSR+L+ LSKN LA
Sbjct: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393

Query: 411 PKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISIS 470
           P+FLS  ++GGVPY +V +T+VFG LA++E S G  K F WLLNITGVAGFFAWL IS S
Sbjct: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAA 530
           HIRFMQA++ RGISRD+LP+KA++MP LAYY+SFF+      QGFTAFAP F    F+AA
Sbjct: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA 513

Query: 531 YISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           YISIFLF+A+W+ F+  F+CR +WK++D+DIDSDRR IE +VW + E KT W + W+V++
Sbjct: 514 YISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/592 (60%), Positives = 446/592 (75%), Gaps = 4/592 (0%)

Query: 3   NPKQEAEIEEKHMYNEPV--TTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60
            P  + E++E+++  E    + +L +     T     S  LK   + E     + PTG  
Sbjct: 8   KPCPQKELKERNILREEAGSSDVLPNDTNITTATSVASFELKSTNASEAASQSTSPTGSE 67

Query: 61  G-QDTFSMEENLQDE-DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAG 118
              D      N      E  V++  VKR LK RH                    PL NAG
Sbjct: 68  LIPDCLQSATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAG 127

Query: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           PVGALIAY+F+G++ FSVTQSLGEM TFIPVTSSFTVFS RFLSPAFGAANGYMYWFSWA
Sbjct: 128 PVGALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWA 187

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
           +TFA+ELSV+G+VIQFWT  VPLAAWI IFW L+T+ N+FPVKYYGE EFW+A +KV+++
Sbjct: 188 MTFAVELSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSL 247

Query: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           +GFLI+C C+  GAG  GP GFRYWR+PGAWGPGII+++++E RFLGWVSSLINAAFT+Q
Sbjct: 248 VGFLIFCLCITSGAGPHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQ 307

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS 358
           GTELVGITAGEAANPRK VP+AIKKV+ RIL FY+GSL FIG+LVP+NDPKLT ATS+VS
Sbjct: 308 GTELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVS 367

Query: 359 TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTS 418
           +SPFI+AIQNSG  +LP IFN VIL TIISA NSN+YVGSRILFGL+ + LAP+F +RT+
Sbjct: 368 SSPFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTT 427

Query: 419 KGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQAL 478
           K GVP++AV  T++FG+LA++E +T GDKVF WLL+I  +AGFFAWL IS+SHIRFM+AL
Sbjct: 428 KTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKAL 487

Query: 479 KYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFI 538
           +YRGISR+ LPFKA  MP LAYY++ F+      QGFTAFAP+FN S F+A+YIS+ LF+
Sbjct: 488 EYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFV 547

Query: 539 AVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
            +W +F+ + +CR  WK+ED+D+DSDR+DIE I WED  PKTFW K W  +A
Sbjct: 548 IIWGVFQAMKKCRIFWKVEDIDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/565 (63%), Positives = 432/565 (76%), Gaps = 3/565 (0%)

Query: 26  DVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVK 85
           D+   +T   +  + +K  +S E + L+      N   T   +EN+ + ++ E    EVK
Sbjct: 5   DINTEETLEGKSKIVIKSTESLEQHDLQG-NEDKNTPTTTPSKENVSENEKDEYH--EVK 61

Query: 86  RELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT 145
           R+L +RH                    PL  +GPVG+LIAYLF+G++ +SVTQSLGEMAT
Sbjct: 62  RDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121

Query: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWI 205
           FIPVT+SFT+FS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+IQFWT  VPL AWI
Sbjct: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWI 181

Query: 206 SIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRN 265
           SIFWV++TI NLFPV+ YGE EFW+A +KV AI+GF+IYCFC+VCGAG TGPVGFRYWRN
Sbjct: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRN 241

Query: 266 PGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325
           PG WG GIIS N  E RFLGW SSLINAAFTFQGTELVGITAGEAANPR+TVP+AI+KVV
Sbjct: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301

Query: 326 FRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTT 385
           FRIL FYI SL FIGLLVPY+D KL    SYVS+SPFI+AI+NSGTK+LPHIFN VIL T
Sbjct: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361

Query: 386 IISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGG 445
           IISA NSN+Y+GSR+LFGL+KN   PK  ++T+K GVP  AV  T++FGALA+METSTGG
Sbjct: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421

Query: 446 DKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFF 505
           D+ F+WLLN+ GVAGFF+WL IS +HIRFMQ L+ RGISR++LPFKAK MP LAYY++  
Sbjct: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481

Query: 506 MXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDR 565
           M      QGFTAFAPKF+  +F A+YIS+FLF   W  F+  F+CR++WK+ D+DID DR
Sbjct: 482 MIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKDR 541

Query: 566 RDIEAIVWEDHEPKTFWDKFWNVVA 590
           R+IE  VW+D  P   W KFW+ VA
Sbjct: 542 REIEDRVWQDTTPANLWGKFWDFVA 566

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/574 (63%), Positives = 439/574 (76%), Gaps = 15/574 (2%)

Query: 26  DVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDT-FSMEENLQDEDEGEV----- 79
           D+  S+  +R  + S    K KEL   +        QDT  ++  N   E++G       
Sbjct: 6   DICTSKEGKREAN-SAPTIKEKELVDAQ-----YEEQDTSAAIAANSSIENDGAKGTETS 59

Query: 80  --QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVT 137
                EV+R+LK+RH                    PLA+AGPVGALI+YLFMG++ +SVT
Sbjct: 60  PRSRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVT 119

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTH 197
           QSLGEMATFIPVTSSF+VF+QRFLSPA GA NGYMYW SW  TFALELSV+GQ+IQ+WTH
Sbjct: 120 QSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTH 179

Query: 198 KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGV-TG 256
            VPLAAWI IFW L+T+MN+FPVKYYGEFEF +ASIKVI ++GF+I+ FC+VCGAG   G
Sbjct: 180 AVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDG 239

Query: 257 PVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
           P+GFRYWRNPGAWGPGIIS NKNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK 
Sbjct: 240 PIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 299

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPH 376
           VPRAIKKVV RIL FYI SL FIGLLVPYNDPKL    ++VS SPF+++I+NSGTKVLP 
Sbjct: 300 VPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPD 359

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
           IFNAV+L TI SA NSN+Y+GSR+L+ LSKN LAPK LS  ++GGVPY+AV  T++FG L
Sbjct: 360 IFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFL 419

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++ETS G  K F WLLNITGVAGFFAWL IS SHIRFMQA+K RGISRD+LP+KA++MP
Sbjct: 420 AFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMP 479

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKI 556
            LAYY+SFF+      QGFTAFAP F    F+AAYIS+FLF  +W+ F+  F+CR I K+
Sbjct: 480 FLAYYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKL 539

Query: 557 EDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +D+DIDSDRR+IE  VW + E KT W + W++++
Sbjct: 540 QDIDIDSDRREIEEQVWIEPECKTRWQRVWDILS 573

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/522 (68%), Positives = 417/522 (79%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           E     D    Q   ++R LK RH                    PL +AGPVG+LI+YLF
Sbjct: 34  EQQSQIDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLF 93

Query: 129 MGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188
           MGSLAF VTQSLGEMATFIPV SSFTVF++RFLSPA GAANGYMY FSW ITFALELS+V
Sbjct: 94  MGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIV 153

Query: 189 GQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
           G++IQ+WT  VP AAWI IFWV I++ NL  VK+YGEF+FW+A IKVIAI+GFLIYC CM
Sbjct: 154 GEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCM 213

Query: 249 VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308
           VCGAG TGPVGFRYWRNPG WG GIISK+K+EGRFLGWVSSL+NAAFT+QGTELVG++AG
Sbjct: 214 VCGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAG 273

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQN 368
           E+ANPRKTVP+AI+KV  RIL FY+GSL FIGLLVP+NDPKL    +Y ++SPFI+AIQN
Sbjct: 274 ESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQN 333

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVF 428
           SGT+ LP IFNAVILTTIISAANSN+YVGSR+L+GL+K  LAPK + R ++ GVPYI V 
Sbjct: 334 SGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVG 393

Query: 429 ATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDEL 488
             ++FG L Y+  S+G  K F+WLLNIT +AGFFAWLFIS+ HIRFMQALKY+GISRD+L
Sbjct: 394 IVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDL 453

Query: 489 PFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIF 548
           PFKAKLMP  AYY++FF+      QGFTAFAPKFN S+F AAY+S+FLFIAVW++F+ IF
Sbjct: 454 PFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIF 513

Query: 549 RCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           + R I K+EDVDIDSDRR+IEA VWED EP   W KFW  +A
Sbjct: 514 KSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/579 (61%), Positives = 450/579 (77%), Gaps = 5/579 (0%)

Query: 16  YNEPVTTLLHDVEASQTHRRRGSLS---LKD-EKSKELYPLRSFPTGVNGQDTFSMEENL 71
           Y  P+    H++++S+ +  + SL+   +K+ ++S    P  +   G    + + +++++
Sbjct: 3   YKGPLEFNQHELDSSKENTDKPSLNETYVKEYDRSISSPPKENDGYGYRVDNEYDVDDSV 62

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGS 131
            D ++GEV++ EVKR LK RH                    PL NAGPVG LIAYLFM +
Sbjct: 63  -DGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMAT 121

Query: 132 LAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQV 191
           +AFSV QSLGEMAT+IPVTS+F+VFSQRFLSPAFGAANGYMYWFSW+ITFALELSV+GQ+
Sbjct: 122 IAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQI 181

Query: 192 IQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           +Q+WT KVP+AAWISIFWVLI  +N  PVK+YGEFEFW+A IKV+AI+GF+IYCF MVCG
Sbjct: 182 VQYWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCG 241

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
           AG TGPVGFRYWR+  A+G GIISKNKNE RFLGWVSSLINAAFT+QGTELVGITAGEAA
Sbjct: 242 AGKTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA 301

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGT 371
           NPRKTVP++IK+ ++RIL FYI SLLF+GLLVP+ND  L ++ SY ++SPFI+AI+NSGT
Sbjct: 302 NPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSGT 361

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
           K LP IFNAVILTT+ISAANS++YVGSR+++ +++N+LAP  L++ SKGGVPY AV  T+
Sbjct: 362 KALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTS 421

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
             GALAY+ETS+ G  VF WL+NITGVAGFF+W  IS SH+RFM+ALK RGISR++LPFK
Sbjct: 422 AIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFK 481

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCR 551
           A  MP +A YS FFM      QGFT F P F  S F+A+YIS+ LF  +W +F+  FRC 
Sbjct: 482 ASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCP 541

Query: 552 FIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
            +  I ++DID+DRRD++A VWED  PKT WDKFWN+VA
Sbjct: 542 LLVPIAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/560 (63%), Positives = 434/560 (77%), Gaps = 3/560 (0%)

Query: 31  QTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQ 90
           +T  + G +S K E   E Y + SF      Q+  S +++ Q    G  +NA V+R+LK 
Sbjct: 3   KTSEKEG-MSQKTETRLEDYEMGSFAEEALDQEAQSSQDS-QLGSSGHGRNA-VQRQLKP 59

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVT 150
           RH                    PL NAGPVGALI+YLFMGS+A+ VTQSLGEMATFIPVT
Sbjct: 60  RHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVT 119

Query: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWV 210
           SSFTVF++RFLS   GAANGYMY FSW++T+ALELS+VGQ+I++WT  VP AAWI+IFWV
Sbjct: 120 SSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWV 179

Query: 211 LITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWG 270
            IT+ NL PVK+YGEF+FW+A IKV+AIIGFL+YC CMVCGAG TGPVGFRYWRNPG WG
Sbjct: 180 PITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWG 239

Query: 271 PGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330
            GIIS + +EGRFLGWVSSL+NAAFT+QGTELVGI+AGE+ANPRKTVP+AI KV FRIL 
Sbjct: 240 DGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILL 299

Query: 331 FYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAA 390
           FY+GSL FIGLLVP+ND KLT + SY + SPFI+AIQNSGTK+LP IFNAVIL TIISAA
Sbjct: 300 FYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAA 359

Query: 391 NSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFE 450
           NSN+YVGSR+L+GL+K +LAP+F +RT++ GVP +AV   A FG L Y+  S G  K F+
Sbjct: 360 NSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFD 419

Query: 451 WLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXX 510
           WLLNIT +AGFF+WLFIS+ H+RFMQALK +GISRD+LPFKAKLMP  AYYS+FF+    
Sbjct: 420 WLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLII 479

Query: 511 XXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEA 570
             QGFT+ AP FN S+F AAYIS+F+F+ +W +F+C +R R I +IE VDIDSDRR+++A
Sbjct: 480 IIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDA 539

Query: 571 IVWEDHEPKTFWDKFWNVVA 590
             W++ EP T W KFW  +A
Sbjct: 540 QQWDNTEPTTLWGKFWAAMA 559

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/564 (64%), Positives = 430/564 (76%), Gaps = 16/564 (2%)

Query: 27  VEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKR 86
           + A Q H      S K++ S+EL    S       +D  S+E        G V+  +VKR
Sbjct: 1   MSAQQHHS-----SEKEKNSEELVSEFS-----RSKDVVSLE------SLGSVKETQVKR 44

Query: 87  ELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATF 146
            LK RH                    PL+NAGPVGALIAY+F+G+LA+ V+QSLGEMATF
Sbjct: 45  ALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATF 104

Query: 147 IPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWIS 206
           IPVTSSF VF+QRFLSPA GAANGYMY+ SW+ITFALELSVVGQVIQFWT  VPL AWI 
Sbjct: 105 IPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWII 164

Query: 207 IFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNP 266
           I WV++   NL PVK+YGE EFW+A IKV+AI+GF+IY F MVCGAG TGPVGFRYWRNP
Sbjct: 165 ILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNP 224

Query: 267 GAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVF 326
           G WGPGIISK+ NEGRFLGWVSSLI+AAFT+QGTELVGITAGEAANPRKTVPRAI KV F
Sbjct: 225 GPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFF 284

Query: 327 RILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTI 386
           RIL FYI SLLFIGLLVP+NDPKL    SY+S+SPF++AI+NSGTKVLPHIFNAVIL+TI
Sbjct: 285 RILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTI 344

Query: 387 ISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGD 446
           ISA NS++Y+ SR+L+ +  N LAPK+L+ T+K G+PY AV  T++ G LAY+E+S G  
Sbjct: 345 ISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGAS 404

Query: 447 KVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFM 506
            VF+WLLNIT VAGFFAW+ IS++HIRFMQALK++GISRD+LPFKAK MP  AYY++FF+
Sbjct: 405 VVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFI 464

Query: 507 XXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRR 566
                 QGFTAFAPKFN S F  AY+S+ LF AVWI F+  FR     K ED+D+D+DRR
Sbjct: 465 GVIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRR 524

Query: 567 DIEAIVWEDHEPKTFWDKFWNVVA 590
           +I+  VWE+ EPK  W+KFW+ VA
Sbjct: 525 EIDNDVWEEDEPKNLWEKFWSAVA 548

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/603 (63%), Positives = 443/603 (73%), Gaps = 35/603 (5%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60
           MT+  Q+ E+EE           LH    SQ+   R  + + + K  +  PLR       
Sbjct: 1   MTSIAQQIELEELEA--------LHS-NLSQSQSARSGMHVSNSKIDD--PLR------- 42

Query: 61  GQDTFSMEENLQ----DED-------EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXX 109
               FS + NL     D+D       EG +  AEVKR LK RH                 
Sbjct: 43  ----FSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFIS 98

Query: 110 XXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAAN 169
              PL NAGPVG+LIA++ +G+LA+SVTQSLGEMATFIPVTSSFTVFSQRF+SPA GAAN
Sbjct: 99  ISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAAN 158

Query: 170 GYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFW 229
           GYMYWFSWAITFALELS+VGQ+IQ+WT  VPL AWI+IFWVL+   N+FPVK+YGEFEFW
Sbjct: 159 GYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFW 218

Query: 230 VASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSS 289
           VASIKVIAIIGFLIY  CMVCGAG  GP+GFRYWR PG WG GII+KN N+ RFLGWVSS
Sbjct: 219 VASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSS 278

Query: 290 LINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPK 349
           LI+AAFT+QGTELVGITAGE  NPRK VPRAI KV FRIL FYIGSL FIGLLVPYNDPK
Sbjct: 279 LISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPK 338

Query: 350 L--TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
           L  ++  SY++ SPF++AI N  T VLPHIFNAVILTTIISA NSN+YVGSRILFGLSKN
Sbjct: 339 LEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKN 398

Query: 408 KLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
            LAPKF S+T+K GVP+IAV  TAVFG LAY+  S    +VF+WLLNIT +AGF  WL I
Sbjct: 399 NLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLI 458

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSF 527
           SISHIRFMQ LK+RGISRD+LP+KAK MP  AYY++FF+      QGFTAFAP FN S F
Sbjct: 459 SISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDF 518

Query: 528 LAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWN 587
            AAYIS+FLF  VW +F+ I+R +    +++VDIDSDRRDI+ I+WE+ EPK  W+KFW 
Sbjct: 519 FAAYISVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWA 578

Query: 588 VVA 590
           V A
Sbjct: 579 VAA 581

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/479 (72%), Positives = 405/479 (84%), Gaps = 1/479 (0%)

Query: 113 PLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYM 172
           PLA+AGPVGALI+Y+FMG++ +SVTQSLGEMATFIPVTSSF+VF+QRFLSPA GA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 173 YWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
           YW SW  TFALELSV+GQ+IQ+WT  VPL+AWI IFW L+T+MN+FPVKYYGEFEF +AS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 233 IKVIAIIGFLIYCFCMVCGAGV-TGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
           IKVIA++GF+IY FCMVCGAG   GP+GFRYWRNPGAWGPGIIS +KNEGRFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           NAAFT+QGTELVGITAGEAANPRK VPRAIKKVV RIL FYI SL FIGLLVPYNDPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 352 EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
              S+VS SPF+++I+NSGTKVLP IFNAV+L TI+SA NSN+Y+GSR+L+ LSKN LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 412 KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           +FLS  +KGGVPY AV AT+VFG LA++ETS G  K F WLLNITGVAGFFAWL IS SH
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAY 531
           IRFMQA+  RGISR++LP+KA++MP LAYY+SFF+      QGFTAFAP F    F+AAY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 532 ISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           IS+FLF+A+W  F+  F+C  I K++DVDIDSDRR+IE  VW +   KT W   W+V+A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/553 (61%), Positives = 421/553 (76%), Gaps = 2/553 (0%)

Query: 39  LSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQ-DEDEGEVQNAEVKRELKQRHXXXXX 97
           ++L+  K  E+  L S  + ++   T S+ ++ + D +E + Q+  VKR LKQRH     
Sbjct: 59  ITLRKSKLSEIGSLHS-GSNLHQHGTTSLHDDEESDTEEAQYQDTRVKRALKQRHIGMIA 117

Query: 98  XXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFS 157
                          PL+NAGPVG+LIAY+FMGS+ + VTQSLGEMATFIPVTSS TVFS
Sbjct: 118 LGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFS 177

Query: 158 QRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNL 217
           +RFLSPAFG ANGYMYWF+WAIT+A+E+SV+GQVIQ+WT  VPLAAWI IFWV++T+MN 
Sbjct: 178 KRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNF 237

Query: 218 FPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKN 277
           FPVK YGEFEFW+ASIKV+AI+G+LIY   +VCG    GP+GFRYWRNPG WGPGIIS  
Sbjct: 238 FPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGPWGPGIISDK 297

Query: 278 KNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
             E RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAI KVVFRI  FYI SL 
Sbjct: 298 TGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLF 357

Query: 338 FIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           FIGLLVP+ND +L   ++ +++SPF+++IQN+GT+ LP IFNAV+L TIISAANSN+YVG
Sbjct: 358 FIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVG 417

Query: 398 SRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITG 457
           SR+L+ L+    APK  S  +K GVPY+ V  TA  G LA++  +   +  F WL+NI+ 
Sbjct: 418 SRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINIST 477

Query: 458 VAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTA 517
           +AG  AWLFIS+SHIRFMQALKYRGISRD+LPFKAKLMP  AYY+SFF+      QGF A
Sbjct: 478 LAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQA 537

Query: 518 FAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHE 577
           F PKF+ S+F  +YIS+ L   ++   +  +RCRFIWK+ED+DIDSDRR+IEAI+WE+ E
Sbjct: 538 FTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDSDRREIEAIIWEEDE 597

Query: 578 PKTFWDKFWNVVA 590
           PK  W+KFW  VA
Sbjct: 598 PKNLWEKFWAWVA 610

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/508 (65%), Positives = 408/508 (80%), Gaps = 1/508 (0%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGE 142
            VKR LKQRH                    PL+NAGPVG+LIAY+FMG++ + +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLA 202
           MATFIPVTSS TVFS+RFLSPAFG +NGYMYWF+WAIT+A+E+SV+GQVIQ+WT KVPLA
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRY 262
           AWI+IFWVLIT+MN FPVK YGEFEFWVAS+KV+AI+G+LIY   +VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 263 WRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 322
           WRNPGAWGPGIISKNK+EGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPRAI 
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVI 382
           KVVFRI+ FYI SL FIGLLVPYN+P+L+ +++ +++SPF+++IQN+GT  LP IFNAV+
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETS 442
           L T+ISAANSN+YVGSR+L+ L+++  APK     +K GVPY+ V +TA  G LA++  +
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYS 502
              +  F WL++I+ +AG  AWLFIS++HIRFMQALK RGISRD+LPFKAKLMP  AYY+
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 503 SFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDID 562
           SFF+      QGF AF P F+ S F  +YIS+ L   V+I  +  ++CRFIWK+ED+DID
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 563 SDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           SDRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/599 (57%), Positives = 439/599 (73%), Gaps = 15/599 (2%)

Query: 5   KQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKE------------LYPL 52
           +++  I E+ M   P   + H++EA     +    S+ DEK               +  +
Sbjct: 15  EKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYSI-DEKQYNTKKKHGSLQGGAIADV 73

Query: 53  RSFPTGVNGQDTFSMEENL-QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
            S    +      S E ++ +DE+E   ++  VKR LKQRH                   
Sbjct: 74  NSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGIS 133

Query: 112 XPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGY 171
            PL+NAGPVG+LIAY+FMG++ + VTQSLGEMATFIPVTSS TVFS+RFLSPAFG +NGY
Sbjct: 134 TPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGY 193

Query: 172 MYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVA 231
           MYWF+WAIT+A+E+SV+GQVI++WT KVPLAAWI+IFWV+IT+MN FPVK YGEFEFWVA
Sbjct: 194 MYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVA 253

Query: 232 SIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
           S+KV+AI+G+LIY   +VCG    GP+GFRYWRNPGAWGPGIIS +K+EGRFLGWVSSLI
Sbjct: 254 SVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLI 313

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           NAAFT+QGTELVGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIGLLVPYND +L+
Sbjct: 314 NAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLS 373

Query: 352 EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
            +++ +++SPF+++IQN+GT  LP IFNAV+L T++SAANSN+YVGSR+L+ L++   AP
Sbjct: 374 ASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAP 433

Query: 412 KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           K     ++ GVPY+ V  TA  G LA++  +   +  F WL+NI+ +AG  AWLFIS++H
Sbjct: 434 KQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAH 493

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAY 531
           IRFMQALK+RGISRD+LPFKAKLMP  AYY++FF+      QGF AF P F  S F  +Y
Sbjct: 494 IRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSY 552

Query: 532 ISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           IS+ L   V+I  +  ++CRFIWK+ED+DIDSDRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 553 ISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/568 (59%), Positives = 433/568 (76%), Gaps = 3/568 (0%)

Query: 25  HDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDED--EGEVQNA 82
           H+ + S T    G    +D+   EL+PL      V  +   ++ + L++ED  E    + 
Sbjct: 7   HEKDDSPTISPVGKTE-QDKYGYELHPLDPVTQQVTLRTVTNVCDGLEEEDAEEAGYHDT 65

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGE 142
            VKR LKQRH                    PL+NAGPVG+LIAYLFMGS+ + +TQSLGE
Sbjct: 66  RVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGE 125

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLA 202
           MATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E+SV+GQVIQFWT  VPLA
Sbjct: 126 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAVPLA 185

Query: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRY 262
           AWI+IFWV ++++N FPVK YGE EFWVASIKVIAI+G+LIY   +VCG    GP+GFRY
Sbjct: 186 AWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGSSQGPIGFRY 245

Query: 263 WRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 322
           WRNPG WGPGIIS +KNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAI 
Sbjct: 246 WRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 305

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVI 382
           KVVFRI+ FYI SL F+G+LVP+NDP+L    + +++SPF+++IQN+GT+VLPHIFNAV+
Sbjct: 306 KVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNAGTRVLPHIFNAVV 365

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETS 442
           + TIISAANSN+YVGSR+L+ LS+   APK     ++ GVPY+ V AT++ G LA++  +
Sbjct: 366 MLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVN 425

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYS 502
              +  F WL+NI+ +AG  AWLFIS+SHIRFMQALK+RGISRD+LPFKAKLMP  AYY+
Sbjct: 426 NNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYA 485

Query: 503 SFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDID 562
           +FF+      QGF AF+PKF+ S F  AYIS+ + + + I  +  +RCRF+WK+ED+DID
Sbjct: 486 AFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDID 545

Query: 563 SDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DRR+IE I+WE+ EP+  W+KFW+++A
Sbjct: 546 TDRREIECIIWEEEEPQNLWEKFWSIMA 573

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/586 (57%), Positives = 426/586 (72%), Gaps = 13/586 (2%)

Query: 18  EPVTTLLHDVEASQTHRRRGSLSLKDEK----SKELYPLRSFPTGVNGQDTFSMEENLQD 73
           E  T+ +H +E        G  ++ DEK     K+L     F   +N          +  
Sbjct: 14  EKDTSEIHSIEEGNNVYENGIETINDEKIVFDKKKLAHTNQFNADINSITHSLTRSRIAT 73

Query: 74  EDEGEV---------QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALI 124
             E +           + +VKR LKQRH                    PL N+GPVG+LI
Sbjct: 74  HHEDDQEEEAEEAQYHDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLI 133

Query: 125 AYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
           AYLFMGS+ + +TQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAITFA+E
Sbjct: 134 AYLFMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVE 193

Query: 185 LSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           +SVVGQVI++WT KVPLAAWI+IFWVLIT++N FPVK YGE EFW+A IKV+AI+G+L+Y
Sbjct: 194 ISVVGQVIEYWTDKVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLY 253

Query: 245 CFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVG 304
              +VCG    GP+GFRYWRNPG WGPGIISK+ N GRFLGWVSSLINAAFT+QGTELVG
Sbjct: 254 ALIIVCGGSSQGPIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVG 313

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIV 364
           ITAGEAANPRKTVPRAI KVVFRI  FYI SL FIG+LVPYND +L   ++ +++SPF++
Sbjct: 314 ITAGEAANPRKTVPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVI 373

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           +IQN+GTKVLP IFNA+++ TIISAANSN+YVGSR+L+ L+ +  APK  +  ++ GVPY
Sbjct: 374 SIQNAGTKVLPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPY 433

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           + V  T+  G LA++  +   +  F WL+NI+ +AG  AWLFISISHIRFMQALK+RGIS
Sbjct: 434 LGVIVTSALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGIS 493

Query: 485 RDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILF 544
           RD+LPFKAKLMP  AYY++FF+      QGF AF+P ++ ++F  +YIS+ +   ++I  
Sbjct: 494 RDDLPFKAKLMPFGAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGC 553

Query: 545 ECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +  +RCRF W++ED+DIDSDRR+IEA++WED EPKT WDKFW  VA
Sbjct: 554 QIFYRCRFFWRVEDIDIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/568 (59%), Positives = 422/568 (74%), Gaps = 10/568 (1%)

Query: 26  DVEASQTHRRRGSLSLK---DEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNA 82
           D +   + R++ +++ K   D+ S  +  +    +  NG    S       E+ G VQ+ 
Sbjct: 39  DTDMEPSQRKKAAMAGKLFSDQLSYNV-SVADNSSAANGDLDLS-----DTEEAGHVQDT 92

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGE 142
            VKR LKQRH                    PL NAGPVGALIAY+FMGS+ + +TQSLGE
Sbjct: 93  RVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGE 152

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLA 202
           MATFIPVTSS TVFS+RFLSPAFG  NGYMYWF+WAIT+A+E+SVVGQVIQ+WT  VPLA
Sbjct: 153 MATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDAVPLA 212

Query: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRY 262
           AWI+IFWV +T++N FPVK YGE EFWVASIKV+AIIG+LIY   +VCG    GP+GFRY
Sbjct: 213 AWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSSQGPIGFRY 272

Query: 263 WRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 322
           WRNPG WGPGIISK+ NEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAI 
Sbjct: 273 WRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 332

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVI 382
           KVVFRI  FYI SL FIGLLVPYND  L+   SY+++SPF+++IQN+GT  LP IFNAV+
Sbjct: 333 KVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTYALPDIFNAVV 392

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETS 442
           + TIISAANSN+YVGSR+L+ L++   APK  +  +K GVP++ V  TA  G LA++  +
Sbjct: 393 MLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVN 452

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYS 502
              +  F WL+NI+ +AG  AW FI++SHIRFMQALKYRGISRD+LPFKAKLMP  AYYS
Sbjct: 453 NNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYS 512

Query: 503 SFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDID 562
           +FF+      QGF AF P ++ ++F  +YIS+ L + V+I  +  +RCRF+ K+ED+DID
Sbjct: 513 AFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVEDIDID 571

Query: 563 SDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 572 TDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/590 (57%), Positives = 431/590 (73%), Gaps = 12/590 (2%)

Query: 7   EAEIEEKHMYNEPV--TTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDT 64
           E E++  H   E +  TT  +D +   T      +  K +   +++      T VN   +
Sbjct: 25  EFEMQSIHSNAEKLRSTTYAYDDKKDMTVTYDNEILEKKDSKSDIF------TSVNRYAS 78

Query: 65  FSMEENLQ----DEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
              E  +     D  E E ++ +VKR LK RH                    PL  +GPV
Sbjct: 79  HPSEARISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPV 138

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           G+LIAY+FMG++ + VTQ+LGEMATFIPVTSS TVFS RFLSPAFG +NGY+YWF+WAIT
Sbjct: 139 GSLIAYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAIT 198

Query: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
           +A+E+SVVGQVI+FWT KVPLAAWISIFWVL+T +N FPV  YGE EFWVAS+KV+AI+G
Sbjct: 199 YAVEISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVG 258

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
           +LIY   +VCG    GP+GFRYWR+  A G G+ISK+KNE RFLGWV+SLINAAFT+QGT
Sbjct: 259 YLIYALVIVCGGSKQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGT 318

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360
           ELVGITAGEAANPRK+VPRAI KVVFRI+ FYI SL FIGLLVPYNDPKL  ATSY+++S
Sbjct: 319 ELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASS 378

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           PF+++I+N+GT+ LPHIFNA+I+ TIISAANSN+YV SR+L+ L+ +  APK  +R +  
Sbjct: 379 PFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQ 438

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVP++ V  TA+ G LA++  +   ++ F WL+NI+ +AG  AWLFIS+SH+RFM+ALKY
Sbjct: 439 GVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKY 498

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAV 540
           RGISRD+LPFKA+ MP  +YY+ FF+      QGFTAF+PKF+ +SF  AYIS+ L   +
Sbjct: 499 RGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVL 558

Query: 541 WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +I  +  +RCRF WK+ED+DID+DRR+I+ IVWED EPKT WDKFW  VA
Sbjct: 559 FIGCQLYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/591 (58%), Positives = 433/591 (73%), Gaps = 13/591 (2%)

Query: 11  EEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEEN 70
            EK+  NE   +  H  E  +    R         ++  +  ++  TG +  DT S+   
Sbjct: 9   NEKNEKNEASASTSHASEDIEIIPSRYDNEKFYSATEATHKKKTGSTGFD--DTISLTHT 66

Query: 71  LQDED-----------EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
           L               E EV +  VKR LKQRH                    PL+N+GP
Sbjct: 67  LSRSRIPTSMEDEDAEEAEVHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGP 126

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAI 179
           VGALIAY+FMG++ + VTQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAI
Sbjct: 127 VGALIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAI 186

Query: 180 TFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAII 239
           T+A+E+SV+GQVIQ+WT KVPLAAWI IFWVLIT+MN FPVK YGEFEFWVASIKVIAI+
Sbjct: 187 TYAVEVSVIGQVIQYWTFKVPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIV 246

Query: 240 GFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQG 299
           G+LIY   +VCG    GP+GFRYWRNPGA G GIIS +  E RFLGWVSSLINAAFT+QG
Sbjct: 247 GYLIYALIIVCGGSHQGPIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQG 306

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVST 359
           TELVGITAGEAANPRK+VPRAI KVVFRI+ FYI SL F+GLLVPYNDP+L+ +++ +++
Sbjct: 307 TELVGITAGEAANPRKSVPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIAS 366

Query: 360 SPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSK 419
           SPF+++IQN+GTKVLP IFNAV+L T+ISAANSN+YVGSR+L+ L+++  APK  +  ++
Sbjct: 367 SPFVISIQNAGTKVLPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTR 426

Query: 420 GGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            GVPY+ V  TA+ G LA++  +   +  F WL+NI+ +AG  AWLFIS++HIRFMQALK
Sbjct: 427 HGVPYLGVICTALLGLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALK 486

Query: 480 YRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIA 539
           +RGISRD+LPFKAK MP  AYY+SFF+      QGF AFAPKF+ S F  AYIS+ L + 
Sbjct: 487 FRGISRDDLPFKAKFMPWGAYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVV 546

Query: 540 VWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           ++   +  +RCRF+WK+ED+DIDSDRR+I+AIVWED EP+  W+KFW  VA
Sbjct: 547 LFAGCQLYYRCRFLWKLEDIDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/593 (56%), Positives = 427/593 (72%), Gaps = 14/593 (2%)

Query: 12  EKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENL 71
            KH   + VT +    E  QT     S+ +   +  E    +   T     D  S+ ++L
Sbjct: 15  NKHDSEKHVTEIHTSTEDEQTSPDDHSIEIIKNEILEKDKKKIAHTNQFSSDIHSITDSL 74

Query: 72  QDED--------------EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANA 117
                             E +  + EVKR LKQRH                    PL N+
Sbjct: 75  ARSRLPHLGDDDDEEDAEEAQYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNS 134

Query: 118 GPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GPVG+LIAYLFMGS+ +S+TQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+W
Sbjct: 135 GPVGSLIAYLFMGSIIYSITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNW 194

Query: 178 AITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIA 237
           AIT+A+E+SVVGQVI++WT KVPLAAWI+IFWV +T+MN FPVK YGE EFW+A +KV+A
Sbjct: 195 AITYAVEISVVGQVIEYWTKKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLA 254

Query: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
           I G+L+Y   +VCG    GP+GFRYWRNPG WG GIISK+KN  RFLGWVSSLINAAFT+
Sbjct: 255 IAGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTY 314

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV 357
           QGTELVGITAGEAANPRK+VPRAI KVVFRI  FYI SL FIGLLVPY+DP+L+  ++ V
Sbjct: 315 QGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVV 374

Query: 358 STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417
           ++SPF+++IQN+GTK+LP IFNA+++ T+ISAANSN+YVGSR+L+ L++   APK  +  
Sbjct: 375 ASSPFVISIQNAGTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYV 434

Query: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477
           ++ GVPY+ V  TA  G LA++  +   +  F WL+NI+ +AG  AWLFISISHIRFMQA
Sbjct: 435 TRHGVPYLGVLCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQA 494

Query: 478 LKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLF 537
           LK+RGISRD+LPFKAK MP  AYY++FF+      QGF AF+P F+ ++F  AYIS+ + 
Sbjct: 495 LKFRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIIL 554

Query: 538 IAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
             ++I  +  +RCRF WK+ED+DID+DRR+IE ++WED EPKT+WDKFW  VA
Sbjct: 555 AVLFIGCQIYYRCRFFWKLEDIDIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/594 (57%), Positives = 427/594 (71%), Gaps = 17/594 (2%)

Query: 12  EKHMYNEPVTTLL-HDVEASQTHRRRGSLSLKDEKSKELYPLRSFP----TGVNGQDTFS 66
           EKH   E  T  + H++E    H +  S    DEK   +   R         VN      
Sbjct: 21  EKHSIQEVSTDQIEHEMEVIDAHDKLSSYC-TDEKQYNMKKKRLLQDDAIASVNLITNSL 79

Query: 67  MEENLQDEDEG----------EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLAN 116
               +   + G            ++  VKR LKQRH                    PL+ 
Sbjct: 80  PRSQIASHEVGDEEEDDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSK 139

Query: 117 AGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
           AGPVG+LI+Y+FMG++ + +TQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+
Sbjct: 140 AGPVGSLISYIFMGTVVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFN 199

Query: 177 WAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVI 236
           WAIT+A+E+SV+GQVIQ+WT KVPLA WI+IFWVLIT+MN FPVK YGEFEFWVAS+KV+
Sbjct: 200 WAITYAVEVSVIGQVIQYWTDKVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVL 259

Query: 237 AIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFT 296
           AI+G+LIY   +VCG    GP+GFRYWRNPGAWGPGIIS +KNEGRFLGWVSSLINAAFT
Sbjct: 260 AIMGYLIYALVIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFT 319

Query: 297 FQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY 356
           +QGTELVGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIGLLVPYN+P+L+ +++ 
Sbjct: 320 YQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAV 379

Query: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416
           +++SPF+++IQN+GT  LP IFNAV+L T+ISAANSN+YVGSR+L+ L++   APK    
Sbjct: 380 IASSPFVISIQNAGTYALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGY 439

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
            +K GVPY+ V +TA  G LA++  +   +  F WL+NI+ +AG  AWLFIS++HIRFMQ
Sbjct: 440 VTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQ 499

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFL 536
           AL+ RGISRD+LPFKAKLMP  AYY++FF+      QGF AF P F  S F  +YIS+ L
Sbjct: 500 ALEQRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLIL 558

Query: 537 FIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
              V+   +  ++CRFIWK+ED+DID+DRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 559 LAVVFTGCQLYYKCRFIWKLEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/599 (56%), Positives = 430/599 (71%), Gaps = 15/599 (2%)

Query: 5   KQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDT 64
           +++   EE+ + ++    + H++E   T  +  + S+ DEK   L             D 
Sbjct: 15  EEQDNSEEQSIRDDSTNQIEHEMEVIDTSNKPVAYSI-DEKQDNLKKKSGLMLDGTIGDI 73

Query: 65  FSMEENLQDED-------------EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
            S+  +L                 E   ++  V+R LKQRH                   
Sbjct: 74  NSITNSLTRSQIASHEQGGDDEEEEAHYEDKHVRRALKQRHIGMIALGGTIGTGLFVGIS 133

Query: 112 XPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGY 171
            PL+NAGPVG+LIAY+FMG++ + VTQSLGEMATFIPVTSS TVFS+RFLSPAFG +NGY
Sbjct: 134 TPLSNAGPVGSLIAYIFMGTVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGY 193

Query: 172 MYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVA 231
           MYWF+WAIT+A+E+SV+GQVI++WT KVPL  WI+IFWVLIT+MN FPVK YGEFEFWVA
Sbjct: 194 MYWFNWAITYAVEVSVIGQVIEYWTTKVPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVA 253

Query: 232 SIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
           S+KV+AI+G+LIY   +VCG    GP+GFRYWRNPGAWGPGIIS +KNEGRFLGWVSSLI
Sbjct: 254 SVKVLAIMGYLIYALVIVCGGSKQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 313

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           NAAFT+QGTELVGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIGLLVPY DP+L+
Sbjct: 314 NAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLS 373

Query: 352 EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
            +++ +++SPF+++IQN+GT  LP IFNA++L T+ISAANSN+YVGSR+L+ L++   AP
Sbjct: 374 ASSAVIASSPFVISIQNAGTYALPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAP 433

Query: 412 KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           K     +K GVPY+ V +TA  G LA++  +   +  F WL+NI+ +AG  AWLFIS+SH
Sbjct: 434 KQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSH 493

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAY 531
           IRFMQAL  RGISRD+LPFKAK MP  AYY+SFF+      QGF +F P F  + F  +Y
Sbjct: 494 IRFMQALNQRGISRDDLPFKAKFMPYGAYYASFFVTVIIFIQGFQSFCP-FRVADFFTSY 552

Query: 532 ISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           IS+ L   V+   +  ++CRFIWK+ED+DIDSDRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 553 ISLILLAVVFTGCQLYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/598 (55%), Positives = 432/598 (72%), Gaps = 12/598 (2%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60
           + N  +    E+    N+  TT   + E  +          KD   K+  P     +  +
Sbjct: 4   LRNIIRSKRNEDSTESNDDSTTSYDNFEIIEIQHNDS----KDNSIKKKIPNSELASLTH 59

Query: 61  GQDTFSME-ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
                 +E E+ +D +E + ++ +VKRELKQRH                    PLA+AGP
Sbjct: 60  AYSRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGP 119

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAI 179
           VGALIAY+FMGS+ + VTQ+LGEMATFIPVTSS TVFSQRFLSPAFG ANGYMYWF+WAI
Sbjct: 120 VGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAI 179

Query: 180 TFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAII 239
           TFA+E+SVVGQVIQ+WT  VPLAAWI+IFWVL+T+MN FPVK YGE EFWVA +KVIAI+
Sbjct: 180 TFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIV 239

Query: 240 GFLIYCFCMVCGAGV-TGPVGFRYWRNPGAWGPGIISK------NKNEGRFLGWVSSLIN 292
           G+L+Y   +VCG     GP+GFRYWRNPGAWG G+ S       +K EGRFLGWV+SLIN
Sbjct: 240 GYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLIN 299

Query: 293 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTE 352
           AAFT+QGTELVGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIGLLVP+ D +L++
Sbjct: 300 AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSD 359

Query: 353 ATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412
            T+ +++SPF+++I+N+GTK+LP IFNA+++ T++SAANSN+YVGSR+L+ L+  K+APK
Sbjct: 360 DTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPK 419

Query: 413 FLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472
             +R ++ GVP++ V  T++ G LA++      +  F WL++I+ +AG  AWLFIS++H+
Sbjct: 420 IFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHV 479

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYI 532
           RFMQ LK RGISRD+LPFKAK MP  +YY++F++      QGF AF+P F+ ++F   YI
Sbjct: 480 RFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYI 539

Query: 533 SIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           S+ L   V+I  +  +RCRF+WK+EDVDIDSDRR+IE  +WED EPKT WDKFW  +A
Sbjct: 540 SLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/529 (61%), Positives = 404/529 (76%)

Query: 62  QDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVG 121
           Q+  S   +  ++DEG++Q  +VKR LK RH                    PL++AGPVG
Sbjct: 32  QNGGSGHNSSFEDDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVG 91

Query: 122 ALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITF 181
           ALIAY+FMGS+ + VTQS+GEMATFIPVTSS TVFS RFLSPAFG ANGYMYWF+WAIT+
Sbjct: 92  ALIAYIFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITY 151

Query: 182 ALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGF 241
           A+E+SV+GQVIQ+WT  VPLAAWI IFWV IT+ N FPV++YGE EFWVASIKVIAI+G+
Sbjct: 152 AVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGY 211

Query: 242 LIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTE 301
           L+Y   +VCG    GP+GFRYWRNPG WG GIIS +K++GRFLGWV+SLINA+FT+QGTE
Sbjct: 212 LLYALIIVCGGSKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTE 271

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSP 361
           LVGITAGEAANPRKTVP+AI KV FRIL FYI SL F+GLLVPYN P L + TS +++SP
Sbjct: 272 LVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSP 331

Query: 362 FIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGG 421
           F+++IQ++GT++LP IFNAV+L TIISAANSN+YVGSRILF L+   +APK  S  +  G
Sbjct: 332 FVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQG 391

Query: 422 VPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481
           VPY+ V  TA+ G LA++      ++ F WL+NI+ +AG  AWLFISISHIRFMQ LK R
Sbjct: 392 VPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQR 451

Query: 482 GISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVW 541
           GISRD+LPFK+KLMP  AYY++F++      QGF AF PKF  + F   YIS+ L   V+
Sbjct: 452 GISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVF 511

Query: 542 ILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
            L +  +RCRF  ++ED+DIDSDRR+I+A++WE+ EP T W KFW  VA
Sbjct: 512 CLAQLYYRCRFFNRLEDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/562 (58%), Positives = 413/562 (73%), Gaps = 3/562 (0%)

Query: 31  QTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDED--EGEVQNAEVKREL 88
            +  RRGS +   E   + +    F   V  QD  S +    D +  EG++Q  +VKR L
Sbjct: 61  HSRARRGSGATAGEPKLKAHS-DDFEMYVYSQDEPSTDPLGSDTESGEGDMQEGKVKRAL 119

Query: 89  KQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP 148
           K RH                    PL+ +GPVGALIAY+FMG++ + VTQS+GEMATFIP
Sbjct: 120 KPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEMATFIP 179

Query: 149 VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIF 208
           VTSS TVFS RFLSPAFG ANGYMYWF+WAITFA+ELSV GQVI++WT  VP AAWI+IF
Sbjct: 180 VTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTEAVPRAAWIAIF 239

Query: 209 WVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGA 268
           WVL+T+ N FPV++YGE EFWVASIKV+AI+G+LIY   +VCG    GP+GFRYWRNPG 
Sbjct: 240 WVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGSKQGPIGFRYWRNPGP 299

Query: 269 WGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRI 328
           WG GIISK+K+EGRFLGWV+SLINA+FT+QGTELVGITAGEAANPR+TVPRAI KV FRI
Sbjct: 300 WGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTVPRAINKVFFRI 359

Query: 329 LTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIIS 388
           L FYI SL F+GLLVPYN   L + T+ +++SPF+++IQN+GT+ LP IFNAV+L TIIS
Sbjct: 360 LFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQNAGTRALPDIFNAVVLVTIIS 419

Query: 389 AANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKV 448
           AANSN+YVGSR+LF L+   +APK  S  +  GVP++ V  T++ G LA++  +   ++ 
Sbjct: 420 AANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLVVNHNANEA 479

Query: 449 FEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXX 508
           F WL+NI+ +AG  AWLFISISHIRFMQ LK RGISRD+LPFK+KLMP  AYY++F++  
Sbjct: 480 FNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVTV 539

Query: 509 XXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDI 568
               QGF AF+P F  + F  +YIS+ L + V+   +  +RCRF  ++ED+DIDSDRR+ 
Sbjct: 540 IIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRLEDIDIDSDRREA 599

Query: 569 EAIVWEDHEPKTFWDKFWNVVA 590
           +A++WED EP T W KFW  VA
Sbjct: 600 DALIWEDDEPTTLWGKFWTAVA 621

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/519 (61%), Positives = 405/519 (78%), Gaps = 1/519 (0%)

Query: 68  EENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           E +  DE E EV   +VKR LKQRH                    PL+ AGPVG+LIAY+
Sbjct: 76  ESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYI 135

Query: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
           FMG++ + VTQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E+SV
Sbjct: 136 FMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISV 195

Query: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
           +GQVIQ+WT  VPLAAWI+IFWVL+T+MN FPVK YGE EFW+A +KV+AI+G+LIY   
Sbjct: 196 IGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALV 255

Query: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
           +VCG    GP+GFRYWR+PGA+GPGIISKNKN G+FLGWV+SLINAAFT+QGTELVGITA
Sbjct: 256 IVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITA 315

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367
           GEAANPRKTVPRAI KVVFRI+ FYI SL FIG+L+PYND +L+   + +++SPF+++I+
Sbjct: 316 GEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIASSPFVISIK 375

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
           N+ TKVLP IFNAV++ T++SAANSN+YVGSR+L+ L+    APK  S  ++ GVPY+ V
Sbjct: 376 NAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGV 435

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
             TA  G LA++  +   +  F WL+NI+ +AG  AWLFIS++HIRFMQALK+RGISRD+
Sbjct: 436 VCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDD 495

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547
           LPFKAKLMP  AYY++FF+      QG+ AF P ++ S+F  +YIS+ L   + +  +  
Sbjct: 496 LPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQLY 554

Query: 548 FRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFW 586
           +R RF+ K+ED+DID+DRR+IE+IVWED EPKT WDKFW
Sbjct: 555 YRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTLWDKFW 593

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/553 (60%), Positives = 419/553 (75%), Gaps = 10/553 (1%)

Query: 38  SLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXX 97
           S  L+D  S E  P+ S           S +    ++ EG+ +  EVKR LK RH     
Sbjct: 20  SKKLEDYVSSETLPIYSH----------SGDNAPCEKGEGDCRETEVKRALKPRHISMIA 69

Query: 98  XXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFS 157
                          PL+ +GPVGALIAY+F+GS+ + VTQSLGEMATFIPVTSS TVFS
Sbjct: 70  LGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFS 129

Query: 158 QRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNL 217
           +RFLSPAFG ANGYMYWF+WAIT+A+E++VVGQVIQ+WT  VPLAAWI+IFWVL+T+ N 
Sbjct: 130 KRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANF 189

Query: 218 FPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKN 277
           FPVK+YGE EFWVAS+KVIAI+G+LIY   +VCG    GP+GFRYWRNPG WGPGIISK+
Sbjct: 190 FPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSHQGPIGFRYWRNPGPWGPGIISKD 249

Query: 278 KNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
            NEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPRAI KV FRIL FYI SL 
Sbjct: 250 VNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLF 309

Query: 338 FIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           FIGLLVPY+D +L+  T+ +++SPF+++IQN+GTKVLPHIFNA+++ TIISAANSN+YVG
Sbjct: 310 FIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVG 369

Query: 398 SRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITG 457
           SR+L+ L+ +  APK     +K GVPY+ V  TA+ G LA++  +   ++ F WL+NI+ 
Sbjct: 370 SRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNIST 429

Query: 458 VAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTA 517
           +AG  AWLFIS+SH+RFMQ LK+RGISR++LPFKAKLMP  AYY++FF+      QGF A
Sbjct: 430 LAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKA 489

Query: 518 FAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHE 577
           F PKF  S F  +YIS+ L   +++  +  +RCRFIW ++D+DIDSDRR+I+AIVWED E
Sbjct: 490 FTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDE 549

Query: 578 PKTFWDKFWNVVA 590
           PK  W+KFW  VA
Sbjct: 550 PKNLWEKFWVAVA 562

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/567 (58%), Positives = 414/567 (73%), Gaps = 9/567 (1%)

Query: 24  LHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQD-EDEGEVQNA 82
           L    A + H  R + S   E S  L+  +        +  F  +EN+ + E      + 
Sbjct: 7   LETYPAGKQHNDRSAES--SESSDVLHHRKE----TKNEGIFINQENMSEVESLYGNDDP 60

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGE 142
           +VKR+LK RH                    P+  AGPVG+L+AYLFMG++AF VTQSLGE
Sbjct: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLA 202
           MATFIPVTSSFT+++QRFLSPA GAANGY+YWFSW +TFALELS++GQ+IQ+WT  VPL+
Sbjct: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180

Query: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRY 262
            WI +FW+L+T  N+ PV++YGE EFW+A++KV++I GFLIY   MVCG    G +GFRY
Sbjct: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240

Query: 263 WRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 322
           W+NPG WG G+IS NK E RFLGWVSSLI AAFT+QGTELVGITAGE+ NPRKTVP+AI 
Sbjct: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKL-TEATSYVSTSPFIVAIQNSGTKVLPHIFNAV 381
           KV FRIL FYI SL F+GLLVPY DP+L T + S ++TSPF++AIQNSGTKVLP +FN V
Sbjct: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360

Query: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMET 441
           IL TI+SA NSNIY+GSR+L+GLSK+ LAP    +T+K GVP+ AV  +++FG LAY+  
Sbjct: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420

Query: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501
           S    KVF+WLL IT VAGFFAWL IS+SHIRFMQ LK RGISR++LPFKAK MP  AYY
Sbjct: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480

Query: 502 SSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDI 561
           ++FF+      QGF +FAP+F  S F+A YIS+FLFI  W+ F+ +F+ R I + EDVDI
Sbjct: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540

Query: 562 DSDRRDIEAIVW-EDHEPKTFWDKFWN 587
           D+DRR+I+A+VW +D EPKT   K W 
Sbjct: 541 DTDRREIDALVWSDDDEPKTLLQKLWQ 567

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/520 (59%), Positives = 398/520 (76%), Gaps = 1/520 (0%)

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGS 131
           + E EG+    EVKR LK RH                    PL  AGPVG+LIAY+FMG+
Sbjct: 48  EHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGT 107

Query: 132 LAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQV 191
           + +S+TQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAITFA+ELSVVGQ+
Sbjct: 108 VVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQI 167

Query: 192 IQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I +WT  VPL AWI+IFW+++T++N FPV++YGE EFW+AS+KVI I+G+LIY F +VCG
Sbjct: 168 INYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCG 227

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
               GP+GFR WRNPG WG G+IS N+ E RFLGWVSSLI AAFT+QGTELVGITAGE+ 
Sbjct: 228 GSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESK 287

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIVAIQNSG 370
           NPRKTVP+AI KV FRIL FYI SL F+GLLVPYNDP++   + + V+ SPF+++I+N+G
Sbjct: 288 NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAG 347

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFAT 430
           TK+LP IFNAV+L T++SAANSN+Y+GSR+++ L+++  APK     ++ GVP + V  T
Sbjct: 348 TKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVT 407

Query: 431 AVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
           A+ G +A++  +      F WL+NI+ +AG  AWLFIS++HIRFMQ LK RGISRD LPF
Sbjct: 408 ALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPF 467

Query: 491 KAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRC 550
           KAK MP  AYY++ F+      QG+TAF+PKF+ + F  AYIS+ L + V+I  +  ++C
Sbjct: 468 KAKFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKC 527

Query: 551 RFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           RF+WK+ED+DID++RR+I+AIVWED EPK  WDKFW+ +A
Sbjct: 528 RFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/519 (62%), Positives = 402/519 (77%)

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGS 131
            +E EG+    EVKR LK RH                    PL+ +GPVG+LIAY+FMGS
Sbjct: 61  SEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGS 120

Query: 132 LAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQV 191
           + + VTQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+ELSV+GQ+
Sbjct: 121 VVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQI 180

Query: 192 IQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I +WT  VPLAAWI+IFWVL+T  N FPVK+YGEFEF VASIKVIAI+G+L+Y   +VCG
Sbjct: 181 INYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCG 240

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
               GP+GFRYWRNPG WG G I+KN N+ RFLGWV SL+NA+FT+QGTELVGITAGEA+
Sbjct: 241 GSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEAS 300

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGT 371
           NPRKTVP+AI KV FRIL FYIGSL F+GLLVPYN P+L   ++ +++SPF+++IQN+GT
Sbjct: 301 NPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAGT 360

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
           KVLP IFNAV+L TI+SA NSN+YVGSR+L+ L+ +  APK  S  +K GVPY+ V  TA
Sbjct: 361 KVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTA 420

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           + G LA++ T+   +  F WL+NI+ +AG  AW FIS++HIRFMQ LK RGISRD LPFK
Sbjct: 421 LLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFK 480

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCR 551
           AKLMP  AYY++FF+      QGFTAFAP+F+ S F  AYIS+ L + ++IL +  +RCR
Sbjct: 481 AKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCR 540

Query: 552 FIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           F+ KIED+DIDSDRR+I+AI+WED EPK  W+KFW  +A
Sbjct: 541 FLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEKFWVALA 579

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/518 (58%), Positives = 395/518 (76%), Gaps = 2/518 (0%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAF 134
           +EG+ Q  EVKR LK RH                    PL  AGPVG+L+AY+F+G++ +
Sbjct: 46  EEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVY 105

Query: 135 SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194
           S+TQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAITFA+ELSVVGQ+IQ+
Sbjct: 106 SITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQY 165

Query: 195 WTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGV 254
           WT +VP+AAWI IFWVL+T++N FPV++YGE EFW+AS+KV+ I+G+LIY F +VCG   
Sbjct: 166 WTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSK 225

Query: 255 TGPVGFRYWRNPGAWGPGIISKN-KNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
            GP+G        A G    S+  +    FLGWVSSLI AAFT+QGTELVGITAGE+ NP
Sbjct: 226 QGPIGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNP 285

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TEATSYVSTSPFIVAIQNSGTK 372
           RK VP+AI KV FRIL FYIGSLLF+GLLVPY+DP+L +E+++ V+ SPF+++I+N+GTK
Sbjct: 286 RKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTK 345

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAV 432
           +LP IFNAV+L T+ISAANSN+Y+GSR+ + L+    APK L+  +K GVPY  V  T++
Sbjct: 346 ILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSL 405

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
            G ++++  +      F+WL+NI+ +AG  AWLFIS++HIRFMQ LK+RGISRD+LPFKA
Sbjct: 406 MGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKA 465

Query: 493 KLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRF 552
           K MP  AYY++FF+      QG+TAF PKF+ ++F  +YIS+FL + V+I  +  ++CRF
Sbjct: 466 KFMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRF 525

Query: 553 IWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +W +ED+DIDSDRR+I+AIVWE+ EPK  WDKFW+ VA
Sbjct: 526 LWAVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/515 (57%), Positives = 389/515 (75%), Gaps = 1/515 (0%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G+  + +VKR LK RH                    PL+ +GPVG+LIAY+FMGS+ + 
Sbjct: 94  KGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYF 153

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
           VTQSLGEMATFIPVTSS TVF++RFLSPA G +NGYMYWF+WAITFA ELSV GQ+IQ+W
Sbjct: 154 VTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYW 213

Query: 196 THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
           T+KVPLAAWI IFWV++ ++N FPVK YGE EFWV+S+KV+AI+G+LIY   +VCG    
Sbjct: 214 TYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQ 273

Query: 256 GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
           GP+GFRYWR+  A+G G ISKNK+E RFLGWVSSLINAAFT+QGTELVGI+AGEAANPRK
Sbjct: 274 GPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRK 333

Query: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLP 375
           TVPRAI KV+FRI  FYI SL FIGLLVPYND +L++ ++ +++SPF++++ N+GT  LP
Sbjct: 334 TVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALP 393

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGA 435
            IFNAVIL T++SAANS++Y+ SR+L+ L+    APK  +  ++ GVPY+ VF T + G 
Sbjct: 394 DIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGW 453

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           LA++  S   +  F WL+NI+ +AG  AW FI  +HIRFMQALK++GISRD+LPFKA+ M
Sbjct: 454 LAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFM 513

Query: 496 PGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWK 555
           P  AYY++FF+      QG+ AF P ++  SF  +YIS+ LF  +++     +R R + K
Sbjct: 514 PWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIK 572

Query: 556 IEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           IED+DID+DR+++EA VWE+  P+ +W+KFW  VA
Sbjct: 573 IEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/530 (57%), Positives = 400/530 (75%), Gaps = 10/530 (1%)

Query: 66  SMEENLQDEDEGEVQN-------AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAG 118
           +++  + + +  EV++       ++VKRELK RH                    P+ NAG
Sbjct: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAG 83

Query: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           PVG+L+AY+F+ ++A+ VTQSLGEMATFIPVTSSFTVF+ RF+SPA GAANGY+YW SW 
Sbjct: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
           ITFALE+SV+G++I +W+  VP+ AW++IFWVL+T +NL PVK+YGEFEFW+AS+KVIAI
Sbjct: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203

Query: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           + FL Y   +VCG    G +GFRYW++PG WG GI+S+  +  +FLGWVSSLI AAFTFQ
Sbjct: 204 LCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTE--ATSY 356
           GTELVG+TAGE  NPR+TVP+AI  V FRIL FYIGSLL IGLLV Y+DP+L +  +T+ 
Sbjct: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323

Query: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416
            + SPF+VAI  +GTKVLP I N VI+ TIISA NSNIYVGSR+L+GL ++ LAP F+SR
Sbjct: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
           T+  GVPY+AV AT++FGAL Y+  S+    VF+WLL+IT V+GFF WL IS+SHIRFMQ
Sbjct: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFL 536
            LK RGISRD+LPFKAK MP  AYY++FF+      QGFTAF P F+   F+A YIS F+
Sbjct: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFI 502

Query: 537 FIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFW 586
           F+ +W+LF+ +F+ R+   ++++DID+DRRDI+AI+W+D +P T W K W
Sbjct: 503 FVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  359 bits (921), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/523 (37%), Positives = 304/523 (58%), Gaps = 11/523 (2%)

Query: 63  DTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 122
           ++F  E++     +G+     +K+ELK RH                     L   GP   
Sbjct: 29  NSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASI 88

Query: 123 LIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           LIAY F+G L F V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I   
Sbjct: 89  LIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITP 147

Query: 183 LELSVVGQVIQFWTHK--VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
            +L+    VIQ+W  +  V    WI+IF V+I I+N   V+Y+GEFEFW++S K++ + G
Sbjct: 148 NQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFG 207

Query: 241 FLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQG 299
            +++ F ++ G G     +GFRYW+NPGA+ P   S   ++G+F+ +V+  + A F + G
Sbjct: 208 VILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLG 267

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TEATSY 356
            EL GI A EA NPR+ +PRAIK  ++RI+ FYI ++  +G+ V YNDP+L     A++ 
Sbjct: 268 IELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTS 327

Query: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416
            + SPF+VAIQNSG + LPHIFN  +L  + SA NS++YVG+R L+ L+ +  APK  ++
Sbjct: 328 AAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAK 387

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
           T++ GVPY A+F   +F  LAYM  S+G  ++F + +N+  + G  +W+ I I++I F +
Sbjct: 388 TNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYR 447

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFL 536
           A   + + R+   ++A   P  AY + FF       + FT F  +F+  SF+  YI + L
Sbjct: 448 ACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPL 507

Query: 537 FIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPK 579
           ++  +  ++ I++ + + K E+ D+ S +   EAI  E+ E K
Sbjct: 508 YVIFYFGYKIIYKTKLV-KAEEADLYSFK---EAIDREEAEGK 546

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  347 bits (891), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/532 (37%), Positives = 314/532 (59%), Gaps = 14/532 (2%)

Query: 59  VNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAG 118
           ++ QD  S +E+  + D G+     +K+EL+ RH                     L+ AG
Sbjct: 31  LSNQDDISSQESHLNID-GKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAG 89

Query: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           PV  LIAY F+G L + V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + 
Sbjct: 90  PVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYL 148

Query: 179 ITFALELSVVGQVIQFWT--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVI 236
           I    +L+    V+Q+W    KV    WI+IF V+I  +N+  VK++GEFEFW++S KV+
Sbjct: 149 IITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVL 208

Query: 237 AIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAF 295
            ++  ++  F ++ G G +   +GFR++++PGA+ P   + + ++G+F+ +V+  + A F
Sbjct: 209 VMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALF 268

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA-- 353
            + GTEL GI A E  NPR+ VPRAIK  ++RI+ FY+ ++  +G+ V YNDP L +A  
Sbjct: 269 AYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKK 328

Query: 354 -TSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412
            ++  + SPF+VAI+N+G  VLPHIFNA +L  + SA NS++YV SR L+GL+ +  APK
Sbjct: 329 KSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPK 388

Query: 413 FLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472
             ++T+K GVPY ++    +F  LAYM  S+G  +VF + +N+  + G  +W+ I I++I
Sbjct: 389 IFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYI 448

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAY 531
            F +AL+ +G+ +  L + A L    AY++ FF       + FT F   KF+  +F+  Y
Sbjct: 449 YFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGY 508

Query: 532 ISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWD 583
           I I +FI  +  ++ I   +F+ K E+ D+ + +   E I  E+ E K  WD
Sbjct: 509 IGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFK---ELIDLEEEEGK-LWD 555

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  348 bits (892), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/526 (35%), Positives = 306/526 (58%), Gaps = 17/526 (3%)

Query: 59  VNGQDTFSM------EENLQDE--DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           +N  D  S       +   QD+  D+G+ ++  ++++LK RH                  
Sbjct: 53  INDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGT 112

Query: 111 XXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170
              L  AGP+   IAY F+G L F    +LGEMA++IP+   FT ++ R+  PA G A G
Sbjct: 113 GNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVG 171

Query: 171 YMYWFSWAITFALELSVVGQVIQFWTHK--VPLAAWISIFWVLITIMNLFPVKYYGEFEF 228
           Y Y   + I    +L+    VIQ+W  +  V    WI+IF V+I  MN   VK++GEFEF
Sbjct: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231

Query: 229 WVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWV 287
           W+++ KVI +IG +I  F ++ G G T   +GFR++ +PGA+ P   S + ++G+F+ +V
Sbjct: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFV 291

Query: 288 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347
           + L+ A F + G EL GI A EAANPRK++P+AIK  ++RI+ FY+ ++  +G+ V Y+D
Sbjct: 292 AVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351

Query: 348 PKLTEATSY---VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGL 404
           P L +A +     + SP++VAI NSG K LPHIFNA +L  + SA NS++YV SR L+GL
Sbjct: 352 PLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411

Query: 405 SKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAW 464
           + +  APK  + T++ GVPY ++  ++ F  LAYM  S+G  K+F + +N+  + G  +W
Sbjct: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471

Query: 465 LFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFA-PKFN 523
           + I I+++ F +A+K + + R    ++A   P  +Y++  F       + FT F    F+
Sbjct: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531

Query: 524 GSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIE 569
             +F+  YI I +F+  +  ++ + + + IWK E+VD+ + +  I+
Sbjct: 532 YKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAID 576

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  341 bits (874), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/538 (35%), Positives = 317/538 (58%), Gaps = 9/538 (1%)

Query: 40  SLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXX 99
           S++ + +  LY   +   G+   ++     ++ +  +G+ +   +K+EL+ RH       
Sbjct: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIG 65

Query: 100 XXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQR 159
                         LA+AGPV  LI+Y F+G L ++V   LGEMA FIP+   FT ++ R
Sbjct: 66  GSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASR 124

Query: 160 FLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT--HKVPLAAWISIFWVLITIMNL 217
           ++ PA G A GY Y F + I    +L+    V+QFW    +V    WI+IF  LI ++N 
Sbjct: 125 YVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINT 184

Query: 218 FPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISK 276
             V+++GEFEFW++S+KV+ ++G ++  F ++ G G      GFR+WR+PGA+ P   + 
Sbjct: 185 VGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAI 244

Query: 277 NKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSL 336
           + ++G+F+ + S    A F + GTEL GI A EA NPR++VPRAIK  ++RI+ FY+ ++
Sbjct: 245 SGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITI 304

Query: 337 LFIGLLVPYNDPKLTEATSYVST---SPFIVAIQNSGTKVLPHIFNAVILTTIISAANSN 393
           L +G+ V YNDP+L +A    ++   SPF+VAI+N+   VLPHIFN  +L  + SA NS+
Sbjct: 305 LLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSD 364

Query: 394 IYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLL 453
           +YV SR L+GL+ +  AP+  + T+K GVPY ++  + +F  LAYM  S+G  +VF + +
Sbjct: 365 LYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFV 424

Query: 454 NITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQ 513
           N+  + G  +W+ I I++IRF +A++ +   +  L + A   P   Y + FF       +
Sbjct: 425 NVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIK 484

Query: 514 GFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEA 570
            +T F   KF+  +F++ YI I +++  ++ ++ ++R + I K EDVD+ + +  I+A
Sbjct: 485 NYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  334 bits (857), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/514 (35%), Positives = 293/514 (57%), Gaps = 17/514 (3%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G+     +K++LK RH                     L  AGP   LIAY F+G+L F 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
              +LGEMA +IP+   FT ++ R+  PA G A GY Y F + I    +L+    VIQ+W
Sbjct: 134 TMAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYW 192

Query: 196 THK--VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
             +  V    WI+IF V+I  +N   VKY+GEFEFW++S K++ +IG +I+ F ++ G G
Sbjct: 193 VDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGG 252

Query: 254 VTGP-VGFRYWRNPGAWGP---GIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGE 309
                +GFRYW+ PGA+ P    +++   + G+F+ +V+  + A F + G EL GI A E
Sbjct: 253 PNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAE 312

Query: 310 AANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TEATSYVSTSPFIVAI 366
           A NPR+ +PRAIK  V+RIL FY+ ++  +G+ V Y+DP L     A +  + SPF+VAI
Sbjct: 313 AENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAI 372

Query: 367 QNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIA 426
           QNSG  VLPHIFN  +L  + SA NS++YVG+R L+ L+ +  APK  ++T++ GVPY A
Sbjct: 373 QNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNA 432

Query: 427 VFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRD 486
           +    +F  LAYM  S+G  ++F + +N+  + G  +W  I I+ I F +A++ +GI R 
Sbjct: 433 MGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRS 492

Query: 487 ELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFE 545
              + A   P  +Y++ FF       + F+ F   +F+  +F+  YI + ++   +I ++
Sbjct: 493 TFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYK 552

Query: 546 CIFRCRFIWKIEDVDIDS-----DRRDIEAIVWE 574
             ++ + + K  + D++S     DR + E  + E
Sbjct: 553 LYYKTKTV-KPHEADLNSYKAAVDREEEEGKIKE 585

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  334 bits (857), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/514 (37%), Positives = 299/514 (58%), Gaps = 15/514 (2%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G+ +N  +K+ELK RH                     L   GPV  LIAY F+G L F 
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W
Sbjct: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190

Query: 196 T--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
               +V    WI+IF V+I  +N+  VK++GEFEFW++S KV+ ++G ++  F ++ G G
Sbjct: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGG 250

Query: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
                +GFRYWR+PGA+     +   + G+F  +V+  + + F++ G EL GI   EA N
Sbjct: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSY-VSTSPFIVAIQNS 369
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  T+  S   + SPF+VAIQNS
Sbjct: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429
           G KVLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++TSK GVPY A+  
Sbjct: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430

Query: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489
           + +F  LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  
Sbjct: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490

Query: 490 FKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIF 548
           + A      AY++  F       + FT F   KF+  +F+  YI + ++I  W  ++ I+
Sbjct: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550

Query: 549 RCRFIWKIEDVDIDS-----DRRDIEAIVWEDHE 577
           + + I K  DVD+ +     DR + E  + +D E
Sbjct: 551 KTKVI-KSTDVDLYTFKEIYDREEEEGRI-KDQE 582

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/516 (37%), Positives = 302/516 (58%), Gaps = 15/516 (2%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G+ +N  ++++LK RH                     L   GPV  LIAY F+G L F 
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W
Sbjct: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192

Query: 196 T--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
               +V    WI+IF V+I  +N+  VK++GEFEFW++S KV+ ++G ++  F ++ G G
Sbjct: 193 ISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGG 252

Query: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
                +GFRYWR+PGA+     +    +G+F+ +V+  + + F++ G EL GI   EA N
Sbjct: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSY-VSTSPFIVAIQNS 369
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  T+  S   + SPF+VAIQNS
Sbjct: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429
           G +VLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++TS+ GVPY A+  
Sbjct: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432

Query: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489
           + +F  LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  
Sbjct: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492

Query: 490 FKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIF 548
           + A      AY++ FF       + FT F   KF+  +F+  YI + ++I  W  ++ I+
Sbjct: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552

Query: 549 RCRFIWKIEDVDIDS-----DRRDIEAIVWEDHEPK 579
           + + I K  DVD+ +     DR + E  + +D E +
Sbjct: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRM-KDQEKE 586

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 204/569 (35%), Positives = 312/569 (54%), Gaps = 24/569 (4%)

Query: 25  HDVEASQTHRRRGSLSLKDEKSKELY-------PLRSFPTGVNGQDTFSMEENLQDEDEG 77
            D+E  Q     G  ++  E+S +L+        +    +G +G D  ++  +  + D G
Sbjct: 18  EDIEKQQLF---GDDNIVIERSSQLFYDGQSDSKVHGITSG-HGSDVKNVVTHTSEFD-G 72

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVT 137
           +     +K+ L+ RH                     LA AGP   LIAY F+G L F V 
Sbjct: 73  KHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVM 132

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTH 197
             LGEMA +IP+   FT +S R+  PA G A GY Y F + I    +L+    VIQ+W  
Sbjct: 133 SCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191

Query: 198 --KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
             KV    WI+I  V I  +N   V+++GE E++++++K+  ++G +I    + CG G  
Sbjct: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPN 251

Query: 256 GPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
             V GF+YW+NPGA+     +    +GRF+ + S  + A F + GTEL GI   E  NPR
Sbjct: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPR 311

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATS---YVSTSPFIVAIQNSGT 371
           K VP+AIK  ++RI+ FY+ S+  +G+ VP+NDP L  A S     S SPF+VAI N+G 
Sbjct: 312 KAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGI 371

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
            VLPHI NA IL  + SAANS++YV SR L+GL+ +  AP+  ++T+K GVPY ++    
Sbjct: 372 PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGV 431

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           +F  LAYM  S+G  +VF + +N   + G  +W+ I I++IRF +A + +GI +  L ++
Sbjct: 432 LFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQ 491

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIFRC 550
           + L P  A++S FF       + F AF    F+  SF+  YI I  +I  +I ++  ++ 
Sbjct: 492 SPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKT 551

Query: 551 RFIWKIEDVDIDSDRRDIEAIVWEDHEPK 579
           + I   E+VD+ S +   EA+  E+ E K
Sbjct: 552 KIIPS-EEVDLVSFK---EAVDLEEEEGK 576

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/519 (35%), Positives = 298/519 (57%), Gaps = 16/519 (3%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAF 134
           D+G+ +   +K+ LK RH                     LA AGP    I Y F+G L F
Sbjct: 55  DDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVF 114

Query: 135 SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194
                LGEMA FIP+   FT ++ R++ PA G A GY Y   + I  A +L+    V+Q+
Sbjct: 115 FTMSCLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQY 173

Query: 195 WTHKVPL--AAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA 252
           W  +  L    +I+IF +LI  +N+F VK +GEFEFW++S KV+ ++G ++  F ++ G 
Sbjct: 174 WVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGG 233

Query: 253 GVTGP-VGFRYWRNPGAWGP---GIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308
           G     +GFRYWR+PG++ P    IIS + + G+F+ + S  + A F + G EL GI A 
Sbjct: 234 GPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAA 293

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT---SYVSTSPFIVA 365
           EA NPRK +P+AIK  ++RI+ FY+ ++L + + V YNDP L +AT   +  + SPF+VA
Sbjct: 294 EAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVA 353

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
           I+NSG  +LPHIFN  +L  ++SAANS++YV SR L+ L+ +  APKF  +T+K G+PY 
Sbjct: 354 IENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYW 413

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
           ++  +  F  LAYM  S+    VF + +N   + G  +W+ I +++I F +A K +G+ +
Sbjct: 414 SLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDK 473

Query: 486 DELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILF 544
               + A   P  AY++ FF       + FT F   +F+  +F+  YI I +F   ++ +
Sbjct: 474 SNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGY 533

Query: 545 ECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWD 583
           + +++ +   + E+VD+ +    ++A++ ++ E     D
Sbjct: 534 KIVYKTK-THRPEEVDLVT----LKALIDQEEEDGKIED 567

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/575 (34%), Positives = 322/575 (56%), Gaps = 22/575 (3%)

Query: 21  TTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDED----E 76
           ++L  D +A  + +   S  +K++   E+Y +      V+ + +     + +D+     +
Sbjct: 17  SSLDSDRDAYYSKQNPDSFPVKEQ---EIYNIDLEENNVSSRSSTFTSPSARDDSFAVPD 73

Query: 77  GEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSV 136
           G+ +   ++++LK RH                     L   GPV  LIAY F+G L F  
Sbjct: 74  GKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFT 133

Query: 137 TQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT 196
              LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W 
Sbjct: 134 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 192

Query: 197 --HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGV 254
              +V    WI+IF V+I  +N+  VK++GEFEFW++S KV+ ++G ++  F ++ G G 
Sbjct: 193 SRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGP 252

Query: 255 TGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
               +GFRYWR+PGA+     +    +G+F+ +++  + + F++ G EL GI   EA NP
Sbjct: 253 DHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNP 312

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV---STSPFIVAIQNSG 370
           RK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L          + SPF+VAIQNSG
Sbjct: 313 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSG 372

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFAT 430
            KVLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  S+T+K GVPY A+  +
Sbjct: 373 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFS 432

Query: 431 AVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
            +F  LAYM  S G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  +
Sbjct: 433 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 492

Query: 491 KAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIFR 549
            A      AY++  F       + FT F   KF+  +F+  YI + +++  W+ ++ I++
Sbjct: 493 VAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYK 552

Query: 550 CRFIWKIEDVDIDS-----DRRDIEAIVWEDHEPK 579
            + I K  DVD+ +     DR + +  + ED E +
Sbjct: 553 TKVI-KSTDVDLYTFKEIYDREEEQGKI-EDQEKE 585

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  332 bits (851), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/551 (35%), Positives = 312/551 (56%), Gaps = 29/551 (5%)

Query: 62  QDTFSMEENLQDEDE-----GEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLAN 116
           ++  S+  + +D+++     G+ +   +K+ L+ R                      LA 
Sbjct: 44  ENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLAT 103

Query: 117 AGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
           AGPV  LIAY F+G L F    SLGEMA++IP+   FT ++ R+  PA G A GY Y F 
Sbjct: 104 AGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCYLFK 162

Query: 177 WAITFALELSVVGQVIQFWT--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIK 234
           + I    +L+    VIQ+W    KV    WI+IF V+I  +N   V+++GEFEFW++S K
Sbjct: 163 YFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFK 222

Query: 235 VIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINA 293
           V+ +   +I  F ++ G G     +GFR+W++PGA+     +   + G+F+ +VS  + A
Sbjct: 223 VLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYA 282

Query: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA 353
            F + GTELVGI  GEA NPRK+VP+AIK  ++RI+ FY+ S+L +G+ V Y+DP L EA
Sbjct: 283 TFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEA 342

Query: 354 ---TSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLA 410
              ++  + SPF+VAI NSG KVLPHIFNA +L  + SA NS++YV SR L+ L+ +  A
Sbjct: 343 KTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKA 402

Query: 411 PKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISIS 470
           PK  +RT++ G+PY ++  + +F  LAYM  S+G  K+F + +N+  + G  +W+ I ++
Sbjct: 403 PKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVT 462

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLA 529
           ++ F +A++ +GI +    + A      AY++ FF       + FT F   +F+  +F+ 
Sbjct: 463 YLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFIT 522

Query: 530 AYISIFLFIAVWILFECIFRCRFIWKIEDVD-------IDSDRRD--IEAIVWEDHEPKT 580
            YI I +F   +  ++ I++ + I  +E VD       ID +  D  +E I  ++     
Sbjct: 523 GYIGIPVFFISYFGYKLIYKTKIIDPLE-VDLYTFKAAIDQEEEDGKLEDIARKERIKAN 581

Query: 581 ------FWDKF 585
                 F+DKF
Sbjct: 582 GRNFEWFYDKF 592

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/506 (36%), Positives = 296/506 (58%), Gaps = 14/506 (2%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEM 143
           +K+ L+ RH                     L+ AGP    IAY F+G L F    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK--VPL 201
           A++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W  +  V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 202 AAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGF 260
             WI+IF V+I I+N+  VK++GEFEFW++S KV+ ++G ++  F ++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 261 RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRA 320
           RYW++PGA+ P   + + + G+F+ +VS  + A F + G EL GI A EA NPRK+VPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT---SYVSTSPFIVAIQNSGTKVLPHI 377
           +K  V+RI+ FY+ ++  +G+ V YNDP+L  A    +  + SPF+VAIQNSG +VLPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALA 437
           FNA +L  + SA NS++YVGSR L+ L+ +  AP    RT+  G+P+ ++    +F  LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           YM  S+G  +VF + +N+  + G  +W+ I I++I FM+A+K +G+ R +  + A   P 
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 498 LAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKI 556
             Y+S  +       + FT F    F+  +F+  YI + +F+  +  ++ I + + + K 
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576

Query: 557 EDVDIDS-----DRRDIEAIVWEDHE 577
            +VD+ +     D+++IE  + +  +
Sbjct: 577 HEVDLFTGKEVFDQQEIEGKILDQEK 602

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/513 (35%), Positives = 299/513 (58%), Gaps = 14/513 (2%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G+ +   +K++L+ RH                     L+ AGP+  LIAY  MG + F+
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
           V   LGEMA +IP+   FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W
Sbjct: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 196 TH--KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
               KV    WI++F  +I  +N+  VK++GEFEFW++S KV+ ++  +     +V G G
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 254 VT-GPVGFRYWRNPGAWGP--GIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310
            +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F + GTEL GI A E 
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288

Query: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTE---ATSYVSTSPFIVAIQ 367
            NPR+ VPRAIK  ++RI+ FY+ ++  +GL V YNDP L +   A +  + SP++VAI+
Sbjct: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIK 348

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
           N+G  VLPHIFNA +LT + SA NS++YVGSR L+GL+ +K APK  ++T+  GVPY ++
Sbjct: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
               +F  LAYM  S+  + +F + +N+T + G  +W+ I I++I F +A + +GI ++ 
Sbjct: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFEC 546
           L ++A   P  A+ +  F       + FT F    F+  +F+  YI I ++I  ++ ++ 
Sbjct: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528

Query: 547 IFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPK 579
           + + ++I K  +VD+ + +  I+    E+ E K
Sbjct: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/502 (36%), Positives = 299/502 (59%), Gaps = 9/502 (1%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G+ +   +K+ L+ RH                     LA+AGP   LI+Y F+G L ++
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
           V   LGEMA FIP+   FT ++ R++ PA G A GY Y F + I    +L+    V+Q+W
Sbjct: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161

Query: 196 T--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
               KV    WI+IF VLI ++N   V+++GEFEFW++S+KV+ ++G ++  F ++ G G
Sbjct: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 221

Query: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
                 GFRYWR+PGA+ P   + + ++G+F+ + S    A F + GTEL GI A EA N
Sbjct: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 281

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA---TSYVSTSPFIVAIQNS 369
           PR++VPRAIK  ++RI+ FY+ S+L +G+ V YNDP L +A   ++  + SPF+VAI+N+
Sbjct: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNA 341

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429
           G  VLPHIFNA +L  + SA NS++YV SR L+GL+ ++ APK  ++T+  GVPY ++  
Sbjct: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401

Query: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489
           + +F  LAYM  S+G  ++F + +N+  + G  +W+ I I+++RF +A+  +   +    
Sbjct: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461

Query: 490 FKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIF 548
           + A   P   + S FF       + +T F    F+  +F++ YI I ++   ++ ++ + 
Sbjct: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521

Query: 549 RCRFIWKIEDVDIDSDRRDIEA 570
           R + I K EDVD+ + +  I+A
Sbjct: 522 RSKLI-KPEDVDLYTFKAAIDA 542

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/605 (32%), Positives = 318/605 (52%), Gaps = 49/605 (8%)

Query: 4   PKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQD 63
           P  + E++E           L D+EA Q +      SL D  +K+   L    T  +   
Sbjct: 18  PSSKNELKE-----------LGDMEAQQMNLDD---SLDDRFNKKDSGLNKVLTVSSDTS 63

Query: 64  TFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 123
           T S+EE+  +          +K+ LK RH                     L   GP G  
Sbjct: 64  TNSLEEDYTNT---------LKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLF 114

Query: 124 IAYLFMGSLAFSVTQSLGEMATFIP-----VTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           IAY  + S+ + +  ++GEM  ++P        S T   +R++  +   A G+ Y++ + 
Sbjct: 115 IAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYV 174

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
           I  A E +    V+++WT  VP AAWI+IF  +I ++N+  VKY+GE EFW ASIK++ I
Sbjct: 175 ILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCI 234

Query: 239 IGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
           +G +I  F +  G G +   +GFRYW+NPGA+   +   + + G FL   S +I  AF F
Sbjct: 235 MGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHV--TDGSLGNFLDIYSGIIKGAFAF 292

Query: 298 -QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY 356
             G ELV +T+ E ++ R+ + +A K+ ++R++ FYI   L IG++V +NDP L  A S 
Sbjct: 293 ILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSN 352

Query: 357 ----VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412
                 +SPF++ IQN+G +VLPHI NA ILT+  S+ N+ ++  SR LF +++N  APK
Sbjct: 353 NTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPK 412

Query: 413 FLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472
              R +K GVPY+AV  + +   LAY+  S+   +VF WL NI+ ++GF  W+   I+++
Sbjct: 413 IFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYL 472

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF-NGSSFLAAY 531
           RF +A+ Y  +  D +PFK    P L  +S   +       G+  F PKF N S F+AAY
Sbjct: 473 RFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAY 531

Query: 532 ISIFLFIAVWILFECIFR-------CRFIWKIEDVDIDSDRRDIEAIVWEDHE----PKT 580
           I++ +F+A+++  +            +  + +ED+D+ +   +IE    E  E    P  
Sbjct: 532 ITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTN 591

Query: 581 FWDKF 585
            W++F
Sbjct: 592 RWERF 596

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  326 bits (835), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/580 (31%), Positives = 314/580 (54%), Gaps = 32/580 (5%)

Query: 27  VEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEE-NLQDEDEGEVQNAEVK 85
           +  ++  +  G  S+ D+++ +++ L          DT S+   N    +  + +   +K
Sbjct: 1   MSTARDLKDAGQTSIVDKQTGQVFEL----------DTESLSALNTGGSESQKREPHTLK 50

Query: 86  RELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT 145
           + L+ RH                     L+  GP G L +Y+ +  + + V  +LGEM  
Sbjct: 51  QGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVC 110

Query: 146 FIPVTS-----SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVP 200
           ++P +      S +    R+  P+ G A G+ Y++ + I  A E +    V+ +WT  VP
Sbjct: 111 YLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTVVP 170

Query: 201 LAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VG 259
            AAWI+IF  ++T++N  PVK+YGE EFW A +K++ I+G L   F +  G G +   +G
Sbjct: 171 KAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLG 230

Query: 260 FRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVP 318
           FRYW+ PGA+   I + N   GRFL   + +I   F F  G ELV +T+ EA + R+ + 
Sbjct: 231 FRYWQKPGAFAYHITTGNT--GRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIE 288

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPFIVAIQNSGTKVL 374
           +A ++  +R++ FY+ S L IG++V  NDP L +A +      ++SPF++AIQN+  K+L
Sbjct: 289 KASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKIL 348

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFG 434
           PHI NA IL++  S+ NS ++  SR L  ++++ +APK   + ++ GVPY AV  +A F 
Sbjct: 349 PHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFS 408

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            LAY+  S+G  K F W  NI+ ++GF  W+ I ++++RF +A+ +RG+  D +PFK+  
Sbjct: 409 CLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPF 467

Query: 495 MPGLAYYSSFFMXXXXXXQGFTAFAPKF-NGSSFLAAYISIFLFIAVWILFECIFRCRFI 553
            P   Y+    +       G+  F P+F  G+ F+AAYI++ +F+ +W+  +   R    
Sbjct: 468 QPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTLST 527

Query: 554 WKI--EDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWN 587
           W I   +VD+ +   +IE +  E       P + W+KF +
Sbjct: 528 WVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEKFMD 567

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/515 (35%), Positives = 294/515 (57%), Gaps = 13/515 (2%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G+ +   ++++LK RH                     L   GPV  LIAY F+G L F 
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W
Sbjct: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190

Query: 196 T--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
               +V    WI+IF V+I  +N+  V+++GEFEFW++S KV+ ++G ++  F ++ G G
Sbjct: 191 VSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGG 250

Query: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
                +GFRYWR+PGA+     +   ++G+F+ + S  + + F++ G EL GI   EA N
Sbjct: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKN 310

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV---STSPFIVAIQNS 369
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L          + SPF+VAIQNS
Sbjct: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNS 370

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429
           G KVLPHIFN  +L  + SA NS++YV SR L+ L+ +  APK  ++TSK GVPY A+  
Sbjct: 371 GIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMV 430

Query: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489
           + +F  LAYM  S G  K+F + +N+  + G  +W+ I I +I F +A + +G+ + +  
Sbjct: 431 SVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFA 490

Query: 490 FKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIF 548
           + A      AY++ FF       + FT F    F+  +F+  YI + +++  W+ ++ I+
Sbjct: 491 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIY 550

Query: 549 RCRFIWKIEDVDIDSDR----RDIEAIVWEDHEPK 579
           + + + K  D D+ + +    R+ E    +D E +
Sbjct: 551 KTKVV-KPADADLYTLKEIYDREEEQGKLQDQEKE 584

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/503 (36%), Positives = 289/503 (57%), Gaps = 11/503 (2%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G+ +   +K++LK RH                     L  AGPV  LIAY F+G + F 
Sbjct: 57  DGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFF 116

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
               LGEMATFIP+   FT ++ R+  PA G A GY Y   + I    +L+    V+Q+W
Sbjct: 117 TMACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYW 175

Query: 196 THK--VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC-MVCGA 252
             +  V    W+++ + +IT++N+F V+++GEFEFW++S+KV+ +IG +I  F  M+ GA
Sbjct: 176 VPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGA 235

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G    +GFRYW++PGA+       + + G+F+ +V+ L+   F + G EL GI A EA+N
Sbjct: 236 GSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASN 295

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TEATSYVSTSPFIVAIQNSGT 371
           PR++VP+AIK   +RIL FY+ S+  +G+ VPYND KL T   + ++ SPF +AI N+G 
Sbjct: 296 PRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGI 355

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
            VLP IFN  +L  + SAANS++YV SR L+ L+ +  APK  + T++ G+PY ++F + 
Sbjct: 356 TVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSC 415

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           +F  LAYM  S+   +VF++ +N+  +AG   W+ I I++I F +A++ + + +    + 
Sbjct: 416 LFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYV 475

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCR 551
           A   P  AY S FF       + FT F   F+  +F+  YI + +F+  +  ++   +  
Sbjct: 476 APFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSE 535

Query: 552 FIWKIEDVDIDS-----DRRDIE 569
            I     VD+ S     DR  +E
Sbjct: 536 -IRSARYVDLVSQKSLVDREQVE 557

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 198/574 (34%), Positives = 318/574 (55%), Gaps = 29/574 (5%)

Query: 32  THRRRGSLSLKDEKSK--ELYPLRSFPTGVNGQDTFS--MEENL-----QDEDE-----G 77
           T R+  S S  D+  +  E  P + F   +  ++  +  +E N+     QDE++     G
Sbjct: 2   TIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDG 61

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVT 137
           + +   +K+ LK RH                     LA AGPV  LIAY F+G L F   
Sbjct: 62  KTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTM 121

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT- 196
             LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I    +L+    VIQ+W  
Sbjct: 122 ACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVD 180

Query: 197 -HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
             KV    W++IF V+I  +N+F V+++GEFEFW++S KV+ ++G ++  F ++ G G  
Sbjct: 181 KEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPD 240

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              +GFRYWR+PG++     +   + GRF+ +VS  + A + + G EL GI A EA NPR
Sbjct: 241 HDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPR 300

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA---TSYVSTSPFIVAIQNSGT 371
           K++P+AIK  ++RI+ FY+ S+  +G+ V Y+DP L +A   ++  + SPF+VAI NSG 
Sbjct: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGI 360

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
             LPHI NA +L  + SA NS++YV SR L+ L+ +  APK  ++T++ G+PY A+  + 
Sbjct: 361 NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSV 420

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           +F  LAYM  S+   K+F + +N+  + G  +W+ I I++I F +A++ +G+ +    + 
Sbjct: 421 LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV 480

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFA-PKFNGSSFLAAYISIFLFIAVWILFECIFRC 550
           A   P  A++S FF       + FT F   +F+  +F+  YI + +F      F C F  
Sbjct: 481 APFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVF------FFCYFGY 534

Query: 551 RFIWKIEDVD-IDSDRRDIEAIVWEDHEPKTFWD 583
           +F +K + +D +  D    +A + ++ E     D
Sbjct: 535 KFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMAD 568

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  321 bits (822), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 201/612 (32%), Positives = 317/612 (51%), Gaps = 34/612 (5%)

Query: 2   TNPKQEAEIEEKHMYNEPVTTLLH---DVEA--SQTHRRRGSLSLKDEKSKELYPLRSF- 55
           +N K E    E +  N     L+    D+EA  S  + ++    + +EKS     L++  
Sbjct: 11  SNRKNENHQSENYEVNNNGIDLVDVDIDIEATASNDNNKKNPQIIYNEKSYSQDELQTTS 70

Query: 56  PTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLA 115
           PT +   D+   E   +   E    N E+K+ LK RH                     LA
Sbjct: 71  PTII---DSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALA 127

Query: 116 NAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFS-----QRFLSPAFGAANG 170
           N GP G  I+YL + +  + +  +LGEM  F+P   S +  S      +++ P+ G A  
Sbjct: 128 NCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAAS 187

Query: 171 YMYWFSWAITFALELSVVGQVIQFWT--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEF 228
           + Y++ + I  A E+S    VI++W     VP  AWI+IF  LI I+N  PV  YGE EF
Sbjct: 188 WNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEF 247

Query: 229 WVASIKVIAIIGFLIYCFCMVCGAG--VTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGW 286
           W ASIK++ I G +I  F +  G G    G +GFRYW+NPG++   I       G FL  
Sbjct: 248 WFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHITGGGG--GNFLDI 305

Query: 287 VSSLINAAFT-FQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPY 345
            + +I   F+   G ELV +T+ E A+ R+ + +A K+ V+R++ FYI   L IG++V Y
Sbjct: 306 YTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAY 365

Query: 346 NDP----KLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRIL 401
           NDP     L ++ +   +SPF++ IQN+G + +PHI N  ILT+  SA N+ ++  SR L
Sbjct: 366 NDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSL 425

Query: 402 FGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGF 461
             +++N  APK   R ++ GVPY AV A+ +   LAY+  S+    VF W  NI+ ++GF
Sbjct: 426 LTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGF 485

Query: 462 FAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPK 521
             W+   +++IRF +A+ Y  ++   +PF+AK      +YS F++       G+  F P+
Sbjct: 486 IGWICACVAYIRFRKAITYNKLTH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPR 544

Query: 522 -FNGSSFLAAYISIFLFIAVWILFECIFRC---RFIWKIEDVDIDSDRRDIEAIVW---- 573
            +N   F+AAYI++ +FI +WI  +   R     ++  I+ +D+ +   +IE +      
Sbjct: 545 NWNVKDFIAAYITLPIFIVLWIGHKVFTRTLLKAWLRPIDKIDVYTGLEEIEELTEELNA 604

Query: 574 EDHEPKTFWDKF 585
               PK  W+KF
Sbjct: 605 NRQAPKNKWEKF 616

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  315 bits (807), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 194/602 (32%), Positives = 310/602 (51%), Gaps = 31/602 (5%)

Query: 12  EKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFS--MEE 69
           EK+     V +   D   + T    G+L  KD+ +K +     F    + Q T S  + E
Sbjct: 4   EKYPGLTVVGSSSDDAATTHTIGSAGALPAKDKYNKTI----EFVDVESQQSTSSATISE 59

Query: 70  NLQDEDEGE---VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAY 126
            L D D           +++ LK RH                     LA  GP G  I+Y
Sbjct: 60  KLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISY 119

Query: 127 LFMGSLAFSVTQSLGEMATFIP-----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITF 181
           + + S+ + +    GEM  ++P      + S      R++  + G A  + Y++ + I  
Sbjct: 120 IIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILV 179

Query: 182 ALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGF 241
           A E +    V+++WT  VP   WI IF  ++ I+N  PVKYYGE EFW ASIK++ I+G 
Sbjct: 180 AAECTAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGL 239

Query: 242 LIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QG 299
           +I  F +  G G     +GFRYW+ PGA+   I+      GRFL   S +I   F F  G
Sbjct: 240 IILSFILFWGGGPNHDRLGFRYWQRPGAFTEHIM--KGGFGRFLDIYSGVIKGGFAFILG 297

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY--- 356
            ELV +T+ E  + R+ + +A ++ ++R++ FY+   L I ++V YNDP L  A +    
Sbjct: 298 PELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKP 357

Query: 357 -VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415
              +SPF++ IQN+G +VLPHI NA IL++  SA N+ ++  +R L  +++N  AP+   
Sbjct: 358 GAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFG 417

Query: 416 RTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475
           + ++ GVPY+A+  +     LA++  S+    VF W  NI+ ++GF  W+   +++IRF 
Sbjct: 418 KINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFR 477

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPK-FNGSSFLAAYISI 534
           +A+ + G+  D LPFK    P   YYS F +       G+  F PK + GS F+AAYI++
Sbjct: 478 KAIFFNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITL 536

Query: 535 FLFIAVWI---LFECIFRCRFIWKIEDVDIDSDRRDIE---AIVWEDH-EPKTFWDKFWN 587
            +F+ +W+   L+   F  R+  +++ +D+ +   DIE    I+ E   EP T W KF +
Sbjct: 537 PIFVVLWVGHKLWTRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQKFMD 596

Query: 588 VV 589
            V
Sbjct: 597 AV 598

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  314 bits (804), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 190/508 (37%), Positives = 295/508 (58%), Gaps = 9/508 (1%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           ++  ++ +G+  +  +K++LK RH                     LA AGPV  LI+Y F
Sbjct: 47  DDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSF 106

Query: 129 MGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188
           +G L F V   +GEMA +IP+   FT ++ R+  PA G A GY Y   + I    +L+  
Sbjct: 107 VGVLVFFVMSCIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAA 165

Query: 189 GQVIQFWT--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
             VIQ+W    KV    WI+I  V+I ++N F VK++GEFEFW++S KVI ++G +I  F
Sbjct: 166 ALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMF 225

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            ++ G   T   +GFRYW++PGA+     S + + GRF+ +VS  +   F + G EL GI
Sbjct: 226 IIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGI 285

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA---TSYVSTSPF 362
            A EA NPRK +P+AIK  ++RI+ FYI ++  +G+ V  NDP L EA   ++  + SPF
Sbjct: 286 VAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPF 345

Query: 363 IVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGV 422
           +VAI NSG + LPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++T++ G+
Sbjct: 346 VVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGI 405

Query: 423 PYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482
           PY ++    +F  LAYM  S+G  K+F + +N+  + G   W+ I I++I F +A++ +G
Sbjct: 406 PYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQG 465

Query: 483 ISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVW 541
           I +    + A L P  AY+S FF       + FT F   KF+  +F+  YI + LF   +
Sbjct: 466 IDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICY 525

Query: 542 ILFECIFRCRFIWKIEDVDIDSDRRDIE 569
             ++ + + + I K E+VD+ S +  I+
Sbjct: 526 FGYKFVKKTK-IRKPEEVDLFSFKAAID 552

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  313 bits (801), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 183/552 (33%), Positives = 296/552 (53%), Gaps = 18/552 (3%)

Query: 44  EKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEG-EVQNAEVKRELKQRHXXXXXXXXXX 102
           EK    Y ++S      G+        L+ + EG +     +++ L  RH          
Sbjct: 10  EKDTSFYDVKS-----QGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCI 64

Query: 103 XXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                      L N GP+   ++++ +  + + V  +L EM  ++P   +    + R++ 
Sbjct: 65  GTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVD 124

Query: 163 PAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKY 222
           P+ G A G+ Y +S++I  A ELS    V+Q+WT KV +A WI+IF V++  +N  PVK+
Sbjct: 125 PSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKF 184

Query: 223 YGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEG 281
           YGE EFW AS+K+I I+G LI    +  G   +   +GFRYW NPG +   I     N G
Sbjct: 185 YGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHI--TGGNTG 242

Query: 282 RFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIG 340
           RFL   +++I + F F    EL+G+   EA + R+ + +A ++ ++RI+ FYI S L IG
Sbjct: 243 RFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIG 302

Query: 341 LLVPYNDPKLTEATSY----VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYV 396
            ++  +DPKL +A +      ++SPF+  I N+G  VL HI NAVIL++  S+ANS +Y 
Sbjct: 303 FILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYA 362

Query: 397 GSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNIT 456
            SR +  L+K   APK  +R ++ GVPY AV  +     L Y+  S+   +VF WL NI 
Sbjct: 363 SSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNIC 422

Query: 457 GVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFT 516
            ++GF  W  I I+++RF +A+ Y  +  + +PFK+ L P   Y+   F+       G+ 
Sbjct: 423 TISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKSALQPYFTYFFVVFVVLLCLTNGYA 481

Query: 517 AFAPKF-NGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDI--EAIVW 573
            F PK+ N S F+AAYI++ +F  +++  +  F+ R+     ++D+ +   D   EA + 
Sbjct: 482 TFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVITGLADAEEEAKMT 541

Query: 574 EDHEPKTFWDKF 585
           +   PK  W+KF
Sbjct: 542 QPRTPKNMWEKF 553

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  311 bits (798), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 180/562 (32%), Positives = 298/562 (53%), Gaps = 15/562 (2%)

Query: 38  SLSLKDEKSKELYPLRSFPTGVNGQDTF-SMEENLQDEDEGEVQNAE--VKRELKQRHXX 94
           SL +K E S             + ++T+ +   NL+ ++   V + E  +K+ L  RH  
Sbjct: 2   SLEIKKEASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQ 61

Query: 95  XXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFT 154
                              L   GP    ++++ + ++ + +  +L EM  ++P   S  
Sbjct: 62  LIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVP 121

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITI 214
               R++ P+ G A G+ Y +S+A+  A EL+    ++++WT +VP   WI+IF +++ +
Sbjct: 122 ELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVV 181

Query: 215 MNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMV-CGAGVTGPVGFRYWRNPGAWGPGI 273
           +N   V++YGE EFW AS+K+I I+  L+    +   GA     VGFRYWRNPGA+G  I
Sbjct: 182 LNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHI 241

Query: 274 ISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFY 332
                N GRFL   +++I +AF F    ELVG+   EA + R+ + +A ++ ++RI+ FY
Sbjct: 242 --TGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFY 299

Query: 333 IGSLLFIGLLVPYNDPKL----TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIIS 388
           + S L IG++V  ND  L     E     ++SPF+  I NSG  VL H+ N  ILT+  S
Sbjct: 300 LSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWS 359

Query: 389 AANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKV 448
           A NS  Y  SR +  LSK   APK  S+ ++ GVPY AVF  ++   LAY+  S+   KV
Sbjct: 360 AGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKV 419

Query: 449 FEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXX 508
           F+WL NI  ++GF  W  I +++IRF +A+ +  +  D +P+++ L P  AY+ +  +  
Sbjct: 420 FQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAI 478

Query: 509 XXXXQGFTAFAP-KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRD 567
                G+  F   +++   FL +YIS+ +F+A ++  + I++ RF   ++ +D+ +   +
Sbjct: 479 ITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVITGLEE 538

Query: 568 IEAIVWED--HEPKTFWDKFWN 587
            E          PK  W+KF N
Sbjct: 539 AEEEAKLSVVRVPKNAWEKFIN 560

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  309 bits (792), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 174/499 (34%), Positives = 269/499 (53%), Gaps = 10/499 (2%)

Query: 62  QDTFSMEENLQDEDEGEVQ-----NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLAN 116
           + T  +E     EDE E +     N  + RELK R                      LA 
Sbjct: 5   KGTVVLERPASGEDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAK 64

Query: 117 AGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
            GP+   IAYLF GSL   V  SL EMA+F P+   F+ +  R++ PAFG A G+ Y+  
Sbjct: 65  GGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLK 124

Query: 177 WAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVI 236
           +AI  +  L+  G VI +W   V +  W+++ +V +  +N   VKY+GE E  +   K++
Sbjct: 125 YAIVLSANLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLL 184

Query: 237 AIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAF 295
            ++   I C  + CG        GFRYWR  GA  P ++      G+FLGW + ++ + F
Sbjct: 185 VLVIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PYLV--GGGTGKFLGWWACVVQSIF 241

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATS 355
            F G+E++GI  GE ANP+KT+P++   V FRI   Y+  +  +GL +   + KL  A S
Sbjct: 242 GFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHS 301

Query: 356 Y-VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
              + SPF++AI +SG KVLP+  NA +L  IIS+AN++IY+ SR L+GL+K+  APK  
Sbjct: 302 TDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIF 361

Query: 415 SRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
              ++  VP +     ++ G LAYM T      VF ++ +   V G   W +I I++I +
Sbjct: 362 LLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINY 421

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISI 534
            +A+K +GIS D++PF+    P  AY + FF+       G+ AF  KF+  +F+ +YI +
Sbjct: 422 DRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGV 481

Query: 535 FLFIAVWILFECIFRCRFI 553
           F  I + I ++  F+ +F+
Sbjct: 482 FANILMVIGYKLYFKTKFV 500

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  312 bits (800), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 179/520 (34%), Positives = 284/520 (54%), Gaps = 29/520 (5%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAF 134
           D G+  + ++K+ +K RH                     L N GP G +I Y  MGS  +
Sbjct: 87  DAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLY 146

Query: 135 SVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQ 193
            + Q+ GE+A  +  ++  F  +    + PA G +  ++Y   W     LEL      I+
Sbjct: 147 CIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIK 206

Query: 194 FWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-A 252
           +WT  V    +++IF+V+I  +N+F  + Y E EF+  + KV+ I GFLI    + CG A
Sbjct: 207 YWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGA 266

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G  G +G +YW +PG++     S +K    F G VS+L+ AAF F  TE + +TA E AN
Sbjct: 267 GNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQAN 321

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-EATSYVSTSPFIVAIQNSGT 371
           PRK++P A KK+++RIL  Y+GS++ IG LVP+N  +L     S    SP+++AI + G 
Sbjct: 322 PRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGV 381

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
           KV+PH+ NAVIL ++IS  NS  Y  SR+L  L++   AP FL    + G P +A+  ++
Sbjct: 382 KVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISS 441

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           VFG ++++  S   + VF WLL I+G++  F W  I +SHIRF +A+K +G S  EL FK
Sbjct: 442 VFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFK 501

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECI 547
           +++    +YY++  M      Q +TA AP    K +  +F   Y+++ + IA++  ++  
Sbjct: 502 SQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYK-- 559

Query: 548 FRCRFIWKIE--------DVDIDSDRR--DIEAIVWEDHE 577
                +WK +         +D+ S+RR  D + +  ED E
Sbjct: 560 -----VWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAE 594

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  311 bits (796), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 185/573 (32%), Positives = 293/573 (51%), Gaps = 44/573 (7%)

Query: 13  KHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQ 72
           +++  EPV+       +++ H R G      ++++E+                 ++ NL 
Sbjct: 22  ENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEEM----------------ELDPNLT 65

Query: 73  DEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMG 130
           + +   ++ A+  +K  LK RH                     L  AGP G LI +   G
Sbjct: 66  EAERIAIKTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTG 125

Query: 131 SLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190
           ++ +S+  ++GE+A   PV   FT ++ RF+  +FG A  ++Y   W +   LE+     
Sbjct: 126 TMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASI 185

Query: 191 VIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMV 249
            + +W T       ++++F+V+I I+N+F VK YGE EF  + IKVI +IGF+I    ++
Sbjct: 186 TVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLI 245

Query: 250 CGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308
           CG G     +G +YW NPGA+    +     + +F G+ +  + AAF+F G+ELVG+   
Sbjct: 246 CGGGKDHKYIGAQYWYNPGAF----VGDTAGQ-QFQGFCTVFVTAAFSFAGSELVGLAGS 300

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQ 367
           EA  PRK+VP A K+V +RI  FYI  LL IG+LVP + P+L  A+S   + SPF++AI 
Sbjct: 301 EAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIV 360

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
           N G K LP + N VIL  ++S  NS IY  SR L  L+     P       +GG P + +
Sbjct: 361 NHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGI 420

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
             +A FG +A++  S     VF WL+ ++G++  F W  I + HIR+  AL  +G S DE
Sbjct: 421 AISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDE 480

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFLFIAVWILF 544
           LPF+A      +Y+  F        Q +    P   K N   F  AY+S  +FIA++   
Sbjct: 481 LPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFH 540

Query: 545 ECIFRCRFIWK--------IEDVDIDSDRRDIE 569
           +       IWK        ++D+DID+ RR+++
Sbjct: 541 K-------IWKRNWKLFIPLKDLDIDTGRREVD 566

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  311 bits (798), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 194/612 (31%), Positives = 310/612 (50%), Gaps = 51/612 (8%)

Query: 4   PKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKD-EKSKELYPLRSFPTG---- 58
           P+ E E  E  M  + +  L ++ +   +H RR   S K  E S    P  S   G    
Sbjct: 44  PENEVEYFENTM-EKTMENLEYEGDRKASHLRRFIDSFKRAEGSHPNSPDSSNSIGGGAT 102

Query: 59  --------------VNGQDTFSMEENLQDEDEGEVQNAE-VKRELKQRHXXXXXXXXXXX 103
                         +N + +F  E  ++   + + QN E +K+ +K RH           
Sbjct: 103 PISTNDSSSQLDNELNPKGSFVTESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIG 162

Query: 104 XXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLS 162
                     L NAGP G +I Y  MGS  + + Q+ GE+A  +  +   F  +    + 
Sbjct: 163 TGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVD 222

Query: 163 PAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKY 222
           PA G +  ++Y   W     LEL      I++WT KV    ++ IF+VLI ++N+F  K 
Sbjct: 223 PALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKG 282

Query: 223 YGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEG 281
           Y E +F+    K++ IIGF I    + CG AG  G +G RYW NPGA+       N    
Sbjct: 283 YAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAF-----RGNTGIQ 337

Query: 282 RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGL 341
           RF G V++ + AAF F  +E + +TA E +NPRK +P A KK+++RIL  ++GSL+ +G 
Sbjct: 338 RFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGF 397

Query: 342 LVPYNDPKLTEAT-SYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRI 400
           LVPY   +L  A+ S    SP+++A+ + G +V+PH  NAVIL +++S AN   Y  SRI
Sbjct: 398 LVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRI 457

Query: 401 LFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAG 460
           L  L+K   APK      + G P +A+  +++FG +A+  +S   + VF WLL I+G++ 
Sbjct: 458 LMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQ 517

Query: 461 FFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP 520
            F W+ I +SHIRF +A+K +G S  E+ +K+++    + Y+   M      Q + A +P
Sbjct: 518 LFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISP 577

Query: 521 -----KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWK--------IEDVDIDSDRR- 566
                K +  SF   Y+++ + IA+++ ++       +WK         + +D+ +DR+ 
Sbjct: 578 IGGGGKLSAQSFFENYLAMPILIALYVFYK-------VWKKDWTLFIPADKIDLVTDRQI 630

Query: 567 -DIEAIVWEDHE 577
            D E +  ED E
Sbjct: 631 FDEELLKQEDEE 642

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  310 bits (795), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 176/519 (33%), Positives = 285/519 (54%), Gaps = 21/519 (4%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEM 143
           +K+ L+ RH                     L+  GP G L +Y+ +  + + V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 144 ATFIPVTS-----SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK 198
             F+P ++     S +    R+  P+ G A G+ Y++ + I  A E +    V+ +WT  
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 199 VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP- 257
           VP  AWI+IF  ++T++N  PVK YGE EFW A +K++ I+G L   F +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 258 VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKT 316
           +GFRYW++PGA+   I + N   GRFL   + +I   F F  G ELV IT+ EA + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTGNT--GRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP----KLTEATSYVSTSPFIVAIQNSGTK 372
           + +A ++  +R++ FY+ S L IG++V   DP     L E  +   +SPF++AIQN+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAV 432
           VLPHI NA IL++  S+ NS ++  SR L  ++++  AP+ L R ++ GVPY AV  +A 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
           F  LA++  S+G  K F W  NI+ ++GF  W+ I +++++F +A+ +RG+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 493 KLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRF 552
            L P   Y+    +       G+ +F   +N S F+AAYI++ +F+ +W+  +   R   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 553 IW--KIEDVDIDSDRRDIEA----IVWEDHEPKTFWDKF 585
            W   + +VD+ +   +IE     +  +   P   W KF
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  309 bits (791), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 176/543 (32%), Positives = 291/543 (53%), Gaps = 21/543 (3%)

Query: 63  DTFSMEENLQDEDEG--EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           D FS+  + +       ++   E+K+ LK RH                     L   GP 
Sbjct: 52  DVFSLSSSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPA 111

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSS----FTVF-SQRFLSPAFGAANGYMYWF 175
           G  I+Y  + S+ + + Q +GEM  ++P + S    F  +   +++  + G A+ + Y++
Sbjct: 112 GLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYY 171

Query: 176 SWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKV 235
            + I  A E +    V+++WT  VP AAWI+IF   + I+N   VK+YGE EFW ASIK+
Sbjct: 172 CYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKI 231

Query: 236 IAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAA 294
           + I+G +I  F +  G G     +GFRYW+NPG +   I  +  + G FL   + +I   
Sbjct: 232 LCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGG 289

Query: 295 FTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA 353
           F F  G E++ +T+ E  + R+ + +A ++ V+R++ FYI   L I ++V YNDP L  A
Sbjct: 290 FAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENA 349

Query: 354 TSY----VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL 409
            +       +SPF++ IQN+G KVLPHI NA IL++  SA N+ ++  SR L  +++N  
Sbjct: 350 LAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQ 409

Query: 410 APKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISI 469
           AP+  ++ ++ GVPY AV  ++    LAY+  S+    VF W  NI+ ++GF  W+ + I
Sbjct: 410 APRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCI 469

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF-NGSSFL 528
           ++IRF +A+ + G+ +  LP+ A+ MP L Y+    +       G+  F P+F +  +F+
Sbjct: 470 AYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFV 528

Query: 529 AAYISIFLFIAVWILFECIFRCRFI---WK-IEDVDIDSDRRDIEAIVWEDHEPKTFWDK 584
           AAYI++ +F  +WI      R  F    WK IE++D+ +   +IE    E    +    K
Sbjct: 529 AAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTK 588

Query: 585 FWN 587
           +W 
Sbjct: 589 WWE 591

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  306 bits (784), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 181/550 (32%), Positives = 292/550 (53%), Gaps = 34/550 (6%)

Query: 58  GVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANA 117
           G+NG     +E  LQ             + L  RH                     L   
Sbjct: 43  GINGNKDAKLEGKLQ-------------QGLSARHIQLIALGGAIGTGLFVGTSSTLHTC 89

Query: 118 GPVGALIAYLFMGSLAFSVTQSLGEMATFIP-----VTSSFTVFSQRFLSPAFGAANGYM 172
           GP G  I+Y+ + ++ + +  + GEM  ++P        S +    R++ P+   A G+ 
Sbjct: 90  GPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWN 149

Query: 173 YWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
           Y++ + I  A E +    V+++WT  VP AAWI+IF  ++ ++NL  VKYYGE EFW AS
Sbjct: 150 YFYCYVILVAAECTAASGVVKYWTDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFAS 209

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
           IKV+ I+G +I  F +  G G     +GFRYW+NPG +   I     N G FL   S +I
Sbjct: 210 IKVLCIVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHI--TGGNLGNFLDVYSGII 267

Query: 292 NAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
             AF F  G EL+ + + E  + R+ + +A K+ V+R++ FYI   L I ++V  NDP L
Sbjct: 268 KGAFAFILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPAL 327

Query: 351 TEATSY----VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSK 406
           T A +       +SPF++ IQN+G K+LPHI NA ILT+  SA N+ ++  SR L  ++ 
Sbjct: 328 TSALASGKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMAS 387

Query: 407 NKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLF 466
           N  APK   + ++ GVP++AV  +A+   LAY+  S+    VF W  NI+ ++GF  W  
Sbjct: 388 NGQAPKIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDC 447

Query: 467 ISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF-NGS 525
             ++++RF +A+KY G+  + LP+  +    + ++S   +       G+  F P+F N S
Sbjct: 448 GLVAYLRFRKAIKYNGL-ENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVS 506

Query: 526 SFLAAYISIFLFIAVWILFECIFR--CRFIWKIEDVDIDSDRRDIEA---IVWEDH-EPK 579
            F+AAYI++ LF+ +WI  +   R   ++ + +E++D+ +   +IE    I+ E+  EPK
Sbjct: 507 DFIAAYITLPLFVVLWIGHKIYTRDFKKWWYPVEEIDVVTGLTEIEERTRILDEERVEPK 566

Query: 580 TFWDKFWNVV 589
             + KF + +
Sbjct: 567 GAFPKFMDAL 576

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  307 bits (787), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 197/583 (33%), Positives = 302/583 (51%), Gaps = 21/583 (3%)

Query: 12  EKHMYNEPVTTLLHDVEASQTHRRRGSLSLKD---EKSKELYPLRSFPTGVNGQDTFSME 68
           +K  Y     TL   V++S T     S+   D   + SK +             +   ++
Sbjct: 18  KKETYFINSETLHEPVQSSLTPTTTASIDSNDATIDHSKSVSRWTRIKDSFKRAEKEEVD 77

Query: 69  ENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAY 126
            NL + +   +  A+  +K  LK RH                     L  AGP G +I +
Sbjct: 78  PNLTEAERIAINTAKAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGW 137

Query: 127 LFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
               ++ + +  +LGE+A   PV+  FT ++ RF+  +FG A+ + Y   W  T  LE+ 
Sbjct: 138 GLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIV 197

Query: 187 VVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
                + +W T +     ++++FW++I I+NLF V+ +GE EF  ++IKV+ +IGF+I  
Sbjct: 198 SASITVNYWQTPERYRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILG 257

Query: 246 FCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEG-RFLGWVSSLINAAFTFQGTELV 303
             +V G G  G     RYW NPGA+         N G +F G  S  + AAF+F G+ELV
Sbjct: 258 IVLVAGGGPEGGFVGGRYWHNPGAF------VGDNAGTQFKGVCSVFVTAAFSFAGSELV 311

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPF 362
           GITA EAANPRK+VPRA K+VV+RI+ FY+GSL+ IGLLVPY DP+L  A+S   S SPF
Sbjct: 312 GITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPF 371

Query: 363 IVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGV 422
           ++AI   G + LP + N VIL  ++S  NS I+ GSR +  LS+    P+      + G 
Sbjct: 372 VIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGR 431

Query: 423 PYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482
           P + +   + FG +A++  S    +VF WL+ ++G++  F W  I + HIRF  ALK +G
Sbjct: 432 PLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQG 491

Query: 483 ISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFLFIA 539
            S +ELPF +      + +  F +      Q + A  P   K +   F  +Y+S  + +A
Sbjct: 492 RSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLA 551

Query: 540 VWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
            +   +   +  +   K ED+DID+ RR  D+E +  E  E K
Sbjct: 552 FYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQEIEEEK 594

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  306 bits (785), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 196/582 (33%), Positives = 297/582 (51%), Gaps = 18/582 (3%)

Query: 9   EIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSME 68
            +E+K  +       L   +A  +    GS   + + SK  +  + F  G    +   ++
Sbjct: 2   SLEDKKNFVYAQEEPLEAQDAGHSSYETGSSPGQTQASKSRW--QDFKDGFKRVELEELD 59

Query: 69  ENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAY 126
            NL + ++  +  A+  ++R LK RH                     L   GP G LI +
Sbjct: 60  PNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGW 119

Query: 127 LFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
             +G + + V  S+GE+A   PV+  FT ++ RF+  +FG A  Y Y   W +   LE+ 
Sbjct: 120 GLIGLMIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIV 179

Query: 187 VVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
                + FW T       ++++F+++I I+N F V+ YGE EF  + IKVI +IGF+I  
Sbjct: 180 AASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILG 239

Query: 246 FCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVG 304
             +VCG G  G     +YW NPGA+     S +    RF G  S  + AAF+F GTELVG
Sbjct: 240 IVLVCGGGPVGGYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVG 294

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFI 363
           + + E ANPRK +PRA K+V +RIL FYI SL  IGLLVP+   +L   +S   + SPF+
Sbjct: 295 LASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFV 354

Query: 364 VAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVP 423
           +AIQ  G K LP + N VIL +++S  NS +Y  SR +  L++    P   +   + G P
Sbjct: 355 LAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRP 414

Query: 424 YIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGI 483
            +A+  T VFG L+++  S     VF WLL ++G++  F+W  I I HIRF +AL  +G 
Sbjct: 415 LVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGR 474

Query: 484 SRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFLFIAV 540
           S DEL F +      +Y+    +      Q + A  P     N   F +AY+S  + +A 
Sbjct: 475 STDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAF 534

Query: 541 WILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           +I  +   R  +   + +D+DID+ RR  D EA+  E  E K
Sbjct: 535 YIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEK 576

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  307 bits (787), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 185/583 (31%), Positives = 306/583 (52%), Gaps = 25/583 (4%)

Query: 29  ASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNG--QDTFSMEENLQDED--EGEVQNAEV 84
           +S +     S + KD+  +     ++     NG  ++   M+ +L+     +G+ +  ++
Sbjct: 47  SSGSRNNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSVDGDSEPHKL 106

Query: 85  KRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMA 144
           K+ L+ RH                     L   GP G  I+Y+ + ++ + +  +LGEM 
Sbjct: 107 KQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMV 166

Query: 145 TFIPVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKV 199
            F+P   S +  S      R++ P+ G A G+ Y++ + I  A E +    V+++WT  V
Sbjct: 167 CFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAV 226

Query: 200 PLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-V 258
           P   WI+IF  ++ I+N   VK YGE EFW ASIK++ I+G +I  F +  G G     +
Sbjct: 227 PKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRL 286

Query: 259 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTV 317
           GFRYW++PGA+   +     + G F    + +I  AF F  G ELV +T+ E A+ R+ +
Sbjct: 287 GFRYWQHPGAFAHHL--TGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNI 344

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPFIVAIQNSGTKV 373
            +A ++ V+R++ FY+   L I ++VPYNDP L  A +       +SPF++ IQN+G KV
Sbjct: 345 AKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKV 404

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVF 433
           LPHI N  ILT+  SAAN+ ++  +R L  +++   APK L R +K GVPY+AV  + + 
Sbjct: 405 LPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLC 464

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAY+  S+    VF W  NI+ ++GF  W+   I+++RF +A+ Y G+  D LPFK  
Sbjct: 465 SCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKTW 523

Query: 494 LMPGLAYYSSFFMXXXXXXQGFTAFAPKF-NGSSFLAAYISIFLFIAVWILFECIFRCRF 552
             P   ++S   +       G+  F PK+   + F+AAYI++ +F+ +W   +   R   
Sbjct: 524 GQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRTWR 583

Query: 553 IW--KIEDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWNVV 589
            W   + ++D+ +   +IE    E  E    P  F DKF + +
Sbjct: 584 QWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLDAL 626

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  306 bits (783), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 179/576 (31%), Positives = 303/576 (52%), Gaps = 29/576 (5%)

Query: 38  SLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQ---NAEVKRELKQRHXX 94
           S S ++E+ K ++  R         ++ + E+  + +   EV+   N ++K+ L  RH  
Sbjct: 9   SYSKEEEEKKTVFDNRQILINELDLESLTREKITRSDSSSEVEAEGNGKLKQGLSSRHVQ 68

Query: 95  XXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-----V 149
                              L   GP G +I+Y+ + ++ + +  +LGEM  ++P      
Sbjct: 69  FIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDS 128

Query: 150 TSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFW 209
             S      R++  +   A G+ Y++ + I  A E +    V+ +WT  VP A WI+IF 
Sbjct: 129 AGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTTSVPTAVWITIFL 188

Query: 210 VLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTG-PVGFRYWRNPGA 268
            ++T++N   VKY+GE EFW ASIK++ I+G ++  F +  G G +   +GF YW++PG 
Sbjct: 189 GIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGT 248

Query: 269 WGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFR 327
           +   I     + G FL   + +I  AF F  G ELV +T+ E  + R+ + +A K+ ++R
Sbjct: 249 FAHHI--TGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWR 306

Query: 328 ILTFYIGSLLFIGLLVPYNDP----KLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVIL 383
           ++ FYI   L I ++V YNDP     L E     ++SPF++ IQN+G KVLPHI NA IL
Sbjct: 307 LMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACIL 366

Query: 384 TTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETST 443
           ++  SA NS ++  SR L  ++ N  APK   + ++ GVPY +V  +A+   LA++  S+
Sbjct: 367 SSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSS 426

Query: 444 GGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSS 503
              +VF+W  NI+ ++GF  W+   I+++RF +A+ Y  +  D LPFK    P L +YS 
Sbjct: 427 STAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLPFKTFGQPYLIWYSL 485

Query: 504 FFMXXXXXXQGFTAFAPKF-NGSSFLAAYISIFLFIAVWILFECIFR-------CRFIWK 555
             +       G+  F P+F +GS F+AAYI++ LF+ +W+  +   R        +  + 
Sbjct: 486 LVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAVPLLKLYYP 545

Query: 556 IEDVDIDSDRRDIEAIV----WEDHEPKTFWDKFWN 587
           ++++D+ +   + E +          P T+W KF N
Sbjct: 546 VDEIDVITGLAEAEEVAEKLDMNRIPPSTYWGKFIN 581

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  307 bits (786), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 191/578 (33%), Positives = 298/578 (51%), Gaps = 51/578 (8%)

Query: 39  LSLKDEKSK---ELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXX 95
           +S KD  S+   EL P  S+ T V+G    S E+  + E+        +K+ +K RH   
Sbjct: 106 ISTKDSSSRLDNELNPKSSYIT-VDGIKQSSQEQEPKQEN--------LKKSIKPRHTVM 156

Query: 96  XXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTSSFT 154
                             L NAGP G +I Y  MGS  + + Q+ GE+A  +  +   F 
Sbjct: 157 MSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFN 216

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITI 214
            +    + PA G +  +++   W     LEL      I++WT KV    ++ IF+VLI +
Sbjct: 217 TYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILV 276

Query: 215 MNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGI 273
           +N+F  K Y E +F+    K++ I GF I    + CG AG  G +G RYWR+PGA+    
Sbjct: 277 INIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAF---- 332

Query: 274 ISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI 333
              + +  RF G V++ + AAF F  +E + +TA E +NPRK +P A KK+++RIL  ++
Sbjct: 333 -RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFL 391

Query: 334 GSLLFIGLLVPY-NDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANS 392
            SL  +G LVPY +D  L  A S    SP+++A+ + G +V+PH  NAVIL +++S ANS
Sbjct: 392 ASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANS 451

Query: 393 NIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWL 452
             Y  SRIL  L+K   APK      + G P +A+  +AVFG +A+  +S   + VF WL
Sbjct: 452 AFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWL 511

Query: 453 LNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXX 512
           L I+G++  F W+ I +SHIRF + +K +G S  E+ +K+++    + Y+   M      
Sbjct: 512 LAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIG 571

Query: 513 QGFTAFAP-----KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWK--------IEDV 559
           Q + A +P     K +  SF   Y+++ + IA++I ++       +WK         + +
Sbjct: 572 QFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYK-------VWKRDWSLFIPADKI 624

Query: 560 DIDSDRR--DIEAIVWEDHEPKT------FWDK---FW 586
           D+ S R   D E +  ED E K       FW +   FW
Sbjct: 625 DLVSHRNIFDEELLKQEDEEYKDRLRNGPFWKRVLDFW 662

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  305 bits (781), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 179/574 (31%), Positives = 295/574 (51%), Gaps = 14/574 (2%)

Query: 5   KQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDT 64
            +E   ++    N  V   L DVE   ++    +   ++E+       +         + 
Sbjct: 3   DKEYTTKDVEAGNVQVKETLPDVETGASYEHYDNYIDEEEQGPPDSRWKKIKDSFKRAEV 62

Query: 65  FSMEENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 122
             ++ NL + ++  +  A   ++ +LK RH                     L  AGP G 
Sbjct: 63  PELDPNLTEAEKIAIATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGI 122

Query: 123 LIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           LI ++  GS+ + +  S+ E+A   PV   FT ++ RF+  ++G AN + Y   W +T  
Sbjct: 123 LIGWIIAGSMIYCMVMSVAELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLP 182

Query: 183 LELSVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGF 241
           LE+      + +W T K     ++++FWV+I I+N+F V+ YGE EF  +  K++ I+GF
Sbjct: 183 LEIVAASITVNYWHTDKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGF 242

Query: 242 LIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
           +I    ++CG G        RYW +PGA+     + + +  +F G+ S  + AAF+F G+
Sbjct: 243 IILAIILICGGGPGTGYIGARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGS 297

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VST 359
           ELVG+ A EA+NPRK VP A K+V +RI  FY+  LL IG+LVPY DP+L   +S   + 
Sbjct: 298 ELVGLAAAEASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAA 357

Query: 360 SPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSK 419
           SPF++AI+N G   LP + N VIL  ++S  NS +Y  SR L  L+     PK  S   +
Sbjct: 358 SPFVIAIKNQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDR 417

Query: 420 GGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            G P + +  T+ FG +A++  S    +VF+WL+ ++G++  F W  I + HIRF +AL 
Sbjct: 418 MGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALA 477

Query: 480 YRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFL 536
            +G S +EL F +      A +  F        Q + A  P     + + F   Y+S+ +
Sbjct: 478 AQGRSTNELAFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPI 537

Query: 537 FIAVWILFECIFRC-RFIWKIEDVDIDSDRRDIE 569
            +A+W+  +   +  +   K ED+DID+ RR+++
Sbjct: 538 VLAMWLGHKIWKKNWKLFIKAEDMDIDTGRRELD 571

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  305 bits (781), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 180/554 (32%), Positives = 288/554 (51%), Gaps = 27/554 (4%)

Query: 54  SFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           SF +  N +       + ++       ++++ ++L  RH                     
Sbjct: 58  SFDSKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGAS 117

Query: 114 LANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L   GP   ++A++ + +  F++  +LGE+A   PV   F V+  RF+ P+FG A    Y
Sbjct: 118 LNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINY 177

Query: 174 WFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASI 233
              WA+   LEL      I++W + +   AW++IF+  I + N+  VK +GE EF ++ I
Sbjct: 178 LAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMI 237

Query: 234 KVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAW---GPGIISKNKNEGRFLGWVSS 289
           K++AIIGF I    + CG G +G  +G RYW +PGA+    PG         RF G  + 
Sbjct: 238 KILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTPG--------RRFKGVCAV 289

Query: 290 LINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPK 349
            + AAF++ GTELV ++A E+ NPR T+P+A K+  + I   YI  L  IG LVPYND +
Sbjct: 290 FVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDER 349

Query: 350 LTEATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
           L    S V  + SP ++AI+N G K LP + NA+IL  I+S ANS +Y  SR +  +++ 
Sbjct: 350 LLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEI 409

Query: 408 KLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
              PK L+   K G P  A+FAT +FG L+++  S   ++VF WL  ++G++  F W  I
Sbjct: 410 GNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSI 469

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFN 523
           ++SHIRF QA+K +  S +ELPF +      ++Y    +        +T+  P      +
Sbjct: 470 NLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGAD 529

Query: 524 GSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRRDIEAIVW--------E 574
             SF   Y+S+ +FI  ++  +   +  R   K +D+D+D+ RR+I+  +         E
Sbjct: 530 AESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLERE 589

Query: 575 DHEPKTFWDKFWNV 588
               K F+ +F NV
Sbjct: 590 QMAQKPFYIRFLNV 603

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  305 bits (782), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 179/526 (34%), Positives = 277/526 (52%), Gaps = 30/526 (5%)

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGS 131
           Q   E E +   +K+ +K RH                     L NAGP G +I Y  MGS
Sbjct: 133 QAPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGS 192

Query: 132 LAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190
             + + Q+ GE+A  +  +   F  +    + PA G +  +++   W     LEL     
Sbjct: 193 CVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASM 252

Query: 191 VIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVC 250
            I++WT KV    ++ IF+VLI ++N+F  K Y E +F+    K++ IIGF I    + C
Sbjct: 253 TIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDC 312

Query: 251 G-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGE 309
           G AG  G +G +YWR+PGA+       +    RF G V++ + AAF F  +E + +TA E
Sbjct: 313 GGAGTDGYIGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASE 367

Query: 310 AANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLTEATSYVSTSPFIVAIQN 368
            +NPRK +P A KK+++RIL  ++ SL  +G LVPY +D  L  A S    SP+++A+ +
Sbjct: 368 QSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSS 427

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVF 428
            G +V+PH  NAVIL +++S ANS  Y  SRIL  L+K   APK      + G P +A+ 
Sbjct: 428 HGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAML 487

Query: 429 ATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDEL 488
            +A+FG +A+  +S   + VF WLL I+G++  F W+ I +SHIRF +A+K +G S  E+
Sbjct: 488 VSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEV 547

Query: 489 PFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSSFLAAYISIFLFIAVWIL 543
            +K+++    + Y+   M      Q + A AP     K +  SF   Y+++ + IA++I 
Sbjct: 548 GYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIF 607

Query: 544 FECIFRCRFIWKIE--------DVDIDSDRR--DIEAIVWEDHEPK 579
           F+       +WK +         VD+ S R   D E +  ED E K
Sbjct: 608 FK-------VWKNDWSLFIPANKVDLVSHRNIFDEELLKQEDEEYK 646

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 170/526 (32%), Positives = 281/526 (53%), Gaps = 13/526 (2%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           E L+ +  G   N  + + L+ RH                     L N G    L++++ 
Sbjct: 32  EELETQSAGSEYNT-LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFIL 90

Query: 129 MGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188
           + ++ + +  SL EM  ++P   S      R++ P+ G A G+ Y +++AI  A ELS  
Sbjct: 91  ISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAA 150

Query: 189 GQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
             V+ +W + VP+AAWI+IF V++  +N   VKYYGE EFW ASIK+I I+G L+    +
Sbjct: 151 ASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVI 210

Query: 249 -VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGIT 306
              GA      GFRYW+NPG +   +     + GRFL    ++I +AF F    EL+GI 
Sbjct: 211 FFGGAPNHDRTGFRYWKNPGPFAMSL--APGSTGRFLDVWRAVIKSAFAFILSPELIGIA 268

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPF 362
             EA + R+   +A ++ ++RI+ FY+   L IG+++   DPKL EA        ++SPF
Sbjct: 269 CVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPF 328

Query: 363 IVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGV 422
           +  I N+G  VL H+ N  IL++  SA NS +Y  +R++  L++   APKFL++ ++ GV
Sbjct: 329 VQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGV 388

Query: 423 PYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482
           PY AV    +   LAY+   T    VF+WL NI  ++GF  W  + I+ IRF + + +  
Sbjct: 389 PYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNN 448

Query: 483 ISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-KFNGSSFLAAYISIFLFIAVW 541
           + +  +P++  L P +AYY +F         GF  F   ++N   F+AAY+++ +++ ++
Sbjct: 449 L-QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLY 507

Query: 542 ILFECIFRCRFIWKIEDVDIDSD--RRDIEAIVWEDHEPKTFWDKF 585
           +  +  FR R+   +E +D+ +     + E+ +     PK  W+KF
Sbjct: 508 LGHKLWFRTRWYIPVEQIDVITGLVEAEEESKMTPPRIPKNLWEKF 553

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  298 bits (764), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 166/503 (33%), Positives = 271/503 (53%), Gaps = 7/503 (1%)

Query: 66  SMEENLQDEDEGEVQN-AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALI 124
           ++ ++    DEG   N A + REL                         LA  GP+   +
Sbjct: 14  TLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFL 73

Query: 125 AYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
           AYLF GS+   V  SL EMA F P+   F+ +  +++ PAFG A G+ Y+  +AI  +  
Sbjct: 74  AYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSAN 133

Query: 185 LSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L+  G VI +W   + +A W+++ +    ++N   V+Y+G+ E ++   K+  ++   I 
Sbjct: 134 LTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIV 193

Query: 245 CFCMVCGAGVT-GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELV 303
           C  + CG G     +GFRYWR  G + P ++    N G+FLGW + +I + F F G+E++
Sbjct: 194 CLVITCGGGPDHTTIGFRYWRESG-FLPYLV--KGNTGKFLGWWACVIQSIFGFMGSEMI 250

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPF 362
           GI  GE ANPRKT+P+A + V+ RI  FYI  +  +GL V  ++ KL  A S   + SPF
Sbjct: 251 GIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANASPF 310

Query: 363 IVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGV 422
           ++AI  SG KVLP   NA +L  I S+A ++IY+ SR L+GL+K+  APK   R +K  +
Sbjct: 311 VIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKI 370

Query: 423 PYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482
           P +     ++ G LAYM T      VF ++ +   V G   W +I +++I + + +K  G
Sbjct: 371 PMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHG 430

Query: 483 ISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWI 542
           +  DE+PF+    P  AY + FF+       G++AF  KFN   F+ +YI IF  + + +
Sbjct: 431 VRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVL 490

Query: 543 LFECIFRCRFIWKIEDVDIDSDR 565
            ++  ++ +++ K E++  +  +
Sbjct: 491 GYKLYYKTKWV-KPEEITFEKKQ 512

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  303 bits (775), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 182/544 (33%), Positives = 281/544 (51%), Gaps = 31/544 (5%)

Query: 47  KELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXX 106
             L  +++ PTG NGQ  F  E               +K+ +K RH              
Sbjct: 120 NSLDRVQNKPTG-NGQMKFEEEA--------------LKKSIKPRHVVMISLGTGIGTGL 164

Query: 107 XXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAF 165
                  L NAGP G +I Y  MGS  + + Q+ GEMA  +  +   F  +    + P F
Sbjct: 165 LVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGF 224

Query: 166 GAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGE 225
           G A  ++Y   W     LEL      I++WT  V   A++ IF+V+I  + +F  + Y E
Sbjct: 225 GFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAE 284

Query: 226 FEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFL 284
            EF+    K++ IIGF I    +   GAG  G +G +YW +PGA+            RF 
Sbjct: 285 AEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAF-----RGTNGIQRFK 339

Query: 285 GWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVP 344
           G +++ ++AAF F  TE + +TA E +NPRK +P A KKV++R++  ++G++  +G LVP
Sbjct: 340 GIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVP 399

Query: 345 YNDPKLTEAT-SYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFG 403
           ++  +L  A  S    SP+++AI   G +V+PH  NAVIL ++ S ANS  Y  SR+L G
Sbjct: 400 WDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLG 459

Query: 404 LSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFA 463
           L++   APKF     + G P+ A+   A+FG +A+   S   D+VF WLL I+G++  F 
Sbjct: 460 LAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFT 519

Query: 464 WLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP--- 520
           W+ I +SHIRF +A+  +G S  E+ FKA+L    +YY++  M      Q + A AP   
Sbjct: 520 WIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIGN 579

Query: 521 --KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWED 575
               +   F   Y+++ + IA +  ++   R  R   + +D+D+DS R+  D E +  ED
Sbjct: 580 NGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQED 639

Query: 576 HEPK 579
            E K
Sbjct: 640 EEYK 643

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 181/545 (33%), Positives = 295/545 (54%), Gaps = 25/545 (4%)

Query: 42  KDEKSKELYPL-----RSFPTGVNGQDTFSMEENLQDEDEGEVQNAE--VKRELKQRHXX 94
           +++ S   YP      + F       D+  ++ NL D  +  +  ++  ++R+LK RH  
Sbjct: 35  QEDYSNSSYPKSGSKWKDFKDSFKRMDSVDLDPNLTDAQKIAILTSQSPLQRKLKNRHLQ 94

Query: 95  XXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFT 154
                              L  AGP G LI +  M ++   +  SLGEMA   PV+  +T
Sbjct: 95  MIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEMAVTFPVSGGYT 154

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPL-AAWISIFWVLIT 213
            ++ RF+  ++G AN   Y     +   LE+      + +W  K    AA++++FW+ I 
Sbjct: 155 TYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYRAAFVALFWLCIV 214

Query: 214 IMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPG 272
            +N+F VK YGE EF  + IKV+ +IGF+I    +VCG G T   +G ++W NPGA+   
Sbjct: 215 SINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAF--- 271

Query: 273 IISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFY 332
               +    +F G  S  + AAF+F  TELVG+ A E  +PRK+VP+A K+V +RI  FY
Sbjct: 272 --VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFY 329

Query: 333 IGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAAN 391
           I SLL +GLLVPY DP+L  ++    + SPF++A++N G K LP + N VILT ++S  N
Sbjct: 330 ILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSVINVVILTAVLSVGN 389

Query: 392 SNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEW 451
           S+++  SR L  LS+    P       + G P +++  ++ FG L ++  S    ++F+W
Sbjct: 390 SSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDW 449

Query: 452 LLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXX 511
           +L+++G++  F WL IS+ HIRF +AL  +  S DEL F + +    +YYS F +     
Sbjct: 450 MLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLI 509

Query: 512 XQGFTAFAP---KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKI----EDVDIDSD 564
            Q + A  P   K + S+F  AY+S+ + +A+++  +   +    WK+    + +DID+ 
Sbjct: 510 LQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKN---WKLLIDPKYMDIDTG 566

Query: 565 RRDIE 569
           RR+++
Sbjct: 567 RRELD 571

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  301 bits (772), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 178/547 (32%), Positives = 291/547 (53%), Gaps = 28/547 (5%)

Query: 68  EENLQDED-------EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           E+ + D D       EG+ +  ++K+ L+ RH                     L   GP 
Sbjct: 87  EDLIMDVDVEKSPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPA 146

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQ-----RFLSPAFGAANGYMYWF 175
           G  I+Y+ + ++ + +  +LGEM  F+P   S +  S      R++  + G A G+ Y++
Sbjct: 147 GLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFY 206

Query: 176 SWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKV 235
            + I  A E +    V+++WT  VP   WI+IF  ++ ++NL  VK YGE EFW ASIK+
Sbjct: 207 CYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKI 266

Query: 236 IAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAA 294
           + I+G +I  F +  G G     +GFRYW++PGA+   +     + G F    + +I  A
Sbjct: 267 LCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHL--TGGSLGNFTDIYTGIIKGA 324

Query: 295 FTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA 353
           F F  G ELV +T+ E A+ R+ + +A ++ V+R++ FY+   L I ++VPYNDP L  A
Sbjct: 325 FAFILGPELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNA 384

Query: 354 TSY----VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL 409
            +       +SPF++ IQN+G KVLPHI N  IL++  SAAN+ ++  +R L  +++   
Sbjct: 385 LAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQ 444

Query: 410 APKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISI 469
           APK L R ++ GVPY+AV  + +   LAY+  S+    VF W  NI+ ++GF  W+   I
Sbjct: 445 APKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCI 504

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF-NGSSFL 528
           +++RF +A+ Y G+  D LPFK    P   + S   +       G+  F PK+   + F+
Sbjct: 505 AYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFI 563

Query: 529 AAYISIFLFIAVWILFECIFRCRFIW--KIEDVDIDSDRRDIEAIVWEDHE----PKTFW 582
           AAYI++ +F+ +W   +   R    W   + ++D+ +   +IE    E  E    P +F 
Sbjct: 564 AAYITLPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFK 623

Query: 583 DKFWNVV 589
           DKF + +
Sbjct: 624 DKFMDAL 630

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 198/584 (33%), Positives = 306/584 (52%), Gaps = 24/584 (4%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60
           M++P +E  +E++    E   T++ D  + Q        S  ++     Y       G N
Sbjct: 1   MSSP-EEYNLEDRS--KEKNITIIRDDFSGQDIVSESLESFDNQIDSSNYASHRSAWG-N 56

Query: 61  GQDTF------SMEENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXX 112
             D+F       ++ NL D ++  ++ A   ++ +LK RH                    
Sbjct: 57  FLDSFKRVEVEEVDPNLTDLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGR 116

Query: 113 PLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYM 172
            L  AGP G LI +   G++ F++  +LGE+A   PV+  FT ++ RF+  +FG A  + 
Sbjct: 117 ALRTAGPAGILIGWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFN 176

Query: 173 YWFSWAITFALELSVVGQVIQFWTHKVPLA-AWISIFWVLITIMNLFPVKYYGEFEFWVA 231
           Y   W +   LE+      + +W   V     ++++FW+++ I+N+F V+ YGE EF  +
Sbjct: 177 YMLQWLVVLPLEIVAASITVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFS 236

Query: 232 SIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSL 290
            IKV A+IGF+I    +VCG G  G     RYW NPGA+       + +  +F G+ S  
Sbjct: 237 IIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGAF-----VGSTSGQKFHGFCSVF 291

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           + AAF+F G+EL+G+   EA NPRK VP A K+V +RIL FYI  LL IG LVPYNDP+L
Sbjct: 292 VTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRL 351

Query: 351 -TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL 409
            + ++   S SPF++AI   G   LP + N VIL +++S  NS IY  SR L  LS+   
Sbjct: 352 ISSSSVDASASPFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGF 411

Query: 410 APKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISI 469
            PK +S   + G P + +  ++ FG +A++  S   +++F WLL I+G++ FF W  I I
Sbjct: 412 LPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICI 471

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSS--- 526
            HIRF  ALK +G   DELPF +      +Y+  F        Q + A  P     S   
Sbjct: 472 CHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYE 531

Query: 527 FLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRRDIE 569
           F +AY++  + +A +I  +   +  +F+  +EDVDID+ RRD +
Sbjct: 532 FFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDTGRRDTD 575

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  300 bits (767), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 180/565 (31%), Positives = 297/565 (52%), Gaps = 28/565 (4%)

Query: 31  QTHRRRGSLSLKDEKSKELY--PLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKREL 88
           Q  +  G  ++ D+++ ++Y   + S+ + ++G    S      D  +G+     +K+ L
Sbjct: 5   QDLKDAGETTVTDKQTGQVYEIDIESY-SQISGPKVSS-----SDAPQGD---HTLKKGL 55

Query: 89  KQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP 148
           K RH                     L   GP G   +Y  +  + + V  +LGEM  ++P
Sbjct: 56  KSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLP 115

Query: 149 VTSSFTV-----FSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAA 203
              S +         R++ P+ G A G+ Y++ + I  A E +    V+Q+WT  VP  A
Sbjct: 116 GDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVPKGA 175

Query: 204 WISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRY 262
           WI+IF  ++ ++N   VK+YGE EFW AS+K++ I+G L   F +  G G     +GFRY
Sbjct: 176 WITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRY 235

Query: 263 WRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAI 321
           W+ PGA+   I S N   GRFL   + +I   F F  G ELV +T+ EA + R+ + +A 
Sbjct: 236 WQKPGAFAYHITSGNT--GRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKAS 293

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPFIVAIQNSGTKVLPHI 377
           ++ V+R++ FY+ S L IG +V YND  L+ A         +SPF++ IQN+G KVLPHI
Sbjct: 294 RRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHI 353

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALA 437
            N  IL++  S+ NS ++  SR L  +S+   APK L R ++ GVPY AV  T++   +A
Sbjct: 354 INVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIA 413

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           Y+  S+    VF W  NI+ ++GF  W+ I I+++RF +A+ ++ +  + +PFK    P 
Sbjct: 414 YLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVPFKTPFQPY 472

Query: 498 LAYYSSFFMXXXXXXQGFTAFAP-KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKI 556
             ++    +       G+  F P  +N S F+AAY+++ +F+ +WI  +   R    W I
Sbjct: 473 GTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAI 532

Query: 557 --EDVDIDSDRRDIEAIVWEDHEPK 579
              ++D+ +  ++IE    E  E +
Sbjct: 533 PVPEIDVTTGLKEIEEESKECDEKR 557

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  299 bits (766), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 175/545 (32%), Positives = 284/545 (52%), Gaps = 26/545 (4%)

Query: 43  DEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXX 102
           D K K+L         ++G +T ++E       E E Q+A   ++L  RH          
Sbjct: 40  DSKQKDL---------MSGSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAI 90

Query: 103 XXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                      L   GP   +I ++ + +  F++  +LGE+++  PV   F V+  RF+ 
Sbjct: 91  GTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVE 150

Query: 163 PAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKY 222
           P+FG A    Y   WA+   LEL      I++W H +   AW++IF+ +I + NL  VK 
Sbjct: 151 PSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKS 210

Query: 223 YGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEG 281
           +GE EF ++ +K++AIIGF I    + CG G  G     +YW NPGA+       +    
Sbjct: 211 FGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAF-----VGHTAGD 265

Query: 282 RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGL 341
           RF G  S  + AAF++ GTEL+ ++A E+ NPR T+P+A K+  + I   YI  L  +G 
Sbjct: 266 RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGC 325

Query: 342 LVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSR 399
           LV  +DP+L   +S V  + SP ++AI+N G K LP + NA+IL  ++S ANS +Y  SR
Sbjct: 326 LVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSR 385

Query: 400 ILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVA 459
            +  +++    PK  +   + G P  A+ AT +FG L+++  S   ++VF WL  ++G++
Sbjct: 386 CMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLS 445

Query: 460 GFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL--AYYSSFFMXXXXXXQGFTA 517
             F W  I++SHIRF + +K RG + DELPF +  M G+  +YY    +        +T+
Sbjct: 446 TLFCWFAINVSHIRFRRTMKERGRTLDELPFVS--MTGVWGSYYGCIVIFIVLVVCFWTS 503

Query: 518 FAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRRDIEAIV 572
             P      N  SF   Y+S  + +A +   +   R  R +   +++D+DS RR ++  +
Sbjct: 504 LFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLEL 563

Query: 573 WEDHE 577
            +D +
Sbjct: 564 MKDEK 568

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  299 bits (765), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 181/575 (31%), Positives = 296/575 (51%), Gaps = 35/575 (6%)

Query: 43  DEKSKELYPLRSFPTGVNGQDTFSMEENL----QDEDEGEVQNAE----------VKREL 88
           D K ++L  L         ++T+S+E+ L    +++D  ++ + E          + ++L
Sbjct: 9   DTKQQDLSSLSEVGQSFAKEETWSVEKQLKPLAEEKDYADMNDVEKAIYNTKDSKLNKDL 68

Query: 89  KQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP 148
             RH                     L+  GP   +IA+  + +  F++  SLGE++   P
Sbjct: 69  SIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATFP 128

Query: 149 VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIF 208
           V   F V+  RF+ P+FG A  + Y   WAI   LEL      I++W   +   AW+SIF
Sbjct: 129 VVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSINPDAWVSIF 188

Query: 209 WVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVC-GAGVTGPVGFRYWRNPG 267
           +V I   N+  VK +GE EF ++ +K++AIIGF I    ++C G    G +G +YW +PG
Sbjct: 189 YVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPG 248

Query: 268 AWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327
           A+       +    RF G  +  I AAF++ G ELVG++A E+ NPR T+P+A K+  + 
Sbjct: 249 AF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWL 303

Query: 328 ILTFYIGSLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTT 385
           I   Y+  L  IG LVP NDP L   TS V  + SP ++AIQN G K LP + NA+IL  
Sbjct: 304 ITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIILIA 363

Query: 386 IISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGG 445
           ++S ANS +Y  SR +  +++    P+ L+   K G P  A+  T + G L+++  S   
Sbjct: 364 LLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKR 423

Query: 446 DKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFF 505
           D+VF WL  ++G++  F W  I+++H+RF  A+K++  S +ELP+ +      ++Y    
Sbjct: 424 DEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIV 483

Query: 506 MXXXXXXQGFTAFAPK----FNGSSFLAAYISIFLFIAVWILFECIFR-CRFIWKIEDVD 560
           +        +T+  P      + +SF  +Y+S+ +FIA ++  +   R  R   K+ +VD
Sbjct: 484 IGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVD 543

Query: 561 IDSDRRDIEAIVWEDHEP--------KTFWDKFWN 587
           +DS R D +A   +  +         K F+ + WN
Sbjct: 544 VDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWN 578

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  299 bits (765), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 175/552 (31%), Positives = 282/552 (51%), Gaps = 23/552 (4%)

Query: 42  KDEKSKELYPLRS------FPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXX 95
           K     ++ PL S           +G +++++E         + +++   ++L  RH   
Sbjct: 22  KQSSRNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSDAEDSRYNKDLSVRHLLT 81

Query: 96  XXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTV 155
                             L   GP   +I ++ + +  F++  +LGE+++  PV   F V
Sbjct: 82  LAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNV 141

Query: 156 FSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIM 215
           +  RF+ P+FG A    Y   WA+   LEL      I++W   +   AW++IF+ +I + 
Sbjct: 142 YISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFYTIIFLA 201

Query: 216 NLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGII 274
           NL  VK +GE EF ++ +K++AIIGF I    + CG G  G     +YW NPGA+     
Sbjct: 202 NLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAF----- 256

Query: 275 SKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIG 334
             N +  RF G  S  + AAF++ GTEL+ ++A E+ NPR T+P+A K+  + I   YI 
Sbjct: 257 VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIV 316

Query: 335 SLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANS 392
            L  +G LVP +DP+L   +S V  + SP ++AI+N G K LP + NA+IL  ++S ANS
Sbjct: 317 VLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANS 376

Query: 393 NIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWL 452
            +Y  SR +  +++    PK  S   + G P  A+ AT +FG L+++  S   + VF WL
Sbjct: 377 AVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTWL 436

Query: 453 LNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL--AYYSSFFMXXXX 510
             ++G++  F W  I++SHIRF   +K RG S DELPF +  M G+  +YY    +    
Sbjct: 437 SALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVS--MTGVWGSYYGCVIIFVVL 494

Query: 511 XXQGFTAFAPKFNG----SSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDR 565
               +TA  P   G     SF   Y+S  + +  +I  +   +  R +    ++DIDS R
Sbjct: 495 VVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGR 554

Query: 566 RDIEAIVWEDHE 577
           R ++  V +D +
Sbjct: 555 RAVDIEVLKDEK 566

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  299 bits (765), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 194/591 (32%), Positives = 297/591 (50%), Gaps = 30/591 (5%)

Query: 6   QEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTF 65
            E+ +  K      V  L  DVE+ Q H         ++ +K       F   V+G    
Sbjct: 11  SESSLNGKLAIKTAVEELSPDVESDQNHDYYKDKVHVNDPNKS-----RFQNFVDGFREL 65

Query: 66  SMEE---NLQDEDEGEVQ--NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
            ME+   NL   +   +   ++ +KR LK RH                     L   GP 
Sbjct: 66  RMEDVDPNLTAAERAAIATASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPA 125

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
             +IA++  GS+ +SV Q+LGE+A  +PV+ S+  +  RF+ P+FG A  Y Y     IT
Sbjct: 126 AVVIAWIMTGSMVYSVVQALGELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLIT 185

Query: 181 FALELSVVGQVIQFWTHKVPLA-AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAII 239
             LEL      + +W      A A++++F+++I  +NLF VK YGE EF  + IKV AI+
Sbjct: 186 MPLELIAASITVNYWDVDSKYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIV 245

Query: 240 GFLIYCFCMVCGAGVT--GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
           GF+I    +VCG G +  G +G RYW NPG +  G          F G+ +  + +AF+F
Sbjct: 246 GFIILGIVLVCGGGPSDEGYIGARYWYNPGGFAHG----------FKGFAAIFVTSAFSF 295

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TEATSY 356
            G+E+  + A E  NPRK +PRA K+V +RI  FY+ SL  IG LVPY D  L   ++  
Sbjct: 296 AGSEMFALAAAETENPRKDLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVD 355

Query: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416
            S SPF++AI  +G K LP + N VIL  ++S  N  +Y  SR +  L+     P+    
Sbjct: 356 ASASPFVIAIARAGIKGLPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGY 415

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
             + G P + +   A+FG L+++  S+   +VF+W+L I+G+  FF W  I + H+RF +
Sbjct: 416 VDRKGRPLVGILLCAIFGLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRR 475

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYIS 533
           AL  +G S DEL +KA+     + Y    +      Q + A  P     N + F +AY+S
Sbjct: 476 ALSVQGRSTDELSYKAQTGIWGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLS 535

Query: 534 IFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPKTF 581
           + + I  +   +   R   F+ K  D+DID+ RR  D+E +  E  E + +
Sbjct: 536 LPVVIFFYTCHKLYTRSWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQY 586

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  299 bits (765), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 183/556 (32%), Positives = 291/556 (52%), Gaps = 20/556 (3%)

Query: 26  DVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAE-- 83
           D+E+     ++ + +      ++    R F       +   ++ NL +++   +  A   
Sbjct: 29  DLESESIDIKKETFNYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQERIAIITAHTP 88

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEM 143
           +K  LK RH                     L  AGP   +I +   GS+ +S+  ++ EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-THKVPLA 202
           A   P++  FT ++ RF+  +FG AN + Y   W +   LE+      + +W T      
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++FW++I I+NLF VK YGE EF  ++IKVI ++GF+I    +VCG G TG     +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 262 YWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
           YW +PGA+            +F G+ S  + AAF+F G+EL+GI   EA NPRK VP A 
Sbjct: 269 YWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQNSGTKVLPHIFNA 380
           K+V +RIL FYI SLLFIGLLVP ND +L  +++   + SPF++AI   G + LP + N 
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINV 383

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYME 440
           VIL  ++S  NS IY  SR L  L++    PK +S   + G P + +  ++ FG +A++ 
Sbjct: 384 VILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVA 443

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S     VF WLL I+G++ FF W  I + HIRF  ALK +  S DELPF + L    +Y
Sbjct: 444 QSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSY 503

Query: 501 YSSFFMXXXXXXQGFTAFAPKFN---GSSFLAAYISIFLFIAVWILFECIFRCRFIWKI- 556
           +  F +      Q + A  P  +    ++F +AY+S+ + + ++I  +   +    WKI 
Sbjct: 504 WGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKN---WKIF 560

Query: 557 ---EDVDIDSDRRDIE 569
                +D+D+ R+ ++
Sbjct: 561 IPLGQLDLDTGRKQLD 576

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  298 bits (764), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 189/571 (33%), Positives = 295/571 (51%), Gaps = 33/571 (5%)

Query: 9   EIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSME 68
            +E + +  EP++   HD+ ++ +           E+ K+      F      ++   ++
Sbjct: 18  RVESEFISQEPLS---HDLSSTGS-----------EEHKKGKVWTRFVDSFRERERLEVD 63

Query: 69  ENLQDEDE--GEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAY 126
            N+ + D+      N+ ++  LK RH                     L  AGP G LI +
Sbjct: 64  PNMSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGW 123

Query: 127 LFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
              G++ +S+  +LGE+A   PV+  FT ++ RF+  ++G AN   Y   W +   LE+ 
Sbjct: 124 GLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIV 183

Query: 187 VVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
                + +W T+      ++++FW+ I I+NLF VK YGE EF  + IKVI ++GF+I  
Sbjct: 184 AASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILG 243

Query: 246 FCMVCGAG-VTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVG 304
             + CG G V G +G RYW +P     G    +    RF G  S  + AAF+F G+ELVG
Sbjct: 244 IILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVG 299

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFI 363
           + + E ANPRK+VP+A K+V +RI  FY+ +L  +GLLVPY + +L  A+S   + SPF+
Sbjct: 300 LASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFV 359

Query: 364 VAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVP 423
           +AI   G + LP + N VIL  ++S  NS IY  SR L  L++    PKF     + G P
Sbjct: 360 IAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRP 419

Query: 424 YIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGI 483
             ++  T+ FG +A++  S    +VF WLL ++G++  F W  I + HIRF +AL  +G 
Sbjct: 420 LYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGR 479

Query: 484 SRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFLFIAV 540
             DEL F +      +Y+  F +      Q + A  P   K N  +F  AY+S  + IA 
Sbjct: 480 GTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIAC 539

Query: 541 WILFECIFRCRFIWKI----EDVDIDSDRRD 567
           + L   I++    WKI    ED+DID+ R+D
Sbjct: 540 Y-LGHKIYKKN--WKIFIKAEDMDIDTGRKD 567

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  300 bits (768), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 192/612 (31%), Positives = 307/612 (50%), Gaps = 49/612 (8%)

Query: 4   PKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKD-EKSKELYPLRSFPTG---V 59
           P+ E E  EK +  + +  + ++ E   ++ RR   S +  E S    P  S   G   +
Sbjct: 48  PENEVEYFEKTV-EKTIENMEYEGEHHASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPI 106

Query: 60  NGQDTFSMEEN--------------LQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXX 105
           + +D+ S  +N               Q   E E +   +K+ +K RH             
Sbjct: 107 STKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTG 166

Query: 106 XXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPA 164
                   L NAGP G +I Y  MGS  + + Q+ GE+A  +  +   F  +    + PA
Sbjct: 167 LLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPA 226

Query: 165 FGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYG 224
            G +  +++   W     LEL      I++WT  V    ++ IF+VLI ++N+F  K Y 
Sbjct: 227 LGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYA 286

Query: 225 EFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRF 283
           E +F+    K++ I+GF I    + CG AG  G +G +YWR+PGA+       +    RF
Sbjct: 287 EADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF-----RGDTPIQRF 341

Query: 284 LGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLV 343
            G V++ + AAF F  +E + +TA E +NPRK +P A KK+++RIL  ++ SL  +G LV
Sbjct: 342 KGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLV 401

Query: 344 PY-NDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILF 402
           PY +D  L  A S    SP+++A+ + G +V+PH  NAVIL +++S AN   Y  SRIL 
Sbjct: 402 PYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILM 461

Query: 403 GLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFF 462
            L+K   APK      + G P  A+  +A+FG +A+  +S   + VF WLL I+G++  F
Sbjct: 462 SLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLF 521

Query: 463 AWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-- 520
            W+ I +SHIRF +A+K +G S  E+ +K+++    + Y+   M      Q + A AP  
Sbjct: 522 TWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIG 581

Query: 521 ---KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWK--------IEDVDIDSDRR--D 567
              K +  SF   Y+++ ++IA++I ++       +WK         + VD+ S R   D
Sbjct: 582 GGGKLSAQSFFENYLAMPIWIALYIFYK-------VWKKDWSLFIPADKVDLVSHRNIFD 634

Query: 568 IEAIVWEDHEPK 579
            E +  ED E K
Sbjct: 635 EELLKQEDEEYK 646

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  298 bits (764), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 185/570 (32%), Positives = 298/570 (52%), Gaps = 31/570 (5%)

Query: 19  PVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSF-------PTGVNGQDTFSMEENL 71
           P +TL +D E     +   S S    K +    + SF       P+ +    T + E  L
Sbjct: 47  PSSTLSNDFEPISQDQNTTSHSRTRAKFQNF--IDSFKRADKEQPSTLEHDLTKTFEGTL 104

Query: 72  QDEDEG----EV--QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIA 125
           +  ++G    EV  ++ E+K  +K RH                     LAN+GP G +I 
Sbjct: 105 EPSEDGTQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIG 164

Query: 126 YLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
           Y  MGS  + + Q+ GEMA  +  +   F  +    + PA G +  ++Y   W     LE
Sbjct: 165 YAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLE 224

Query: 185 LSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIAIIGFLI 243
           L      I++WT KV    ++ IF+VLI ++N+      Y E EF+  S K++ ++GF I
Sbjct: 225 LVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFI 284

Query: 244 YCFCMVCG-AGVTGPVGFRYWRNPGAW-GPGIISKNKNEGRFLGWVSSLINAAFTFQGTE 301
               ++CG AG  G +G RYW +PGA+ G   I       RF G VS+L+NAAF F  +E
Sbjct: 285 LGIILICGGAGDDGYIGGRYWHDPGAFRGEHAID------RFKGVVSTLVNAAFAFGLSE 338

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTEATSYVSTS 360
           ++G+TA E +NPRK +P A KK+++RI+  Y+GS++ +G LVP+N D  L  +   V  S
Sbjct: 339 MIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKAS 398

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           P+++A+   G +V+PH  NAVIL +++S ANS  Y  SR+L GL++   APK      + 
Sbjct: 399 PYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDRE 458

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           G P + +   A+   +++  TS   D+VF WLL I+G++  F W  I +SHIRF +A+  
Sbjct: 459 GRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAV 518

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFL 536
           +G S  E+ FK++     ++Y+   M      Q + A AP    + +  +F   Y++  +
Sbjct: 519 QGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPI 578

Query: 537 FIAVWILFECIFRC-RFIWKIEDVDIDSDR 565
            IA++  ++   +  R   + +D+D+D +R
Sbjct: 579 LIALYFGYKIYTKDWRLFIRAKDIDLDINR 608

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  300 bits (767), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 179/583 (30%), Positives = 300/583 (51%), Gaps = 30/583 (5%)

Query: 28  EASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRE 87
             S+TH        KD+  +     ++     NG     ++       +G+     +K+ 
Sbjct: 109 SGSRTHHYEAE---KDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQG 165

Query: 88  LKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFI 147
           L+ RH                     L   GP G  I+Y+ + ++ + +  +LGEM  F+
Sbjct: 166 LQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFL 225

Query: 148 PVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLA 202
           P   S +  S      R++  + G A G+ Y++ + I  A E +    V+++WT  VP  
Sbjct: 226 PGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKG 285

Query: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFR 261
            WI+IF  ++ ++N   VK YGE EFW ASIK++ I+G +I  F +  G G     +GFR
Sbjct: 286 VWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFR 345

Query: 262 YWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRA 320
           YW++PG++   +     + G F    + +I  AF F  G ELV +T+ E A+ R+ + +A
Sbjct: 346 YWQHPGSFAHHL--AGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKA 403

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPFIVAIQNSGTKVLPH 376
            ++ V+R++ FY+   L I ++VPYNDP L  A +       +SP+++ IQN+G KVLPH
Sbjct: 404 SRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPH 463

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
           I N  ILT+  SAAN+ ++  +R L  +++   APK L + ++ GVPY+AV  + +   L
Sbjct: 464 IINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCL 523

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           AY+  S+    VF W  NI+ ++GF  W+   I+++RF +A+ + G+  D LPFK    P
Sbjct: 524 AYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQP 582

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAPKF-NGSSFLAAYISIFLFIAVWILFECIFRCRFIW- 554
              ++S   +       G+  F PK+ N + F+AAYI++ +F+ +W+  +   R    W 
Sbjct: 583 YTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWNHWW 642

Query: 555 -KIEDVD-------IDSDRRDIEAIVWEDHEPKTFWDKFWNVV 589
             + ++D       I+   RDIE +      P TF +KF + +
Sbjct: 643 HSVSEIDVTTGLVEIEEKSRDIEEL---RLPPATFKEKFMDAL 682

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  297 bits (760), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 188/598 (31%), Positives = 315/598 (52%), Gaps = 41/598 (6%)

Query: 12  EKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENL 71
           +K   ++P+ + + D+EA+    +     L  +K KE          ++  +T S++E  
Sbjct: 16  DKADKSDPIISEV-DIEANTITEQ-----LTKDKHKET---------IDYSETSSLDEEK 60

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGS 131
           Q + E   +N ++K+ LK RH                     LA  GP G   +YL + +
Sbjct: 61  QQQPE---ENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICT 117

Query: 132 LAFSVTQSLGEMATFIPVTSSFTVFS-----QRFLSPAFGAANGYMYWFSWAITFALELS 186
             + +  + GEM  ++P   S +  S     ++++  + G A+ + Y++ + I  A E +
Sbjct: 118 FIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECT 177

Query: 187 VVGQVIQFWT--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
               V+++W    KVP  AWI+IF   +  +N+ PV +YGE EFW ASIK++ I+G +I 
Sbjct: 178 AAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIIL 237

Query: 245 CFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTEL 302
            F +  G G +   +GFRYW+ PGA+   I   +   G FL   + +I   F F  G EL
Sbjct: 238 SFILFWGGGPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIKGGFAFVLGPEL 295

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VS 358
           V +T+ E  + R+ + +A ++ V+R++ FY+   L I ++V YNDP L  A +       
Sbjct: 296 VSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAG 355

Query: 359 TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTS 418
           +SPF++ IQN+G KVLPHI N  I+T+  SA N+ ++  SR L  ++ +  APKF S+ +
Sbjct: 356 SSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKIN 415

Query: 419 KGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQAL 478
           + GVPY+AV  + +F  LAY+  S+    VF W  NI+ ++GF  W+   +++IRF +A+
Sbjct: 416 RFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAI 475

Query: 479 KYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF-NGSSFLAAYISIFLF 537
            +  +  D LP+K      L +YS F +       G+  F P+F +   F+AAYI++ +F
Sbjct: 476 IFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVF 534

Query: 538 IAVWILFECIFRCRFIWKI--EDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWNVV 589
           I +WI  + + R    W I  + +D+ +   +IE +  E  E    P   WDKF + +
Sbjct: 535 IVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNAWDKFLDAL 592

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  297 bits (760), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 169/519 (32%), Positives = 271/519 (52%), Gaps = 16/519 (3%)

Query: 59  VNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAG 118
           V   D F   E ++ ED   + N  + ++L  RH                     L+  G
Sbjct: 64  VTSSDHFRGSEGIEQED---INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGG 120

Query: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           P   +I ++ + +  F+V  SLGE++   PV   F V+S RF+ P+F  A    Y   W 
Sbjct: 121 PASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWL 180

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
           +   LEL      I++W  K+   AW++IF+  I + N+  VK +GE EF ++ IK+++I
Sbjct: 181 VLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSI 240

Query: 239 IGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
           IGF I    + CG G  G     +YW +PGA+       + +  +F G  S  + AAF++
Sbjct: 241 IGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSY 295

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV 357
            G E+  ++A E+ NPR+T+P+A K+  + I   Y+  L  IG LVP NDP+L   +S V
Sbjct: 296 SGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSV 355

Query: 358 --STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415
             ++SP ++AI+N G K LP + NA+IL  ++S ANS +Y  SR +  ++     PKFL+
Sbjct: 356 DAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLN 415

Query: 416 RTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475
           R  K G P  A+  T  FG L+++  S    +VF WL  ++G++  F W+ I++SHIRF 
Sbjct: 416 RVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFR 475

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAY 531
           QA+K +  S DELPF ++     ++Y    +        +T+  P      N  SF   Y
Sbjct: 476 QAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGY 535

Query: 532 ISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRRDIE 569
           +S  + I  +   +   R    + K+ED+D+D+ R+ ++
Sbjct: 536 LSFPILIVCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVD 574

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  297 bits (761), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 173/532 (32%), Positives = 287/532 (53%), Gaps = 27/532 (5%)

Query: 58  GVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANA 117
           G NG +T   EE L +ED    +  ++K+ L  RH                     L   
Sbjct: 80  GYNGNETIISEE-LINEDG---RKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKC 135

Query: 118 GPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFS-----QRFLSPAFGAANGYM 172
           GP G + +YL + ++ + +   LGEM  ++P   S +  S     +R+L  +   A G+ 
Sbjct: 136 GPAGLVASYLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWN 195

Query: 173 YWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
           Y++ + +  A E +    V+++WT  VP  AWI +F ++I  +N+ PV+ YGE EFW A 
Sbjct: 196 YYYCFVMLVAAECTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAI 255

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
            K++ I+G +I  F +  G G     +GFRYW  PG++   I   N + G FL     +I
Sbjct: 256 SKILCIVGLIILSFILFWGGGPNHDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGII 313

Query: 292 NAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
             AF+F  G ELV + + E ++PR+ + +A K+ ++R++ FYI   L I ++V YNDP L
Sbjct: 314 LGAFSFILGPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPIL 373

Query: 351 TEA----TSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSK 406
           + A         +SPF++ IQN+G  VLPHI N  IL +  S+ N+ ++  SR L  ++ 
Sbjct: 374 STALIQDKPGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAI 433

Query: 407 NKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLF 466
           N  APK L + ++ GVPY+AV  + +   +AY+  S     VF+W  N++ ++GF  W+ 
Sbjct: 434 NSQAPKCLGKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWII 493

Query: 467 ISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPK-FNGS 525
           +S++++RF +A++Y G+ +D LP+     P L  YS           GF    P+ +N S
Sbjct: 494 VSVTYLRFRKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVS 552

Query: 526 SFLAAYISIFLFIAVWI-------LFECIFR-CRFIWKIEDVDIDSDRRDIE 569
            F+AAY+++ +F+ +WI        F+   R CR+ +++ED+D+ +   +IE
Sbjct: 553 DFIAAYLTLPIFLMIWIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIE 604

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  297 bits (760), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 174/533 (32%), Positives = 277/533 (51%), Gaps = 23/533 (4%)

Query: 60  NGQDTFSME--ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANA 117
           +G++   +E  EN    ++   +N E+K+ +K RH                     L NA
Sbjct: 80  DGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNA 139

Query: 118 GPVGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
           GP G LI Y  MG+  + + Q+ GE+A ++  ++  F V+    + PAFG +  ++Y   
Sbjct: 140 GPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQ 199

Query: 177 WAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVI 236
           W     LEL      I++WT  V    ++ IF+VLI ++N F  + Y E EF+    K++
Sbjct: 200 WLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKIL 259

Query: 237 AIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAF 295
            +IGF I    +   GAG  G +G RYW  PGA+     + ++    F G +++++ AAF
Sbjct: 260 MMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAF 314

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-EAT 354
            F  TE + +TA E +NPRK +P A KKV++RIL  ++GS+  +G LVPY+  +L     
Sbjct: 315 AFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGG 374

Query: 355 SYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
           S    SP+++A+   G KV+PH  NAVIL +++S  NS  Y  SR+L+ L++   APKF 
Sbjct: 375 SATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFF 434

Query: 415 SRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
               + G P+ A+    VF  +++   S   ++VF WLL I+G++  F W  I +SHIRF
Sbjct: 435 DYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRF 494

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISI 534
            +A+  +  S  E+ FKA+     +YY  F +      Q + A AP   G      +   
Sbjct: 495 RKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFEN 554

Query: 535 FLFIAVWILFECIFRCRFIWKIE--------DVDIDSDRR--DIEAIVWEDHE 577
           +L + + ILF   ++   IWK +        ++D+D  R+  D E +  ED E
Sbjct: 555 YLAMPILILFYVGYK---IWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEE 604

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  296 bits (759), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 186/534 (34%), Positives = 285/534 (53%), Gaps = 25/534 (4%)

Query: 64  TFSMEENLQDEDEG-EVQ-NAEVKRE----LKQ----RHXXXXXXXXXXXXXXXXXXXXP 113
           TF   + L D   G +V+  AEV R+    LKQ    RH                     
Sbjct: 60  TFHRADGLGDGASGNDVEFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKA 119

Query: 114 LANAGPVGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYM 172
           L N GP G +I Y  MGS  + + Q+ GE+A ++  ++ +F  +    +  AFG +  ++
Sbjct: 120 LHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWI 179

Query: 173 YWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
           Y   W     LEL      I++WT  V    +++IF+VLI ++N+F  + Y E EF+   
Sbjct: 180 YCLQWLCVLPLELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNC 239

Query: 233 IKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
            KV+ IIGF I    + CG AG  G +G RYW NPGA+        K    F G +S+++
Sbjct: 240 CKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAF-----YGTKPIHHFKGIISTMV 294

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            AAF F  TE + +TA E ANPR+ +P A KKVV+RIL  ++  ++ IG LVP+N P+L 
Sbjct: 295 TAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELM 354

Query: 352 -EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLA 410
              +S    SP+++A+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L+    A
Sbjct: 355 GSGSSATHASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYA 414

Query: 411 PKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISIS 470
           P +L    + G P  A+  + VFG ++++  S   + VF WLL I+G++  F W+ I +S
Sbjct: 415 PAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVS 474

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSS 526
           HIRF +AL  +G    EL +K++     +YY++F M      Q + A AP    K + +S
Sbjct: 475 HIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANS 534

Query: 527 FLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHE 577
           F   Y+++ LF+ ++  F+   R  R    +E +D+DS R+  D E +  ED E
Sbjct: 535 FFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAE 588

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  296 bits (758), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 177/522 (33%), Positives = 273/522 (52%), Gaps = 16/522 (3%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
            +L+D  E    ++++K+ +K RH                     L   GP   +I Y+ 
Sbjct: 76  SDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYIL 135

Query: 129 MGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
           +  + + + Q+ GEMA   P + ++F  +S  F+S +FG A  ++Y F W     LEL  
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELIT 195

Query: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               IQFW  K+    +I IF+V +  ++ F VK YGE EF     K++ I GF+I    
Sbjct: 196 ASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIV 255

Query: 248 MVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGIT 306
           + CG AG  G +G  YW NPGA+     + + + GRF      L+ A F+F G EL  ++
Sbjct: 256 INCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALS 310

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIVA 365
             E +NPRK+ P A K+ ++RI+  Y+ +++ IG  VPYND +L  A  S    SP+++A
Sbjct: 311 VQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
               G K++PHI NAVIL +++S ANS++Y G R++  L++   APKFL    + G P  
Sbjct: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLR 430

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
           A+    VFG +A++  S+  + VF WL  I G++  F W  I +SH+RF QA+K +G S 
Sbjct: 431 ALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490

Query: 486 DELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNG-----SSFLAAYISIFLFIAV 540
           DEL +KA      + Y  FF       Q + A AP  NG      SF   Y++  +++A 
Sbjct: 491 DELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAF 550

Query: 541 WILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           +  +    R    +  ++ +D+D  RR  D E +  ED E K
Sbjct: 551 YFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENK 592

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  296 bits (758), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 188/570 (32%), Positives = 295/570 (51%), Gaps = 23/570 (4%)

Query: 24  LHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDED-EGEVQ-- 80
           ++++++S + +     + ++ K    + + SF     G  T + + N    D EG+V   
Sbjct: 28  VNNLQSSSSEKNYSGQTTRNNKLIHRF-VDSFKRA-EGSTTHTKQINENTSDLEGDVNSF 85

Query: 81  --NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQ 138
             ++++K+ +K RH                     L   GP   +I Y  +  + + + Q
Sbjct: 86  TSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQ 145

Query: 139 SLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTH 197
           + GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL      I+FW  
Sbjct: 146 AAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWND 205

Query: 198 KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTG 256
            +    +I IF+V +  ++ F VK YGE EF     K++ I GF+I    + CG AG  G
Sbjct: 206 TINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDG 265

Query: 257 PVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
            +G +YWRNPGA+     + + + GRF      L+ A F+F G EL  ++  E ANPRKT
Sbjct: 266 YIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKT 320

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIVAIQNSGTKVLP 375
            P A K+ ++RIL  Y+ +++ IG  VPYND +L  A  S    SP+++A    G KV+P
Sbjct: 321 TPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKVVP 380

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGA 435
           HI NAVIL ++IS ANS++Y G R++  L++    PKFL    + G P IA+   +VFG 
Sbjct: 381 HIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGV 440

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           + ++  S+  + VF WL  I G++  F W  I +SH+RF QA+K +G S DEL +KA   
Sbjct: 441 IGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTG 500

Query: 496 PGLAYYSSFFMXXXXXXQGFTAFAPKFNG-----SSFLAAYISIFLFIAVWILFECIFRC 550
              + Y  FF       Q + A AP  NG      SF  +Y++  ++IA ++ +    R 
Sbjct: 501 IWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRD 560

Query: 551 -RFIWKIEDVDIDSDRR--DIEAIVWEDHE 577
             F+  ++ +D+D  R   D E +  ED E
Sbjct: 561 FTFLNPLDKIDLDFHRHIYDPELMRQEDLE 590

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  296 bits (757), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 175/543 (32%), Positives = 282/543 (51%), Gaps = 26/543 (4%)

Query: 44  EKSKELYPLRSFPT-GVN-------GQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXX 95
            K+   +PL S  + G+N         D F   E+ + ED   + N  + ++L  RH   
Sbjct: 41  SKTDSAFPLSSKDSPGINQTTNDITSSDRFRRNEDTEQED---INNTNLSKDLSVRHLLT 97

Query: 96  XXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTV 155
                             L+  GP   +I ++ + +  F+V  SLGE++   PV   F V
Sbjct: 98  LAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNV 157

Query: 156 FSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIM 215
           +S RF+ P+F  A    Y   W +   LEL      I++W  K+   AW++IF+  I + 
Sbjct: 158 YSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALA 217

Query: 216 NLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGII 274
           N+  VK +GE EF ++ IK+++IIGF I    + CG G  G     +YW +PGA+     
Sbjct: 218 NMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF----- 272

Query: 275 SKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIG 334
             + +  +F G  S  + AAF++ G E+  ++A E+ NPR+T+P+A K+  + I   Y+ 
Sbjct: 273 VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVT 332

Query: 335 SLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANS 392
            L  IG LVP NDP+L   +S V  ++SP ++AI+N G K LP + NA+IL  ++S ANS
Sbjct: 333 ILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANS 392

Query: 393 NIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWL 452
            +Y  SR +  ++     PKFL+R  K G P  A+  T  FG L+++  S    +VF WL
Sbjct: 393 AVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWL 452

Query: 453 LNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXX 512
             ++G++  F W+ I++SHIRF QA+K +  S DELPF ++     ++Y    +      
Sbjct: 453 SALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIA 512

Query: 513 QGFTAFAPKFNGS-----SFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR 566
             +T+  P   GS     SF   Y+S  + I  ++  +   R    + K+ED+D+D+ R+
Sbjct: 513 SFWTSLFP-LGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRK 571

Query: 567 DIE 569
            ++
Sbjct: 572 QVD 574

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  295 bits (756), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 170/553 (30%), Positives = 286/553 (51%), Gaps = 29/553 (5%)

Query: 38  SLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXX 97
           ++S+ D+  K      +   GV+ +      E   +    E  +  +K  L+ RH     
Sbjct: 15  NISVYDKNDKN-----NIKDGVSFEKPIIYSEVDIESGAKESSSRNLKHGLQSRHIQLIA 69

Query: 98  XXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSS----- 152
                           LAN GP   +I+Y+ + ++ + +    GEM  ++P         
Sbjct: 70  LGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESV 129

Query: 153 --FTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWV 210
                   +++  + G A  + Y++ + +  A E +    ++++WT K+P A  I +F  
Sbjct: 130 GYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAVLIFLFLG 189

Query: 211 LITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP----VGFRYWRNP 266
           +I ++N  PVK+YGE EFW A IK+  I G +I  F + CG          VGF YW+NP
Sbjct: 190 VIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNP 249

Query: 267 GAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVV 325
            ++   +   N + G FL   ++LI  AF F  G ELV +T+ E  + R+ + +A ++ V
Sbjct: 250 SSFRDYV--TNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFV 307

Query: 326 FRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPFIVAIQNSGTKVLPHIFNAV 381
           +R++ FYI   L I ++VPYNDP L  A +       +SPF++ IQN+G  +LPHI N  
Sbjct: 308 YRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIINFC 367

Query: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMET 441
           ILT+ +SA N+ ++  +R L  + KN  AP+  SR ++ GVPY+A+  + +   LA++  
Sbjct: 368 ILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNC 427

Query: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501
           S    KVF+W  NI+ ++GF  W    I+++RF + + Y G+  D LPFK K    L +Y
Sbjct: 428 SASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWY 486

Query: 502 SSFFMXXXXXXQGFTAFAPKF-NGSSFLAAYISIFLFIAVW---ILFECIFRCRFIWK-I 556
           S  F+       G+    PKF N   F+AAYI++ +F+ ++   I++   +R R  WK +
Sbjct: 487 SFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIYSGRWRQRKWWKPV 546

Query: 557 EDVDIDSDRRDIE 569
           +++D+ +   +IE
Sbjct: 547 DEIDVVTGLEEIE 559

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  295 bits (756), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 181/527 (34%), Positives = 293/527 (55%), Gaps = 22/527 (4%)

Query: 66  SMEENLQDED---EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 122
           S ++  Q  D   +G+ +   +K++L+ RH                     L  AGP   
Sbjct: 38  STDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSI 97

Query: 123 LIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           LIAY  MG + F+V   LGEMA +IP+   FT ++ R+  PA G A G+ Y F + +   
Sbjct: 98  LIAYSIMGWVVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTP 156

Query: 183 LELSVVGQVIQFW--THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
            +L+    VIQFW    +V    WI++   +I ++N   V+++GEFEFW++S KV+ ++ 
Sbjct: 157 NQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLC 216

Query: 241 FLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNE-----GRFLGWVSSLINAA 294
            +I    +  G G T   +GFRYW +PGA+     SK         G+F+ ++S  + A 
Sbjct: 217 VMILLLVLALGGGPTHDRLGFRYWSDPGAFKE--YSKKDTHIKGGLGKFVAFLSVFVYAL 274

Query: 295 FTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT 354
           F + GTEL GI A E  +PR+ VPRAIK  ++RI+ FY+ ++  +G+ V YNDP L +A+
Sbjct: 275 FAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQAS 334

Query: 355 SYVSTS---PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
           S   ++   P++VAI+N+   VLP++FNA +LT + SA NS++YVGSR L+GL+ +  AP
Sbjct: 335 SAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAP 394

Query: 412 KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           K  +RT+K GVPY A+    +F  LAYM  S      F + +N+T + G  +W+ I I++
Sbjct: 395 KLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITY 454

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPK-FNGSSFLAA 530
           I F +A + +GI +  L + A   P   + +  F       + F AF  K  +  +F+  
Sbjct: 455 ICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITG 514

Query: 531 YISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHE 577
           YI + ++I  +I ++ + + ++I   ++VD+ + +   EAI  E+ E
Sbjct: 515 YIGLPIYIFCFIGYKIVHKTKWI-PSKEVDLFTFK---EAIDLEEEE 557

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 189/584 (32%), Positives = 289/584 (49%), Gaps = 19/584 (3%)

Query: 9   EIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEK-SKELYPLRSFPTGVNGQDTFSM 67
            +E+K  +       L   +   +    GS  + D K +      + F  G    +   +
Sbjct: 2   SLEDKKNFVYAQEEPLEGRDVGHSSYETGSGEITDSKPTSSGSRWQDFVDGFKRVELGDL 61

Query: 68  EENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIA 125
           + NL   ++  +  A   ++R LK RH                     L   GP   LI 
Sbjct: 62  DPNLTQAEKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIG 121

Query: 126 YLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALEL 185
           +  +G + +SV  ++GE+A   PV   FT +  RF+  +FG A  Y+Y   W +   LE+
Sbjct: 122 WGLIGLMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEI 181

Query: 186 SVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
                 + +W T       ++++F+V+I I+N+F VK YGE EF  + IKV  ++GF+I 
Sbjct: 182 VAASITVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIIL 241

Query: 245 CFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEG-RFLGWVSSLINAAFTFQGTEL 302
              ++CG G  G     +YW NPGA+         N G RF    S  + AAF+F GTEL
Sbjct: 242 GIVLICGGGPVGGYVGGKYWHNPGAF------NGDNAGQRFKAVCSVFVTAAFSFAGTEL 295

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSP 361
           VG+ A E  NPRK +PRA K+V +RI  FYI SL  IGLLVPY    L  ++S   + SP
Sbjct: 296 VGLAAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASP 355

Query: 362 FIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGG 421
           F++AI+  G   LP + N VIL +++S  NS++Y  SR L  L+     P+  S   + G
Sbjct: 356 FVLAIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKG 415

Query: 422 VPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481
            P + + AT  FG L ++  S     VF WL+ ++G++  F W FI I H+RF +AL  +
Sbjct: 416 RPLVGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQ 475

Query: 482 GISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF---NGSSFLAAYISIFLFI 538
           G S DEL F + +    +Y+    +      Q + A  P     N S F  AY+S+ + +
Sbjct: 476 GRSTDELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVL 535

Query: 539 AVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
             ++  +   R   F  + +D+DID+ RR  D++A+  E  E K
Sbjct: 536 FFYLAHKLYTRNWTFAKRAKDIDIDTGRRELDLDALKQEIAEEK 579

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  296 bits (757), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 180/523 (34%), Positives = 275/523 (52%), Gaps = 16/523 (3%)

Query: 66  SMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIA 125
            +E   + E E +    E+K+ +K RH                     LAN+GP G +I 
Sbjct: 91  DIEGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIG 150

Query: 126 YLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
           Y  MGS  + + Q+ GE+A  +  +T  F  +    + PAFG A  ++Y   W     LE
Sbjct: 151 YAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLE 210

Query: 185 LSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIAIIGFLI 243
           L      I++WT KV    ++ IF+ LI  +N+      Y E EF+  S K++ + GF I
Sbjct: 211 LVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFI 270

Query: 244 YCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTEL 302
               ++CG AG  G +G R W NPG++       +K   RF G VS+L+NAAF F  +E 
Sbjct: 271 LGIVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEF 325

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTEATSYVSTSP 361
           +G+TA E +NPRK +P A KK+++RI+  Y+GS+  +G LVPY+ D  L  + +    SP
Sbjct: 326 LGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASP 385

Query: 362 FIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGG 421
           +++AI   G +V+PH  NAVIL +++S  NS  Y  SR L  LS+   AP FL+   + G
Sbjct: 386 YVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNG 445

Query: 422 VPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481
            P  A   +A+ G +A+  TS   D+VF WLL I+G++  F W  I +SH+RF +A++ +
Sbjct: 446 RPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQ 505

Query: 482 GISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVW 541
           G S  E+ FK+++    + YS   M      Q +TA  P   G   + A+   +L + ++
Sbjct: 506 GRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIF 565

Query: 542 ILFECIFRC-----RFIWKIEDVDIDSDRR--DIEAIVWEDHE 577
           I+    F+      R   + ED+D+ S R   D E +  ED E
Sbjct: 566 IVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEE 608

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  295 bits (756), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 179/530 (33%), Positives = 284/530 (53%), Gaps = 32/530 (6%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAF 134
           D G+  + ++K+ +K RH                     L N GP G +I Y  MGS  +
Sbjct: 87  DAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLY 146

Query: 135 SVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQ 193
            + Q+ GE+A  +  ++  F  +    + PA G +  ++Y   W     LEL      I+
Sbjct: 147 CIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIK 206

Query: 194 FWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-A 252
           +WT  V    +++IF+VL   +N+F  + Y E EF+  + KV+ I GF I    + CG A
Sbjct: 207 YWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGA 266

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G  G +G +YW +PG++     S +K    F G VS+L+ AAF F  TE + +TA E AN
Sbjct: 267 GNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQAN 321

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-EATSYVSTSPFIVAIQNSGT 371
           PRK++P A KKV++RI+  ++GS+  +G LVP+N  +L     S    SP+++AI + G 
Sbjct: 322 PRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGV 381

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
           KV+PH  NAVIL +++S  NS  Y  SR+L  L++   AP FL    + G P +A+  +A
Sbjct: 382 KVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISA 441

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           VFG ++++  S   + VF WLL I+G++  F W  I +SHIRF +A+K +G S  EL FK
Sbjct: 442 VFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFK 501

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECI 547
           +++    +YY++  M      Q +TA AP    K +  +F   Y+++ + IA++  ++  
Sbjct: 502 SQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYK-- 559

Query: 548 FRCRFIWKIE--------DVDIDSDRR--DIEAIVWEDHEPKTFWDKFWN 587
                +WK +         +D+ S+RR  D + +  ED E   F +K  N
Sbjct: 560 -----VWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAE---FREKLRN 601

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  293 bits (751), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 194/598 (32%), Positives = 301/598 (50%), Gaps = 40/598 (6%)

Query: 10  IEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEE 69
           I+ + +  EP+T               GS +  DE        + F       +   ++ 
Sbjct: 22  IDSEFLTQEPITI-----------PSNGSATTNDEAGSG-SKWQDFKDSFRRVEPVEVDP 69

Query: 70  NLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           NL + ++     A+  +K  LK RH                     L   GP   LI + 
Sbjct: 70  NLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
             G++ +S+  +LGE+A   P++  FT ++ RF+  +FG AN + Y   W +   LE+  
Sbjct: 130 STGTMIYSMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVS 189

Query: 188 VGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
               + FW T       ++++FW++I I+N+F VK YGE EF  + IKVI ++GF+I   
Sbjct: 190 ASITVNFWGTDPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 247 CMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            + CG G  G     +YW +PGA+     + +    +F G  S  + +AF+F G+ELVG+
Sbjct: 250 ILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGL 304

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIV 364
            A E+ +PRK+VP+A K+V +RI  FYI SLL +GLLVPYNDP L  A+S   + SPF++
Sbjct: 305 AASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVI 364

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           AI+  G K LP + N VIL  ++S  NS IY  SR +  L++ +  P+  +   + G P 
Sbjct: 365 AIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPL 424

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           + +  T+ FG +A++  S     VF WLL ++G++  F W  I I HIRF +AL  +G  
Sbjct: 425 VGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRD 484

Query: 485 RDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFLFIAVW 541
            DEL FK+      +Y+  F +      Q + A  P     +   F  AY+S  L +A++
Sbjct: 485 LDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMY 544

Query: 542 ILFECIFRCRFIWKI----EDVDIDSDRR--DIEAIVWEDHEPKTF------WDKFWN 587
           +  +   R    WK+    ED+DID+ RR  D+E +  E  E K        W + WN
Sbjct: 545 LGHKIYKRN---WKLFIPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWN 599

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  293 bits (751), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 169/513 (32%), Positives = 270/513 (52%), Gaps = 16/513 (3%)

Query: 65  FSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALI 124
           F  ++++Q ED   + N  + +EL  RH                     L+  GP   +I
Sbjct: 70  FHSDDDVQQED---INNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVI 126

Query: 125 AYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
            ++ + +  F+V  SLGE++   PV   F V+S RF+ P+F  A    Y   W +   LE
Sbjct: 127 DWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLE 186

Query: 185 LSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L      I++W  K+   AW++IF+  I + N+  VK +GE EF ++ IK++AIIGF I 
Sbjct: 187 LVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTIL 246

Query: 245 CFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELV 303
              + CG G  G     +YW +PGA+       + +  +F G  S  + AAF++ G E+ 
Sbjct: 247 GIVLSCGGGPHGGYIGGKYWNDPGAF-----VGHDSGTKFKGLCSVFVTAAFSYSGIEMT 301

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV--STSP 361
            ++A E+ NPR+T+P+A K+  + I   Y+  L  IG LVP NDP+L   +S V  ++SP
Sbjct: 302 AVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSP 361

Query: 362 FIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGG 421
            ++AI+N   K LP + NA+IL  ++S ANS +Y  SR +  ++     PKFL R  K G
Sbjct: 362 LVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRG 421

Query: 422 VPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481
            P  A+  T  FG L+++  S    +VF WL  ++G++  F W+ I++SHIRF QA+K++
Sbjct: 422 RPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQ 481

Query: 482 GISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLF 537
             S DELPF ++     + Y    +        +T+  P      N  SF   Y+S  + 
Sbjct: 482 ERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPIL 541

Query: 538 IAVWILFECIFRC-RFIWKIEDVDIDSDRRDIE 569
           I  +   +   R  R + K+ED+D+D+ R+ ++
Sbjct: 542 IVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVD 574

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  295 bits (754), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 183/563 (32%), Positives = 287/563 (50%), Gaps = 25/563 (4%)

Query: 37  GSLSLKDEKSKELYPLRSFPTGV-NGQDTFSMEENLQDED---------EGEVQNAEVKR 86
            S S  DE + E Y ++ F   + N +    + ++  D           E + +NA++K+
Sbjct: 93  ASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQ 152

Query: 87  ELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT- 145
            +K RH                    PLA AGP   +I Y  MG+  + + Q+ GE+A  
Sbjct: 153 TIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVA 212

Query: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWI 205
           +  V  SF  F    + P F  A  ++Y   W     LEL      I++WT KV    ++
Sbjct: 213 YSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFV 272

Query: 206 SIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFRYWR 264
            IF+VLI ++N F  K Y E EF+    KV+ +IGF I   C+  GA G  G +G +YW 
Sbjct: 273 VIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWN 332

Query: 265 NPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKV 324
           +PGA+      + K E RF G + + + AAF F  TE + +TA E +NPRK +P A KKV
Sbjct: 333 DPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKV 387

Query: 325 VFRILTFYIGSLLFIGLLVPYN-DPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVIL 383
            +RIL  ++ S++ IG LVPYN D  +  ++   S SP+++A    G  V+ H  NAVIL
Sbjct: 388 AYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447

Query: 384 TTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETST 443
            +++S ANS  Y  SR+L GL++   APK+     + G P  ++   A+   +A+  TS 
Sbjct: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSP 507

Query: 444 GGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSS 503
               VF WLL I+G++  F W  I +SHIRF + ++ +G S  EL F+A+     +YY++
Sbjct: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567

Query: 504 FFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIED 558
             +      Q + A  P      +  +F   Y+++ + +A+++ F+   R  R   + ++
Sbjct: 568 IMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627

Query: 559 VDIDSDRR--DIEAIVWEDHEPK 579
           +D+ S R   D E +  ED E K
Sbjct: 628 IDLISHRIIFDEELLRQEDEEYK 650

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  295 bits (754), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 182/564 (32%), Positives = 283/564 (50%), Gaps = 20/564 (3%)

Query: 29  ASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDED-----EGEVQNAE 83
            +  ++R    S   E  +++ P        N Q    +   +QDE+     + E  NAE
Sbjct: 99  GNNQYQRSSPFSNGLEDDQKVGPDIYIDDLENKQQVELIGTTIQDEELLPGQKKEDSNAE 158

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEM 143
           +++ +K RH                    PLA AGP   +I Y  MG+  + + Q+ GEM
Sbjct: 159 LRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEM 218

Query: 144 A-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLA 202
           A  +  +T SF  F    + P F  A  ++Y   W     LEL      IQ+WT KV   
Sbjct: 219 AVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKVDPD 278

Query: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFR 261
            ++ IF+VLI ++N F  K Y E EF   + KV+ I GF I   C+  GA G  G +G +
Sbjct: 279 VFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAK 338

Query: 262 YWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
           YW +PGA+      + K E RF G + + + AAF F  TE + +TA E +NPRK +P A 
Sbjct: 339 YWNDPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAA 393

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYN-DPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNA 380
           KK+++R+L  ++ +++ IG LVPY+ D  L    S    SP+++AI   G +V  H  NA
Sbjct: 394 KKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHFVNA 453

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYME 440
           VIL ++IS  NS  Y  SR+L  L++   APK      + G P IA+  +AV   +A+  
Sbjct: 454 VILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCA 513

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
           TS    +VF WL+ I G++  F W  I +SH+RF +A+K +G S  E+ + ++     + 
Sbjct: 514 TSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSL 573

Query: 501 YSSFFMXXXXXXQGFTAFAPKF----NGSSFLAAYISIFLFIAVWILFECIFRC-RFIWK 555
           Y++  M      Q + A  P      + +SF + Y+++ + I  +  ++   R  R   +
Sbjct: 574 YAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIR 633

Query: 556 IEDVDIDSDRR--DIEAIVWEDHE 577
            +D+D+ S R   D E +  ED E
Sbjct: 634 AKDIDLISHRTIYDEELLRQEDEE 657

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/539 (32%), Positives = 277/539 (51%), Gaps = 20/539 (3%)

Query: 43  DEKSKELYPLRSFPTGV---NGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXX 99
           +EK   L PL S  + V     Q T      +  ED+  + N  + + L  RH       
Sbjct: 33  EEKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDD--INNVNLNKNLSIRHLLTLAVG 90

Query: 100 XXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQR 159
                         LA+ GP   +I ++ + +  F+V  +LGEMA   PV   F V+  R
Sbjct: 91  GSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNVYITR 150

Query: 160 FLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFP 219
           F+ P+ G A    Y   W +   LEL      I++W   +   AW++IF+ +I + N+  
Sbjct: 151 FIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIALANMLE 210

Query: 220 VKYYGEFEFWVASIKVIAIIGFLIYCFCMVC-GAGVTGPVGFRYWRNPGAWGPGIISKNK 278
           VK +GE EF ++ IK++AIIGF I    + C G    G +G +YW +PG++         
Sbjct: 211 VKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF------VGH 264

Query: 279 NEG-RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
           N G +F G  S  + AAF++ G E+  ++A E+ +PR T+P+A K+  + I   Y+  L 
Sbjct: 265 NSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILT 324

Query: 338 FIGLLVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIY 395
            IG LVPY+DP+L   TS V  ++SP ++AI+N G K LP + NA+IL +IIS ANS +Y
Sbjct: 325 LIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVANSAVY 384

Query: 396 VGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNI 455
             SR +  ++     P+ L+R    G P  A+  T  FG L+++  S     VF WL  +
Sbjct: 385 ACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSAL 444

Query: 456 TGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGF 515
           +G++  F W+ I++SHIRF Q++  +  S DELPF ++     ++Y +  +        +
Sbjct: 445 SGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFW 504

Query: 516 TAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRCR-FIWKIEDVDIDSDRRDIE 569
           T+  P      +  SF   Y+S  + +A +   +   R R F+  + D+D+D+ RR ++
Sbjct: 505 TSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVD 563

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/542 (31%), Positives = 279/542 (51%), Gaps = 20/542 (3%)

Query: 42  KDEKSKELYPL--RSFPTGVNGQDTFSMEENLQDEDEGE---VQNAEVKRELKQRHXXXX 96
           +  ++   +PL  +  P      +  +  E  +D D+ E   + N  + ++L  RH    
Sbjct: 39  QKSQTDSTFPLSTKGSPGMKQTTNDITSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTL 98

Query: 97  XXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVF 156
                            L+  GP   +I ++ +G+  F+V  SLGE++   PV   F V+
Sbjct: 99  AVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVY 158

Query: 157 SQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMN 216
             RF+ P+F  A    Y   W +   LEL      I++W  K+   AW++IF+  I + N
Sbjct: 159 GMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALAN 218

Query: 217 LFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIIS 275
           +  VK +GE EF ++ IK+++IIGF I    + CG G  G     +YWRNPGA+      
Sbjct: 219 MLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF------ 272

Query: 276 KNKNEG-RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIG 334
              N G +F G  S  + AAF++ G E+  ++A E+ NPR+T+P+A K+  + I   Y+ 
Sbjct: 273 VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVT 332

Query: 335 SLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANS 392
            L  IG LVP NDP+L   +S V  ++SP ++AI+N   K LP + NA+IL  ++S ANS
Sbjct: 333 ILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANS 392

Query: 393 NIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWL 452
            +Y  SR +  ++     PKFL+R  K G P  A+  T  FG L+++  S    +VF WL
Sbjct: 393 AVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWL 452

Query: 453 LNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXX 512
             ++G++  F W+ I++SHIRF +A+K +  S DELPF ++     ++Y    +      
Sbjct: 453 SALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIA 512

Query: 513 QGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRRD 567
             +T+  P      +  SF   Y+S  + I  +   +   R    + KIED+D+D+ R+ 
Sbjct: 513 SFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQ 572

Query: 568 IE 569
           ++
Sbjct: 573 VD 574

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  293 bits (750), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 177/581 (30%), Positives = 306/581 (52%), Gaps = 23/581 (3%)

Query: 29  ASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDED--EGEVQNAEVKR 86
           +   H+R  +    D + +++   +S  +     +   M+ +L+     +G+ +  ++K+
Sbjct: 48  SRNNHQRYDNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDLEKSPSADGDNEPRKLKQ 107

Query: 87  ELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATF 146
            L+ RH                     L   GP G  I+Y+ + ++ + +  +LGEM  F
Sbjct: 108 GLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCF 167

Query: 147 IPVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPL 201
           +P   S +  S      R++  + G A G+ Y++ + I  A E +    V+++WT  VP 
Sbjct: 168 LPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPK 227

Query: 202 AAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGF 260
             WI++F +++ ++N   VK YGE EFW ASIK++ I+G +I  F +  G G     +GF
Sbjct: 228 GVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGF 287

Query: 261 RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPR 319
           RYW++PGA+   +     + G F    + +I  AF F  G ELV +T+ E A+ R+ + +
Sbjct: 288 RYWQHPGAFAHHL--TGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAK 345

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPFIVAIQNSGTKVLP 375
           A ++ V+R++ FY+   L I ++VPYNDP L  A +       +SPF++ IQN+G KVLP
Sbjct: 346 ASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLP 405

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGA 435
           HI N  ILT+  SAAN+ ++  +R L  +++   APK L + ++ GVPY+AV A+ +   
Sbjct: 406 HIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSC 465

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           LAY+  S+    VF W  NI+ ++GF  W+   I+++RF +A+ Y G+  D LPFK    
Sbjct: 466 LAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKTWGQ 524

Query: 496 PGLAYYSSFFMXXXXXXQGFTAFAPKF-NGSSFLAAYISIFLFIAVWILFECIFRCRFIW 554
           P   ++S   +       G+  F PK+   + F+AAY+++ +F+ +W+  +   R    W
Sbjct: 525 PYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRTWHQW 584

Query: 555 --KIEDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWNVV 589
              + ++D+     +IE    E  E    P +  DKF + +
Sbjct: 585 WLPVSEIDVTRGLVEIEEKSREIEELRLPPTSIKDKFMDTL 625

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  293 bits (749), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 173/531 (32%), Positives = 282/531 (53%), Gaps = 32/531 (6%)

Query: 67  MEENLQDEDEGEV---QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 123
           +E+N   ++ G     ++  +K+ ++ RH                     L +AGP G L
Sbjct: 96  LEKNESSDNIGARTGNKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLL 155

Query: 124 IAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           I Y  MGS+ + + Q+ GEMA  +  +T  +  +    +   FG A  ++Y   W     
Sbjct: 156 IGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCP 215

Query: 183 LELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL      I++WT  V    ++ IF+VL+  +N+F  + Y E EF+    K++ + GF 
Sbjct: 216 LELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFF 275

Query: 243 IYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTE 301
           I    + V GAG  G +G +YW +PGA+     +   +  RF G V++L+ AAF F G+E
Sbjct: 276 ILGIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHSIDRFKGVVATLVTAAFAFGGSE 330

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTS 360
            + IT  E ANPRK VP A K++++RIL  ++ +++ +G LVPYN  +L  ++      S
Sbjct: 331 FIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKAS 390

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           P+++A+ + G +V+PH  NAVIL +++S ANS+ Y  +RIL  LS+   AP+  +   K 
Sbjct: 391 PYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKA 450

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           G P IA+  +A+FG +A+   S   D+VF WLL I+G++  F W  I +SHIRF +A+K 
Sbjct: 451 GRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKV 510

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFL 536
           +G S  EL F+++     + Y+   M      Q + A AP    K +  +F   Y+++ +
Sbjct: 511 QGRSLGELGFRSQTGVWGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPI 570

Query: 537 FIAVWILFECIFRCRFIWK--------IEDVDIDSDRR--DIEAIVWEDHE 577
            IA+++ ++       IWK         + +D+ S R+  D E I  ED E
Sbjct: 571 LIALYVGYK-------IWKKDWKLFIRADKIDLISHRQIFDEELIKQEDEE 614

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  293 bits (749), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 180/524 (34%), Positives = 280/524 (53%), Gaps = 29/524 (5%)

Query: 73  DEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSL 132
           DE EG+ +   +K+ +K RH                     L +AGP G  I Y  MGS 
Sbjct: 114 DELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSC 173

Query: 133 AFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQV 191
            + + Q+ GEMA T+  +   F  +    +SP  G A  ++YW  WA    LEL      
Sbjct: 174 IYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMT 233

Query: 192 IQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I++WT KV    ++ IF+ LI ++N+F  + Y E EF+    KV+ I GF I    + CG
Sbjct: 234 IKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCG 293

Query: 252 -AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310
            AG  G +G +YW +PGA+       +K   RF G  ++L+ AAF F G+E + +TA E 
Sbjct: 294 GAGNDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQ 348

Query: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA-TSYVSTSPFIVAIQNS 369
           +NPRK +P A KK+++RI+  ++GS++ +G LVP+N  +L  + +S    SP+++AI + 
Sbjct: 349 SNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSH 408

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429
           G +V+PH  NAVIL +++S  NS  Y  SRIL  LS+   APKF +   + G P  A+  
Sbjct: 409 GVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVI 468

Query: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489
            A+F  +A+   S+  + VF WLL I+G++  F W  I +SHIRF +A+  +G S  E+ 
Sbjct: 469 GALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIG 528

Query: 490 FKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFE 545
           FK++L    +YY++  M      Q +   AP    K +  SF  +Y+++ + IA ++ + 
Sbjct: 529 FKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGY- 587

Query: 546 CIFRCRFIWKIE--------DVDIDSDRR--DIEAIVWEDHEPK 579
                   WK +        D+D+D  R+  D + +  ED E K
Sbjct: 588 ------MFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETK 625

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  292 bits (748), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 184/596 (30%), Positives = 303/596 (50%), Gaps = 28/596 (4%)

Query: 5   KQEAEIE--EKHMYNEPVTTLLHDVEASQTH--RR------RGSLSLKDE-KSKELYPLR 53
           +Q+ EIE  E    + P +    D E   T   RR      R     +DE ++ ++  L 
Sbjct: 24  EQDNEIEYFETDSNDRPSSQPHLDYEQHNTSAVRRFFDSFKRADQGGQDESEAVQMNDLT 83

Query: 54  SF--PTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
           S   P+  N Q     +   +       ++  +K+ ++ RH                   
Sbjct: 84  SAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNG 143

Query: 112 XPLANAGPVGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANG 170
             L +AGP G LI Y  MGS+ + + Q+ GE+A  +  +T  +  +    +   FG A  
Sbjct: 144 TALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVA 203

Query: 171 YMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWV 230
           ++Y   W     LEL      I++WT  V    ++ IF+VL+  +N+F  + Y E EF+ 
Sbjct: 204 WVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFF 263

Query: 231 ASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSS 289
              K++ + GF I    + V GAG  G +G +YW +PGA+     +   +  RF G V++
Sbjct: 264 NCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHSIDRFKGVVAT 318

Query: 290 LINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DP 348
           L+ AAF F G+E + IT  E +NPRK +P A K++++RIL  ++ +++ +G LVPYN D 
Sbjct: 319 LVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQ 378

Query: 349 KLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNK 408
            L         SP+++AI + G +V+PH  NAVIL +++S ANS+ Y  +R+   LS+  
Sbjct: 379 LLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQG 438

Query: 409 LAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFIS 468
            APKF S   + G P IA+  +A+F  +A+   S   ++VF WLL I+G++  F W  I 
Sbjct: 439 YAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAIC 498

Query: 469 ISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNG 524
            SHIRF +A+K +G S  EL FK++     + Y+   M      Q + A AP    K + 
Sbjct: 499 FSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDA 558

Query: 525 SSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHE 577
            +F   Y+++ + IA+++ ++   +  +   + + +D++S R+  D E I  ED E
Sbjct: 559 QAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHRQIFDEELIKQEDEE 614

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  291 bits (746), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 170/517 (32%), Positives = 274/517 (52%), Gaps = 19/517 (3%)

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGS 131
           Q +DE    N ++K+ ++ RH                     LA+AGP G +I Y  M S
Sbjct: 90  QVDDE---LNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMAS 146

Query: 132 LAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190
             + + Q++GEMA  ++ +   F  +    + PA   +  ++Y   W     LEL     
Sbjct: 147 CIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASM 206

Query: 191 VIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMV 249
            IQ+WT KV    ++ IF++L+  +N+F   + Y E EF   S K++ +IGF I    ++
Sbjct: 207 TIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVII 266

Query: 250 CG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308
           CG AG  G +G +YWR+PGA+       +    RF G VS+L+ AAF+F  TE + ITA 
Sbjct: 267 CGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITAS 321

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS-TSPFIVAIQ 367
           E +NPRK +P A KKV++R L  Y+ S++ +GLLVPY+  +L  ++S  +  SP+++A+ 
Sbjct: 322 EQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVS 381

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
             G +V+PH  NAVIL ++ S A+S  Y  SR+L  L++   APK  +   + G P +  
Sbjct: 382 THGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGF 441

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
              AV   +A+   S+   +VF WLL I+G++  F W  I +SHIRF +A+K +G S DE
Sbjct: 442 LVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDE 501

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547
           + +K+++    + Y+   M      Q +    P   GS+ + A+   +L + V+I+    
Sbjct: 502 IGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLG 561

Query: 548 FRC-----RFIWKIEDVDIDSDR--RDIEAIVWEDHE 577
           ++      R   + +D+D+ S R   D E +  E  E
Sbjct: 562 YKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREE 598

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  289 bits (739), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 176/505 (34%), Positives = 269/505 (53%), Gaps = 16/505 (3%)

Query: 73  DEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSL 132
            E  GE  +  ++R  KQRH                     L   GP   LIA++F GSL
Sbjct: 36  QEAIGE-SSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSL 94

Query: 133 AFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVI 192
              V  SL EMA+F P+  SF+ ++ R++ PA G A G+ Y+  +AI  A ELS +G ++
Sbjct: 95  LIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLV 154

Query: 193 QFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA 252
           Q+W   + +A +I +F V++  +N   +K+YGE EFW A +K + +I   +    + CG 
Sbjct: 155 QYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGG 214

Query: 253 GVTG-PVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
           G +   +GFRYWR   A+ P ++      GRFLGW + +I + + + G+E +G+  GEA 
Sbjct: 215 GPSKETIGFRYWREY-AFVPYLV--KGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAP 271

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA-TSYVSTSPFIVAIQNSG 370
           NP+KT+P A + V+FRI  FYI  +L +GL++  +D  L  A TS  S SPF++A  N+G
Sbjct: 272 NPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAG 331

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFAT 430
            K LP   NA+++  I SAAN+ +YV SR  +GL+K+ +APK     ++ GVP+      
Sbjct: 332 IKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLA 391

Query: 431 AVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
            +   L++M  S     +F +L +   V G   WL + IS+I + +A  +  + RD +PF
Sbjct: 392 GLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPF 451

Query: 491 KAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRC 550
           +    P  AY   FF+       G++AF   F   SF+ +YI I +FI   + ++     
Sbjct: 452 RMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFWK----- 506

Query: 551 RFIWKIEDVDIDSDRRDI---EAIV 572
              WK        D R I   EAIV
Sbjct: 507 --FWKKSAATRPEDLRSIMVEEAIV 529

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  291 bits (745), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 173/565 (30%), Positives = 293/565 (51%), Gaps = 36/565 (6%)

Query: 26  DVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGE---VQNA 82
           +VEA+Q +    ++S    +++EL                  E+N   ++ G     ++ 
Sbjct: 73  EVEATQMNDLTSAISPSSRQAQEL------------------EKNESSDNIGANTGHKSD 114

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGE 142
            +K+ ++ RH                     L +AGP G LI Y  MGS+ + + Q+ GE
Sbjct: 115 SLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGE 174

Query: 143 MA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPL 201
           MA  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT  V  
Sbjct: 175 MALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNP 234

Query: 202 AAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGPVGF 260
             ++ IF+VL+  +N+F  + Y E EF+    K++ + GF I    + V GAG  G +G 
Sbjct: 235 DVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGG 294

Query: 261 RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRA 320
           +YW +PGA+     +      RF G  ++L+ AAF F G+E + IT  E +NPRK +P A
Sbjct: 295 KYWHDPGAF-----NGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGA 349

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQNSGTKVLPHIFN 379
            K++++RIL  ++ +++ +G LVPYN  +L  +T      SP+++A+ + G +V+PH  N
Sbjct: 350 AKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFIN 409

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYM 439
           AVIL +++S ANS+ Y  +R+   LS+   APK  S   + G P IA+  +A+F  +A+ 
Sbjct: 410 AVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFC 469

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S   ++VF WLL I+G++  F W  I +SH+RF +A+K +G S  EL FK++     +
Sbjct: 470 AASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGS 529

Query: 500 YYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIW 554
            Y+   M      Q + A AP    K +  +F   Y+++ + IA+++ ++   +  +   
Sbjct: 530 AYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFI 589

Query: 555 KIEDVDIDSDRR--DIEAIVWEDHE 577
           + + +D+DS R+  D E I  ED E
Sbjct: 590 RADKIDLDSHRQIFDEELIKQEDEE 614

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  290 bits (742), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 176/531 (33%), Positives = 277/531 (52%), Gaps = 18/531 (3%)

Query: 62  QDTFSMEENLQDEDEGEVQ-NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
            DTF   ++L+      V+ N++ K+ +K RH                     L   GP 
Sbjct: 59  SDTFDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPA 118

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAI 179
           G LI Y  +  +A+ + Q+ GEMA   P +  +F V+S  F+S +FG A  ++Y   W  
Sbjct: 119 GLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLT 178

Query: 180 TFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAII 239
              LEL      I++W   +   A+I+IF+ +I  ++ F    YGE EF  ++ KV  I 
Sbjct: 179 VLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIA 238

Query: 240 GFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           GF+I    + CG   TG      YWRNPGA+  G        G F G    L+ A F++ 
Sbjct: 239 GFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYG 293

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSY 356
           G EL  +T  E ANPRK VP A KK ++RIL  Y+ +++ IG LVPYN  +L  +   S 
Sbjct: 294 GMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSA 353

Query: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416
              SP+++A+ + G KV+PHI NAVIL +++S  NS +Y   R+L  L++   APK  S 
Sbjct: 354 THASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSY 413

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
             + G P +A+   ++FG L+++  S   ++VF WL  I G++  F W  I +SH+RF  
Sbjct: 414 VDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRD 473

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNG-----SSFLAAY 531
           A+KY+G S  EL +K+K     + Y+ FF       Q + A AP  NG      +F  +Y
Sbjct: 474 AMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSY 533

Query: 532 ISIFLFIAVWILFECIFR-CRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           ++  ++I+ ++ ++   +  + +  ++++D++S R   D   +  ED E K
Sbjct: 534 LAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHK 584

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  290 bits (742), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 166/501 (33%), Positives = 265/501 (52%), Gaps = 13/501 (2%)

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVT 137
           ++ N  + ++L  RH                     L   GP   +I ++ + +  F+V 
Sbjct: 82  DINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVI 141

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTH 197
            SLGE+A   PV   F V+  RF+ P+F  A    Y   W +   LEL      I++W  
Sbjct: 142 NSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWND 201

Query: 198 KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP 257
           K+   AW++IF+  I + N+  VK +GE EF ++ +K++AIIGF I    + CG G  G 
Sbjct: 202 KINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGG 261

Query: 258 VGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
               +YW NPGA+       +    +F G  S  + AAF++ G E+  ++A E+ NP++T
Sbjct: 262 YIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKET 316

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVL 374
           +P+A K+  + I   Y+G L  IG LVPYNDP+L   +S V  + SP ++AI+N G K L
Sbjct: 317 IPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGL 376

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFG 434
           P + NA+IL  I+S ANS +Y  SR +  ++     PKFLS+  K G P  A+  T  FG
Sbjct: 377 PSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFG 436

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            L+++  S   ++VF WL  ++G++  F W+ I++S IRF  A+K +G S DE+PF ++ 
Sbjct: 437 LLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQS 496

Query: 495 MPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC 550
               A+Y    +        +T+  P      +  SF   Y+S+ + IA ++  +   R 
Sbjct: 497 GTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRD 556

Query: 551 -RFIWKIEDVDIDSDRRDIEA 570
            R +  + ++D+DS RR ++A
Sbjct: 557 WRLLVPLMEMDLDSGRRVLDA 577

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  290 bits (742), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 189/567 (33%), Positives = 298/567 (52%), Gaps = 28/567 (4%)

Query: 13  KHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQ 72
             + +EP +TL  +   +  +  RGS+  K  +         F       +   ++ NL 
Sbjct: 26  DDIVHEPCSTLSSN---NNDNESRGSIRCKWTR---------FVDSFKRIELEELDPNLT 73

Query: 73  DEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMG 130
           D ++  +  A   +K  LK RH                     L  AGP G LI +   G
Sbjct: 74  DAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTG 133

Query: 131 SLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190
           ++ +S+  ++GE+A   PV+  FT ++ RF+  +FG A  + Y   W IT  LE+     
Sbjct: 134 TMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASI 193

Query: 191 VIQFWTHKVPLA-AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMV 249
            + +W         ++++FWV   I+NLF VK YGE EF  A IKV+ IIGF+I    ++
Sbjct: 194 TVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILI 253

Query: 250 CGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308
           CG G  G     +YW +PGA+       +    +F G+ +  I A+F+F G+E+VG+   
Sbjct: 254 CGGGPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGS 308

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQ 367
           E+ NPRK+VP A K+V +RI  FY+  LL IG+LVPYND +L  A+S   + SPF++A+ 
Sbjct: 309 ESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVV 368

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
           N G + LP + N VIL +++S  NS+IY+ SR L  L++    PK ++   + G P +A+
Sbjct: 369 NQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAI 428

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
              + FG +A++  S+   +VF WLL ++G++  F+W  I I HIRF +AL  +G S DE
Sbjct: 429 GIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDE 488

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKF---NGSSFLAAYISIFLFIAVWILF 544
           LPF + +    +Y+  F        Q +    P     N   F  AY+S  + +A +I F
Sbjct: 489 LPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYI-F 547

Query: 545 ECIFRC--RFIWKIEDVDIDSDRRDIE 569
             I++   +   K ED+DID+ RR+++
Sbjct: 548 HKIWKKNWKLYIKAEDMDIDTGRREVD 574

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  291 bits (744), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 184/597 (30%), Positives = 300/597 (50%), Gaps = 30/597 (5%)

Query: 5   KQEAEIE--EKHMYNEPVTTLLHDVEASQTHRRRGSLS------LKDEKSKELYPLRSFP 56
           +QE EIE  E    + P      D E   T   R  L          E+  E+  +    
Sbjct: 24  EQENEIEYFETDSNDRPSQQPHLDYEQHNTSAVRRFLDSFKRADQDQEQEAEVAQMNDLT 83

Query: 57  TGVNGQDTFSMEENLQDEDEGEV------QNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           + ++   +    E  +DE   ++      ++  +K+ ++ RH                  
Sbjct: 84  SAIS-PSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGN 142

Query: 111 XXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAAN 169
              L +AGP G LI Y  MGS+ + + Q+ GEMA  +  +T  +  +    +   FG A 
Sbjct: 143 GTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAV 202

Query: 170 GYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFW 229
            ++Y   W     LEL      I++WT  V    ++ IF+VL+  +N+F  + Y E EF+
Sbjct: 203 AWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFF 262

Query: 230 VASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVS 288
               K++ + GF I    + V GAG  G +G +YW  PGA+  G+ + +    RF G V+
Sbjct: 263 FNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFN-GVHAID----RFKGVVA 317

Query: 289 SLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-D 347
           +L+ AAF F G+E + IT  E +NPRK +P A K++++RIL  ++ +++ +G LVPYN D
Sbjct: 318 TLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSD 377

Query: 348 PKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
             L  +      SP+++AI + G +V PH  NAVIL +++S ANS+ Y  +R+   LS+ 
Sbjct: 378 QLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQ 437

Query: 408 KLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
             APK  S   + G P IA+  +A+F  +A+   S   D+VF WLL I+G++  F W  I
Sbjct: 438 GYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAI 497

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFN 523
            +SHIRF +A+K +G S  EL FK++     + YS   M      Q + A AP    K +
Sbjct: 498 CLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLD 557

Query: 524 GSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHE 577
             +F   Y+++ + I +++ ++   +  +   + + +D+ S R+  D E I  ED E
Sbjct: 558 AQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFDEELIKQEDDE 614

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  288 bits (736), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 191/580 (32%), Positives = 283/580 (48%), Gaps = 38/580 (6%)

Query: 5   KQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDT 64
           KQ +EI E   + EP      D   S + R     S  D+   E +     P  +  +  
Sbjct: 14  KQNSEIYEFTTF-EPKAL---DSYKSSSFRTFTKQSKDDDDIAEGHSSYQPPRNIFQRCI 69

Query: 65  FSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALI 124
            S +  L    +G      +KR LK RH                     LA+ GP+  +I
Sbjct: 70  DSFKPPL----DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALII 125

Query: 125 AYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
            +   G+        LGE+    PV  +F  +S RFL P+       +Y   W     LE
Sbjct: 126 GWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLE 185

Query: 185 LSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           +      IQ+W   +    W++IF+ +I  +NLF  + +GE EF  +SIKVI IIGF+I 
Sbjct: 186 IIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIIL 245

Query: 245 CFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELV 303
           C  ++CG G     VG RYW +PG    G          F G +S L+ A+++  GTE+V
Sbjct: 246 CIVLICGGGPDHDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMV 295

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFI 363
            + +GE  NPR+ +P AIK+  +RIL F++ SL  IG LVPY +P L   +S V+ SPF+
Sbjct: 296 CLASGET-NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPFV 352

Query: 364 VAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVP 423
           +AI+    K LP I NAVIL +I+S  NS I+  SR L  ++   L PKF     + G P
Sbjct: 353 IAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRP 412

Query: 424 YIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGI 483
              +   ++FG LA++  S+   +VF+WL+ I G+A    WL I+ISHIRF  A+K +G 
Sbjct: 413 LTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGK 472

Query: 484 SRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----------KFNGSSFLAAYI 532
           S DEL F + +    + YS+         Q + A  P           K    S+L A I
Sbjct: 473 SLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALI 532

Query: 533 SIFLFIAVWILFECIFRCRFIWKIED---VDIDSDRRDIE 569
             FLF+   + +   ++    W I D   +D+++DR++I+
Sbjct: 533 MAFLFVCHKVFYR--YKTGKWWAIMDLDKIDLETDRKNID 570

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  288 bits (736), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 173/520 (33%), Positives = 270/520 (51%), Gaps = 16/520 (3%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
            +L+D  E    ++++K+ +K RH                     L   GP   +I Y+ 
Sbjct: 76  SDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVL 135

Query: 129 MGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
           +  + + + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL  
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELIT 195

Query: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               IQ+W  K+    +I IF++ +  +++F VK YGE EF     K++ I GF+I    
Sbjct: 196 ASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVV 255

Query: 248 MVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGIT 306
           + CG AG  G +G  YW NPGA+     + + +  RF      L+   F+F G EL  ++
Sbjct: 256 INCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALS 310

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIVA 365
             E +NPRK+ P A K+ ++RI+  Y+ +++ IG  VPYND +L  A  S    SP+++A
Sbjct: 311 VQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
               G K++PHI NAVIL +++S ANS++Y G R++  LS+   APKFL    + G P  
Sbjct: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLR 430

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
           A+    +FG +A++  S+  + VF WL  I G++  F W  I +SH+RF QA+K +G S 
Sbjct: 431 ALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490

Query: 486 DELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFN-GSSFLAAYISIFLFIAVWILF 544
           DEL +KA      + Y  FF       Q + A AP  N G   + ++   +L   +W+ F
Sbjct: 491 DELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTF 550

Query: 545 ---ECIFRCRF--IWKIEDVDIDSDRR--DIEAIVWEDHE 577
                I+   F  +  ++ +D+D  RR  D E I  ED E
Sbjct: 551 FFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQE 590

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  287 bits (734), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 168/530 (31%), Positives = 277/530 (52%), Gaps = 21/530 (3%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAF 134
               V N  + + L  RH                     LA+ GP   +I ++ + +  F
Sbjct: 61  SNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLF 120

Query: 135 SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194
           +V  +LGEMA   PV   F V+  RF+ P+ G A    Y   W +   LEL      I++
Sbjct: 121 TVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKY 180

Query: 195 WTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVC-GAG 253
           W   +   AW++IF+ +I   N+  VK +GE EF ++ +K++AIIGF I    + C G  
Sbjct: 181 WNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGP 240

Query: 254 VTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
             G +G +YW NPG++       + +  +F G  S  + AAF++ G E+  ++A E+ +P
Sbjct: 241 QGGYLGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDP 295

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQNSGT 371
           R+T+P+A K+  + I   YI  L  IG LVPY++P+L   +S V  ++SP ++AI+N G 
Sbjct: 296 RRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGI 355

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
           K LP + NA+IL +IIS ANS +Y  SR +  ++     P+ L    K G P  A+  T 
Sbjct: 356 KGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTL 415

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
            FG L+++  S    +VF WL  ++G++  F W+ I+ISHIRF QA+K +  S DELP+ 
Sbjct: 416 FFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYL 475

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECI 547
           ++     ++Y    +        +T+  P      +  SF   Y+S  + IA ++  + +
Sbjct: 476 SQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLV 535

Query: 548 FRCR-FIWKIEDVDIDSDRRDIEAIVW-------EDHEPK-TFWDKFWNV 588
           +R +  +  +ED+DID+ RR ++  +        ++H  K +F+ +F +V
Sbjct: 536 YRKKQIVVALEDMDIDTGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHV 585

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  287 bits (734), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 173/561 (30%), Positives = 291/561 (51%), Gaps = 30/561 (5%)

Query: 41  LKDEKSKELYPLR----SFPTGVNGQDTFSMEEN----LQDEDEGEVQNAEVKRELKQRH 92
           + +  SK +  L+    SF    +  + + +E+N    ++ +   +  N ++++ ++ RH
Sbjct: 29  INESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRH 88

Query: 93  XXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTS 151
                                L NAGP G LI Y+ M S  + + Q+ GEMA  ++ +  
Sbjct: 89  VIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIG 148

Query: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVL 211
            F  +    +  A+  A  ++Y   W     LEL      I++W  KV    +++IF++L
Sbjct: 149 GFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLL 208

Query: 212 ITIMNLFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAW 269
           I  +NLF   + Y E EF+    K++ I GF I    ++CG AG +G +G  YW NPGA+
Sbjct: 209 IIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAF 268

Query: 270 ---GPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVF 326
               PG         RF G VS+L+ AAF+F  TE + ITA E +NPRK +P A KKV++
Sbjct: 269 RGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIY 320

Query: 327 RILTFYIGSLLFIGLLVPYNDPKLT-EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTT 385
           R L  Y+GS++ +G LVPYN P+L    +S    SP+++A+ + G ++ PH  NAVIL +
Sbjct: 321 RALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILIS 380

Query: 386 IISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGG 445
           ++S ANS+ Y  SR+L  L+K   APK  +   + G P   + A ++   +A+  +S   
Sbjct: 381 VLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKE 440

Query: 446 DKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFF 505
            +VF WLL I+G++  F W  I +SHIRF +A+K +G S +EL +K+++    + Y++  
Sbjct: 441 TEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATV 500

Query: 506 MXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRC-----RFIWKIEDVD 560
           M      Q + A  P  +  + +  +   +L + + +LF   ++          + +D+D
Sbjct: 501 MFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDID 560

Query: 561 IDSDRR--DIEAIVWEDHEPK 579
           + S R   D + +  E ++ K
Sbjct: 561 LISHRHIYDEDVLKQEKNQYK 581

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  287 bits (734), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 186/573 (32%), Positives = 298/573 (52%), Gaps = 32/573 (5%)

Query: 28  EASQTHRRRGSLSLKDEK---------SKELYPLRSFPTGVNGQ-DTFSMEEN------L 71
           EA  T    G  SL DEK         S E+Y   +  TG  G+ D+ S+  +      +
Sbjct: 27  EAPVTTGSTGGDSLGDEKNGFMGAGTTSYEMYNYSNSSTGAGGKGDSHSLTRDEAGSGVM 86

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGS 131
           +++ +G  Q   + ++L  RH                     L++ GP   +I ++ + +
Sbjct: 87  KEDVDGHPQ---MNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIIST 143

Query: 132 LAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQV 191
             F+V  SLGE+A   PV   F V+  RF+ P+FG A    Y   W +   LEL      
Sbjct: 144 CLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASIT 203

Query: 192 IQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I++W  K+   AW++IF+  I   N+  VK +GE EF ++ IK++AI+GF I    + CG
Sbjct: 204 IRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCG 263

Query: 252 AGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310
            G  G     +YW +PGA+  G  S  K    F G  S  + AAF++ G EL  ++A E+
Sbjct: 264 GGPKGGYIGGKYWHDPGAF-VGETSGTK----FKGLCSVFVTAAFSYSGMELTAVSAAES 318

Query: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQN 368
            NPR+T+P+A K+  + I   Y+  L  IG LVPYN+PKL   +S V  ++SP ++AI+N
Sbjct: 319 LNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIEN 378

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVF 428
            G + LP + NA+IL  I+S ANS +Y  SR +  +++ +  P+FL R  + G P  A  
Sbjct: 379 GGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATL 438

Query: 429 ATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDEL 488
            T  FG L+++  S   ++VF WL  ++G++  FAW+ I++SHIRF QA+ ++GIS DEL
Sbjct: 439 LTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDEL 498

Query: 489 PFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILF 544
           P+ +      ++Y    +        +T+  P      + +SF   Y+S  + I  ++  
Sbjct: 499 PYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGH 558

Query: 545 ECIFR-CRFIWKIEDVDIDSDRRDIEAIVWEDH 576
           +   R  R +  + D+D+ SDR+ ++  V  + 
Sbjct: 559 KLYIRKKRLLIDVADMDLVSDRKVVDVEVCREE 591

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  286 bits (732), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 176/555 (31%), Positives = 289/555 (52%), Gaps = 40/555 (7%)

Query: 63  DTFSMEENLQDEDEGEV-------QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLA 115
           D   M +  +D D+ E        ++  + R+L  RH                     L 
Sbjct: 43  DVQVMGKKYEDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALN 102

Query: 116 NAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWF 175
             GP   +IA+  + +  F++  +LGE+A   PV   F V+  R + P+ G A    Y  
Sbjct: 103 IGGPASLVIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLA 162

Query: 176 SWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKV 235
            WA+   LEL      I++W + V   AW+++F+V I + +L  VK +GE EF ++ +K+
Sbjct: 163 QWAVLLPLELVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKI 222

Query: 236 IAIIGFLIYCFCMVCGAG-VTGPVGFRYWRNPGAW---GPGIISKNKNEGRFLGWVSSLI 291
           +AI GF I    ++CG G   G +G +YW +PG++    PG         +F G  S  +
Sbjct: 223 LAIGGFTILGIVLICGGGPKNGYIGAKYWNDPGSFVGASPG--------SQFKGLCSVFV 274

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            AAF++ GTELVG++A E+ANPR T+P+A K+  + I   Y+  L  IG LV ++DPKL 
Sbjct: 275 TAAFSYSGTELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLL 334

Query: 352 EATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL 409
            A+S V  + SP ++AI+N G + LP + NA+IL  IIS ANS++Y  SR +  +++   
Sbjct: 335 SASSSVDVAASPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGN 394

Query: 410 APKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISI 469
            P+  +     G P +A+  T VFG L+++  S   +++F WL  ++G++  F WL I+I
Sbjct: 395 LPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINI 454

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGL--AYYSSFFMXXXXXXQGFTAFAPKFNG--- 524
           SHIRF +AL  +G S DELP+ +  M G+  ++Y    +        +T+  P  +    
Sbjct: 455 SHIRFRRALNTQGYSLDELPYLS--MTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGAD 512

Query: 525 -SSFLAAYISIFLFIAVWILFECIFRCRFIWKIED--VDIDSDRRDIEAIVW-------- 573
             SF   Y+S+ +F+  ++  + +++  + W I    +D+++ RR I+            
Sbjct: 513 WESFFKGYLSLPIFLFCFVGHK-LYKRNWSWMIRSNKIDVNTGRRMIDKEELEKEKQEFN 571

Query: 574 EDHEPKTFWDKFWNV 588
           E    K+F  K WN+
Sbjct: 572 EYMARKSFIAKLWNL 586

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  288 bits (736), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 173/544 (31%), Positives = 282/544 (51%), Gaps = 30/544 (5%)

Query: 65  FSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALI 124
            S  ++ Q     E ++  +++ +K RH                     L  AGP G +I
Sbjct: 112 LSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVI 171

Query: 125 AYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFAL 183
            Y  MGS  + + Q+ GEMA  +  +  +F  +    +  AFG +  ++Y   W     L
Sbjct: 172 GYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPL 231

Query: 184 ELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLI 243
           EL      IQ+WT  V    ++ IF+VLI  +N+F  K Y E EF+  S KV+ + GF I
Sbjct: 232 ELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFI 291

Query: 244 YCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTEL 302
               +   GAG  G +G +YW NPGA+       +K+  RF   +S+   AAF F  +E 
Sbjct: 292 LAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEF 346

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS-TSP 361
           + I A E +NPR+ +P A K +++RIL  ++ S+  +G LVPYN  +L  + S  +  SP
Sbjct: 347 IAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASP 406

Query: 362 FIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGG 421
           +++A+ + G +V+PH  NAVIL +++S ANS  Y   RIL+ LS+   AP + +   + G
Sbjct: 407 YVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREG 466

Query: 422 VPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481
            P  A+  +A+F  +A+   S+  + VF WLL I+G++  F W+ I +SHIRF +A+K +
Sbjct: 467 RPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQ 526

Query: 482 GISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLF 537
           G S DE+ FK+++    + Y++  M      + + + AP      +  +F   Y+++ + 
Sbjct: 527 GRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPIL 586

Query: 538 IAVWILFECIFRCRFIWKI----EDVDIDSDRR--DIEAIVWEDHEPKT------FWDK- 584
           I ++  ++    C+  WK+    +D+D+ S R+  D E I  E+ E K       FW K 
Sbjct: 587 IVLYFGYKI---CKRDWKLFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLRNGPFWKKV 643

Query: 585 --FW 586
             FW
Sbjct: 644 VAFW 647

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  286 bits (732), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 186/541 (34%), Positives = 284/541 (52%), Gaps = 28/541 (5%)

Query: 67  MEENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALI 124
           ++ NL + ++  +  A+  +K  LK RH                     L   GP   LI
Sbjct: 67  VDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLI 126

Query: 125 AYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
            +   G++ +++  +LGE+A   P++  FT ++ RF+  +FG AN + Y   W +   LE
Sbjct: 127 GWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLE 186

Query: 185 LSVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLI 243
           +      + FW T       ++++FW+ I I+N+F VK YGE EF  + IKVI ++GF+I
Sbjct: 187 IVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFII 246

Query: 244 YCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTEL 302
               + CG G TG     +YW +PGA+     + +    +F G  S  + AAF+F G+EL
Sbjct: 247 LGIILNCGGGPTGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSEL 301

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSP 361
           VG+ A E+  PRK+VP+A K+V +RI  FYI SLL IGLLVPYND  L  A+S   + SP
Sbjct: 302 VGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASP 361

Query: 362 FIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGG 421
           F++AI+  G K LP + N VIL  ++S  NS IY  SR +  L++ +  P+  S   + G
Sbjct: 362 FVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKG 421

Query: 422 VPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481
            P + +  T+ FG +A++  S    +VF WLL ++G++  F W  I I HIRF +AL  +
Sbjct: 422 RPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQ 481

Query: 482 GISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSS---FLAAYISIFLFI 538
           G   DEL FK+      +Y+  F +      Q + A  P  +  S   F  AY+S  L +
Sbjct: 482 GRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVM 541

Query: 539 AVWILFECIFRCRFIWKI----EDVDIDSDRR--DIEAIVWEDHEPKTF------WDKFW 586
            ++I  +   R    WK+    E +DID+ RR  D++ +  E  E K        W + W
Sbjct: 542 VMYIGHKIYKRN---WKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIW 598

Query: 587 N 587
           N
Sbjct: 599 N 599

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  284 bits (727), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 172/528 (32%), Positives = 276/528 (52%), Gaps = 25/528 (4%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQ 138
           + N  + + L  RH                     L++ GP   ++ ++ + +  F+V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK 198
           SLGE+A   P+   F V+  RF+ P+ G A    Y   W +   LEL      I++W  K
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 199 VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+V I + N+  VK +GE EF ++ +K++AIIGF I    +  G G +G  
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 259 G-FRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
             F+YW NPGA+  G      N  +F G  S  + AAF+F G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVLP 375
           P+A K+  + + + Y+  L  +G LVPYND +L  A + V  + SP ++AI+N G K LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGA 435
            + NA+IL  I+S ANS +Y  SR +  ++     PK LS+  K G P  A+  T +FG 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           L+++  S   ++VF WL  ++G++  F W+ I+ S IRF +A++ +  S DELP+ ++  
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 496 PGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFI-- 553
              A+Y    +        +T+  P   GS+   A      F+++ IL  C F  +    
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPL--GSAHADAESFFESFLSLPILLVCYFGHKLYFA 510

Query: 554 --WKI----EDVDIDSDRR--DIEAIVWEDHEPK-----TFWDKFWNV 588
             W++    E++DIDS R+  D E +  E  E +     +F  KFW+V
Sbjct: 511 RNWRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSFLIKFWHV 558

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  286 bits (731), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 169/524 (32%), Positives = 274/524 (52%), Gaps = 22/524 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSL 140
           N ++K+ ++ RH                     L++AGP G +I Y  M +  + V Q++
Sbjct: 96  NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAV 155

Query: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKV 199
           GEMA  ++ +   F+ +    + P    A  ++Y   W     LEL      IQ+WT KV
Sbjct: 156 GEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTKV 215

Query: 200 PLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGP 257
               ++ IF++L+  +N+F   + Y E EF+    K++ + GF I    ++CG AG +G 
Sbjct: 216 NADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGF 275

Query: 258 VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +G RYW +PGA+       +    RF G VS+L+ AAF F GTE + ITA E ANPRK +
Sbjct: 276 IGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRKAI 330

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATS-YVSTSPFIVAIQNSGTKVLPH 376
           P A KKV++R L  Y+GS++ +G LVPYN  +L  ++      SP+++A+ + G +V+PH
Sbjct: 331 PSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGIRVVPH 390

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
             NAVIL ++ S A+S  Y  SR+L  L++   APK  +   K G P +     A+   +
Sbjct: 391 FINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIAII 450

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           ++   S+    VF WLL+I+G++  F W  IS+SHIRF +A+K +G S DE+ FK++   
Sbjct: 451 SFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQAGV 510

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-R 551
             + Y+   M      Q +    P      +  SF  AY+++ +FI ++  ++   R  R
Sbjct: 511 WGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIWNRDWR 570

Query: 552 FIWKIEDVDIDSDRR--DIEAIVWEDHEPKT------FWDKFWN 587
              + +++D+ + R   D E +  E  E +        W K +N
Sbjct: 571 LFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYN 614

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  286 bits (731), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 194/621 (31%), Positives = 309/621 (49%), Gaps = 50/621 (8%)

Query: 2   TNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYP--LRSFPTGV 59
           T+ KQE      ++     TT  H   +S+     GSL  +  +    Y   L  F    
Sbjct: 16  TSTKQEMSNSRSYL-----TTTAHQSLSSEA-LSMGSLDARSPQKDVWYTRLLNDFKRAD 69

Query: 60  NGQDTFSMEENLQDED---------------EGEVQNAEVKRELKQRHXXXXXXXXXXXX 104
            G+ T S+ ++  + D               +    ++++ + L  RH            
Sbjct: 70  EGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGT 129

Query: 105 XXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPA 164
                    L   GP   LIA+  + +  F++  SLGE+A+  PV   F V+  RF+ P+
Sbjct: 130 GLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPS 189

Query: 165 FGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYG 224
           FG A    Y   WA+   LEL+     I++W +K+   AW++IF+V I + N+  VK +G
Sbjct: 190 FGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFG 249

Query: 225 EFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAW---GPGIISKNKNE 280
           E EF ++ +K++AI GF I    ++CG G  G     +YW +PGA+    PG        
Sbjct: 250 ETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGDTPG-------- 301

Query: 281 GRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIG 340
            +F G  S  + AAF++ GTELVG++A E+ NPR T+PRA K+  + I + Y+  L   G
Sbjct: 302 AQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAG 361

Query: 341 LLVPYNDPKLTEATSY--VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGS 398
            LVP NDP+L    S   V+ SP ++AI+N G + +P + NA+IL  IIS ANS++Y  S
Sbjct: 362 CLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACS 421

Query: 399 RILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGV 458
           R +  +++    PK  +   + G P +A+ AT VFG L+++  S   + +F WL  ++G+
Sbjct: 422 RCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGL 481

Query: 459 AGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTA- 517
           +  F W  I+ISHIRF +A+  +  S DELP+ +      ++Y +  +        +T+ 
Sbjct: 482 STLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSL 541

Query: 518 FAPKFNG---SSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAI 571
           F P  +G    SF   Y+S  +F+  +I  +   R  R       +D+DS RR  DIE +
Sbjct: 542 FPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEEL 601

Query: 572 ----VWEDHE--PKTFWDKFW 586
               + E  E   K F+ ++W
Sbjct: 602 KEQKLREQAETAKKPFYVRWW 622

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  285 bits (728), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 175/527 (33%), Positives = 272/527 (51%), Gaps = 19/527 (3%)

Query: 67  MEENLQDEDEGE---VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 123
           + EN  D ++G      ++++K+ +K RH                     L   GP   +
Sbjct: 71  INENTSDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALV 130

Query: 124 IAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           I Y+ +  + + + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y F W     
Sbjct: 131 IGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLP 190

Query: 183 LELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL      IQFW  K+    +I IF+V +  ++ F VK YGE EF     K++ I GF+
Sbjct: 191 LELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFI 250

Query: 243 IYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTE 301
           +    + CG AG  G +G  YW  PGA+     + + +  RF      L+ A F+F G E
Sbjct: 251 VLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGME 305

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTS 360
           L  ++  E  NPRK+ P A K+ ++RI+  Y+ +++ IG  VPYND +L  A  S    S
Sbjct: 306 LFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHAS 365

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           P+++A    G +++PHI NAVIL +++S ANS++Y G R++  L++   APKFL    + 
Sbjct: 366 PYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDRE 425

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           G P  A+    V G +A++  S+  + VF WL  I G++  F W  I +SH+RF QA+K 
Sbjct: 426 GRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKV 485

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLA-AYISIFLFIA 539
           +G S +EL +KA      + Y SFF       Q + A AP  NG    A A+   +L   
Sbjct: 486 QGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAP 545

Query: 540 VWILFEC---IFRCRF--IWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           +W++F     I+   F  +  ++ +D+D  RR  D E +  ED E K
Sbjct: 546 IWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENK 592

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  285 bits (728), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 184/600 (30%), Positives = 298/600 (49%), Gaps = 45/600 (7%)

Query: 2   TNPKQEAEIEEKHMYNE----PVTTLLHDVEASQTHRRRGSL-----SLKDEKSKELYPL 52
           T    E E+ +  +YN        +L  +V+      R G +     S K  +S+ L   
Sbjct: 11  TEKNAEFEVTDSALYNNFNTSTTASLSQEVKEHSEESRNGLVHRFVDSFKRAESQHL--- 67

Query: 53  RSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXX 112
                    +D    + +L+D       N  +K+ +K RH                    
Sbjct: 68  ---------ED----DNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAK 114

Query: 113 PLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGY 171
            L  AGP   +I Y+ +  + + + Q+ GEM    P +  +F  ++  F+S +FG A  +
Sbjct: 115 GLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTW 174

Query: 172 MYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVA 231
           ++   W     LEL      I++W  K+    +I IF+V +  ++ F VK YGE EF  +
Sbjct: 175 IFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFS 234

Query: 232 SIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSL 290
           S K++ I GF+I    + CG AGV G +G +YWR+PG++  G         RF G    L
Sbjct: 235 SCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----NGATRFKGICFIL 289

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           + A F+F G EL  ++  E +NPRK+ P A K+ V+RIL  Y+ +++ IG  VP+N+ +L
Sbjct: 290 VTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQL 349

Query: 351 TEATSYVS-TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL 409
             + S  +  SP+++A      +V+PHI NAVIL ++IS ANS +Y   R++  L++   
Sbjct: 350 MGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGY 409

Query: 410 APKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISI 469
           APKFL    + G P  A+F   + G + ++  S   ++ F WL  I G++  F W  I +
Sbjct: 410 APKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIML 469

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNG 524
           SHIRF +A+K +G S DE+ +KA      +YY  FF       Q + A +P     K N 
Sbjct: 470 SHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNA 529

Query: 525 SSFLAAYISIFLFIAVWI---LFECIFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
            +F  +Y++  L++ +++   L+E  F   F+  ++ +D+D  RR  D E I  E+ E K
Sbjct: 530 QAFFESYLAAPLWLCMYLGYMLYERDF--TFLNPLDKIDLDYHRRVYDPEIIRQENEENK 587

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  284 bits (726), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 175/523 (33%), Positives = 275/523 (52%), Gaps = 25/523 (4%)

Query: 68  EENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           +E+LQD ++ E    ++K+ ++ RH                     L N GP G  + + 
Sbjct: 77  QESLQDNNKHE----KLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFF 132

Query: 128 FMGSLAFSVTQSLGEMATFIPVTSS-FTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
            MG+  + V Q+ GEMA   P  S  F  +    + P FG A  ++Y   W   F LEL 
Sbjct: 133 VMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELV 192

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                I++WT  +    ++++F++LI ++N F  + Y E EF+  + KV+ IIGF I   
Sbjct: 193 TASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGI 252

Query: 247 CMVCGA-GVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            +  GA G  G +G +YWR PG++G      +     F G VS+L+NAAF+   +E V +
Sbjct: 253 LVNTGAAGNDGYIGAKYWREPGSFG-----GHTAIDHFKGVVSTLVNAAFSLGCSEFVAL 307

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIV 364
           TA E ANPRK+VP A KK+++++   ++GS+  IG LVP N  +L  +T S V  SP+++
Sbjct: 308 TAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVI 367

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           A+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L++   AP       + G P 
Sbjct: 368 AVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPL 427

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           +A+  +   G L ++  S   + VF WLL I+G++  F W  I ISHIRF +AL  +G  
Sbjct: 428 MAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRG 487

Query: 485 RDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAV 540
            D L FKA+     +YYS+  M      Q +T   P    K N  SF   Y++  +F+A+
Sbjct: 488 WDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVAL 547

Query: 541 WILFECIFRCRFIWKI----EDVDIDSDRR--DIEAIVWEDHE 577
           +  ++   +    W++    E +D+D  R+  D + +  ED E
Sbjct: 548 YFGYKIYNKN---WQLFIPAEKIDLDLHRKIFDADVLKQEDAE 587

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  283 bits (725), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 191/574 (33%), Positives = 287/574 (50%), Gaps = 35/574 (6%)

Query: 26  DVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEV--QNAE 83
            +E+ + H +   +S  D    E      F       DT  ++ NL D ++  +   NA 
Sbjct: 16  QLESGEFHEQNSYVSQSDASPVEGTRWERFRDSFKRADTQDLDPNLTDAEKMAILTANAP 75

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEM 143
           +KR LK RH                     LA AGP G LI +   G++ + +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-THKVPLA 202
           A   P+   FT ++ RF+  +FG A   +Y   W +   LE+      + +W T      
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++F+V+I  +N F VK YGE EF  + IKVI +IG++I    +VCG G  G     R
Sbjct: 196 GFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGR 255

Query: 262 YWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
            W NPGA+  G          F G  S  + AAF+F G+ELVG+ A E ANPRK++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAA 305

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQNSGTKVLPHIFNA 380
           K+V +RI  FYI +LL +GLLVPY   +L   +S   + SPF+++IQN+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYME 440
           VIL  ++S  NS ++  SR +  L+     PK      + G P + +  T VFG L+++ 
Sbjct: 366 VILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIA 425

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S    +VF+WLL ++G++  F W  I + HIR  +AL  +  +  EL F A      + 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSV 485

Query: 501 YSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWK-- 555
           Y    +      Q + A  P   K + S+F  AY+S  + IA +I  +       IWK  
Sbjct: 486 YGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHK-------IWKKN 538

Query: 556 ------IEDVDIDSDRR--DIEAIVWEDHEPKTF 581
                  +++DID+ RR  DIEA+  E  E K F
Sbjct: 539 WKLFIRAKNIDIDTGRRETDIEALKQEIAEEKAF 572

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  284 bits (727), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 182/535 (34%), Positives = 280/535 (52%), Gaps = 22/535 (4%)

Query: 62  QDTFSMEENLQ-DEDEGEVQ-------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           +D+F   E+++ D +  E +        A ++  LK R                      
Sbjct: 73  KDSFKKAEDVELDPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTA 132

Query: 114 LANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L   GP G +I +    ++ +S+  +LGE+A   PV   FT ++ RF+  +FG AN + Y
Sbjct: 133 LRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNY 192

Query: 174 WFSWAITFALELSVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
              W +   LE+      + +W T       ++++FW++I I+N+F VK +GE EF  + 
Sbjct: 193 ALQWLVVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSI 252

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
           IKV  +IGF+I    +VCG G  G     +YW +PGA+       + +  +F G  S  +
Sbjct: 253 IKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAF-----VGHGSGAQFKGVCSVFV 307

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            AAF+F G+EL+GITA EAANPRK++P A K+VV+RI+ FY+G+L  IGLLVPYND +L 
Sbjct: 308 TAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLI 367

Query: 352 EATSY-VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLA 410
            A+S   + SPF++AI   G K LP + N VIL  ++S  NS I+  SR +  LS     
Sbjct: 368 GASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFL 427

Query: 411 PKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISIS 470
           PK      + G P + +  T+ FG LA++  S    +VF WLL ++G++  F W  I + 
Sbjct: 428 PKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLC 487

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSF 527
           HIRF  ALK +G   +EL F +      +Y+  F +      Q + A  P   K +   F
Sbjct: 488 HIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVF 547

Query: 528 LAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
             +Y+S  + +A +   +   R  +    +ED+DID+ RR  D+E +  E  E K
Sbjct: 548 FQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEK 602

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  283 bits (725), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 166/535 (31%), Positives = 272/535 (50%), Gaps = 29/535 (5%)

Query: 62  QDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVG 121
           Q     + +L+++ +  V + ++K+ +K RH                     L  AGP  
Sbjct: 53  QPPLKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAP 112

Query: 122 ALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
            +IAY  +  + + + Q+ GEMA   P +  +F  +   F+S  FG A  ++++  W   
Sbjct: 113 LVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTV 172

Query: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
             LEL      +Q+W   +    ++ IF+V +  ++ F VK YGE EF     K++ + G
Sbjct: 173 LPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGG 232

Query: 241 FLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQG 299
           F+I+   + V GAG +G +G +YW +PGA+     + + N GRF G    L+ A F++ G
Sbjct: 233 FIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGG 287

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-EATSYVS 358
            EL  ++  E  NPR++ P A K+ ++RI+  Y+ +++ +G  VP N  +L     S   
Sbjct: 288 MELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTH 347

Query: 359 TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTS 418
            SP+++A    G KV+PHI NAVIL ++IS  NS +Y   R++  L++   APKF+    
Sbjct: 348 ASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVD 407

Query: 419 KGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQAL 478
           + G P  A+   +VFG + ++  S+  ++VF WL  I G+A  F W  I ISHIRF QA+
Sbjct: 408 REGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAM 467

Query: 479 KYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISI 534
           K +  S DE+ +K+      +Y+  FF       Q + A AP    + +  +F  +Y++ 
Sbjct: 468 KLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAF 527

Query: 535 FLFIAVWILFECIFRCRFIWK--------IEDVDIDSDRR--DIEAIVWEDHEPK 579
            +F A +  +        IWK        +E VD+D  RR  D E +  ED E K
Sbjct: 528 PIFFAFYFGY-------MIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKK 575

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  282 bits (722), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 177/574 (30%), Positives = 286/574 (49%), Gaps = 31/574 (5%)

Query: 31  QTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQ 90
           Q  +  G  S+ D+++ ++Y L       + +   S+    Q  D        +K+ LK 
Sbjct: 5   QDLKDAGETSVVDKQTGQVYELDLTSYSNDSEKNGSLPNKPQSGDH------NLKKGLKS 58

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-- 148
            H                     L   GP G  I+Y  M ++ + V  +L EM  F+P  
Sbjct: 59  AHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGL 118

Query: 149 -----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAA 203
                   S +    R++  + G A G+ Y + + I  A E +    V+ +WT  VP AA
Sbjct: 119 PDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAA 178

Query: 204 WISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRY 262
           WI+IF  +I ++N   V++YG  E    S+K+  I+G +I    +  G G     +GFR+
Sbjct: 179 WITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRF 238

Query: 263 WRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAI 321
           W++PGAW   +   +   GR    ++ +I A F F  G ELV +T+ EA + R+ + +A 
Sbjct: 239 WKDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAA 296

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPFIVAIQNSGTKVLPHI 377
           ++ V+R++ FY  S L  G++V  NDP L  A S       +SPF++ IQN+G KVLPHI
Sbjct: 297 RRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHI 356

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV-FATAVFGAL 436
            N  IL++  S+ NS +Y  +R L  LS+   APK  +R ++ GVPY  V FATA F  L
Sbjct: 357 INVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATA-FSCL 415

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           AY+  S+    VF W  NI+ ++GF  W+   ++++RF +A+ +  +  D LPFK    P
Sbjct: 416 AYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQP 474

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKI 556
              ++    +       G+ +F   +N   F+AAYI++ LF+ +W+  +   R    W I
Sbjct: 475 YFTWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMI 533

Query: 557 --EDVDIDSDRRDIEAIVWEDHE----PKTFWDK 584
              ++D+ +  R+IE    E +     P+  W+K
Sbjct: 534 SVSEIDVTTGLREIEEETKELNARRIPPRNLWEK 567

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 167/513 (32%), Positives = 273/513 (53%), Gaps = 20/513 (3%)

Query: 80  QNAE---VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSV 136
           QNA+   +K+ +K RH                     L + GP G+ I +L MG   + V
Sbjct: 83  QNAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCV 142

Query: 137 TQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
            Q+ GE+A  +  +   F  +    + PA G A  ++Y   W   F LEL      I+FW
Sbjct: 143 IQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFW 202

Query: 196 --THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA- 252
             +  V    +++IF+VLI ++N F  + Y E EF+  S KV+ +IGF I    +  GA 
Sbjct: 203 PGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAV 262

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G +G +G +YWR+PG+ G        +   F G V++L+NAAF+   +E V +TA E AN
Sbjct: 263 GTSGYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQAN 317

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIVAIQNSGT 371
           PRK++P A KK++++I   ++GS++ IG LVP +  +L  +  S +  SP+++A++  G 
Sbjct: 318 PRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGV 377

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
            V+P   NAVIL +++S  NS  Y  SR+L  L++   APK      + G P +A+  + 
Sbjct: 378 NVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISI 437

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           +FG + ++  S   ++VF+WLL I+G++  F W  I +SHIRF +AL  +G S DEL FK
Sbjct: 438 LFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFK 497

Query: 492 AKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECI 547
           A+     +Y S+  M      Q + +  P    + +  SF   Y+++ +F+  +  ++  
Sbjct: 498 AQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIW 557

Query: 548 FRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHE 577
            +  R   + + +D+ S RR  D + +  ED E
Sbjct: 558 NKDWRLFIRADQIDLVSHRRIFDADVLKQEDIE 590

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  281 bits (720), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 185/538 (34%), Positives = 285/538 (52%), Gaps = 16/538 (2%)

Query: 53  RSFPTGVNGQDTFSMEENLQDEDEGEVQ--NAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           + F       +   ++ NL + ++  +   N+ +KR LK RH                  
Sbjct: 44  QDFKNSFKRMEVVELDPNLTEAEKIAIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGS 103

Query: 111 XXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170
              L  AGP G LI +   G++ + +  ++GE+A   PV+  FT ++ RF+  +FG AN 
Sbjct: 104 GKALRTAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVSGGFTTYATRFIDESFGYANN 163

Query: 171 YMYWFSWAITFALELSVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFW 229
           + Y   W +   LE+      + +W T       ++++F+V+I  +N+F VK YGE EF 
Sbjct: 164 FNYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEFV 223

Query: 230 VASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRY-WRNPGAWGPGIISKNKNEGRFLGWVS 288
            + IKVI +IGF+I    +VCG G  G       W NPGA+       N    RF G  S
Sbjct: 224 FSFIKVITVIGFIILGIILVCGGGPVGGYIGGANWHNPGAF-----VGNTAGKRFKGVCS 278

Query: 289 SLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP 348
             + AAF+F G+ELVG+ + E ANPRK++PRA K+V +RI  FYI SL  IGLLVPYND 
Sbjct: 279 VFVTAAFSFAGSELVGLASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDT 338

Query: 349 KLTEATSY-VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
           +L  A+S   + SPF++AI+N G K LP + N VIL  ++S  NS ++  SR L  L++ 
Sbjct: 339 RLIGASSVDAAASPFVLAIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQ 398

Query: 408 KLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
              PK      + G P + +  T+ FG L+++  S    +VF+WLL ++G++  F W+ I
Sbjct: 399 GFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAI 458

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNG 524
            I H+RF +AL  +G S DEL F +      + Y +  +      Q + A  P     + 
Sbjct: 459 CICHLRFRRALSAQGRSTDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPPDA 518

Query: 525 SSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
             F  +Y+S+ + + ++I  +C  R  +   + E++DID+ RR  DIEA+  E  E K
Sbjct: 519 KDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRAENIDIDTGRREVDIEALKVELAEEK 576

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  281 bits (720), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 169/546 (30%), Positives = 283/546 (51%), Gaps = 18/546 (3%)

Query: 32  THRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQR 91
           T +R  S SLK++              +NG    +    L  ED   +  + + ++L  R
Sbjct: 42  TEKR--SNSLKEDNVMIQTTSSGATKNINGTSNPNDSNMLSKED---IDGSNLNKDLNIR 96

Query: 92  HXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTS 151
           H                     L   GP   +I ++ + +  F+V  SLGE+A   PV  
Sbjct: 97  HLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVG 156

Query: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVL 211
            F+V+  RF+ P+   +    Y   W +   LEL      I++W  K+   AW+SIF+ +
Sbjct: 157 GFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTV 216

Query: 212 ITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVC-GAGVTGPVGFRYWRNPGAWG 270
           I ++N+  VK +GE EF ++ IK++AIIGF I    + C G  V G +G +YW +PGA+ 
Sbjct: 217 IGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAF- 275

Query: 271 PGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330
                 +    +F G  S  + AAF++ G E++ ++A E+ +PRKT+P A K+  + I  
Sbjct: 276 ----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITA 331

Query: 331 FYIGSLLFIGLLVPYNDPKLTEATSY--VSTSPFIVAIQNSGTKVLPHIFNAVILTTIIS 388
            Y+  L  IG LVPY+DP+L   +S   V++SP ++AI+N G K LP + NA+IL  ++S
Sbjct: 332 SYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIILIAVLS 391

Query: 389 AANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKV 448
            ANS +Y  SR +  ++     PK L R  K G P  A   T  FG ++++  S    +V
Sbjct: 392 VANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQAEV 451

Query: 449 FEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXX 508
           F WL  ++G++  F W+ I+ISHIRF +A+  +G S +E+P+ +++    ++Y    +  
Sbjct: 452 FTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFL 511

Query: 509 XXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDS 563
                 +T+  P    + N ++F   Y+S+ + +A ++  +  F+  R      ++D+DS
Sbjct: 512 VLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNWRLFTPYNEIDLDS 571

Query: 564 DRRDIE 569
            +RDI+
Sbjct: 572 GKRDID 577

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  281 bits (719), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 172/564 (30%), Positives = 292/564 (51%), Gaps = 31/564 (5%)

Query: 41  LKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXX 100
           + D K+KE    ++  T  + Q + + E+           N  + ++L  RH        
Sbjct: 59  VTDSKTKEGGSEKNIETTPSEQFSIAKED----------INENLNKDLSIRHLITLAVGG 108

Query: 101 XXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRF 160
                        LA+ GP   +I ++ + +  F+V  +LGE+A   PV   F V+  RF
Sbjct: 109 SIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRF 168

Query: 161 LSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPV 220
           + P+   A    Y   W +   LEL      I++W   +   AW++IF+ +I + N+  V
Sbjct: 169 VDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDV 228

Query: 221 KYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKN 279
           K +GE EF ++ +K++AIIGF I    + CG G  G      YW +PG++       +K 
Sbjct: 229 KSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSF-----VGDKP 283

Query: 280 EGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFI 339
             +F G  S  + AAF++ G EL  ++A E+ +PRKT+P+A K+  + +   Y+  L  I
Sbjct: 284 GTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTII 343

Query: 340 GLLVPYNDPKLTEATSYV--STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           G LVP++DP+L   +S V  + SP +++I+N+G K L  + NA+IL +I+S ANS +Y  
Sbjct: 344 GCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYAC 403

Query: 398 SRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITG 457
           SR +  ++     PK LSR  K G P  A+ +T  FG L+++  S    +VF WL  ++G
Sbjct: 404 SRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSG 463

Query: 458 VAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTA 517
           ++  F W+ I+ SHIRF  A+K +  + DELP+ ++     ++Y    +        +T+
Sbjct: 464 LSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTS 523

Query: 518 FAPKFNG----SSFLAAYISIFLFIAVWILFECIFR-CRFIWKIEDVDIDSDRRDIEA-- 570
             P  +G    +SF   Y+S+ + IA ++  +   R  + + K+ED+D+++ R+ I+A  
Sbjct: 524 LFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHE 583

Query: 571 ----IVWEDH--EPKTFWDKFWNV 588
               I+ E      K+F  +FW+V
Sbjct: 584 HRAEILAEKAALSQKSFIKRFWHV 607

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  280 bits (716), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 172/525 (32%), Positives = 271/525 (51%), Gaps = 20/525 (3%)

Query: 68  EENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           E +L+D     V    +K+ +K RH                     L  +GP   +I Y+
Sbjct: 37  ENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYV 96

Query: 128 FMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
            +  + + + Q+ GEMA   P +  SF  ++  F+S  FG A  ++++  W   F LEL 
Sbjct: 97  LVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELI 156

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +++W  K+    +I IF+  +  ++ F VK YGE EF   S KV+ + GF+I   
Sbjct: 157 TASLTVKYWNDKINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSI 216

Query: 247 CMVCG-AGVTGPVGFRYWRNPGAW--GPGIISKNKNEGRFLGWVSSLINAAFTFQGTELV 303
            + CG AG  G +G +YW +PG++  GP I        RF G    L++A F++ G EL 
Sbjct: 217 VINCGGAGTDGYIGAKYWHDPGSFADGPPIT-------RFKGVCFILVSAYFSYGGAELF 269

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS-TSPF 362
            ++  E  NPRK+ P A K+ ++RIL  Y+ +++ IG  VP+N  +L  A S  +  SP+
Sbjct: 270 SLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPY 329

Query: 363 IVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGV 422
           ++A      KV+PH  NAVIL ++IS ANS +Y   R++  L++   APKFL+   + G 
Sbjct: 330 VLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGR 389

Query: 423 PYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482
           P   +   A+FG + ++  S+  ++VF WL  I G++  F W  I +SHIRF QA+K+ G
Sbjct: 390 PLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNG 449

Query: 483 ISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLA-AYISIFLFIAVW 541
            S DE+ FKA      +YY   F       Q + A +P  +G    A A+   +L   +W
Sbjct: 450 KSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIW 509

Query: 542 ILF---ECIFRCRF--IWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           ++F     I++  F  +  +E +D+D  RR  D + I  ED E K
Sbjct: 510 LVFYFGYMIYKRDFTILNPLEKIDLDFHRRIYDPDFIKQEDEENK 554

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  280 bits (717), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 172/542 (31%), Positives = 280/542 (51%), Gaps = 25/542 (4%)

Query: 67  MEENLQDEDEGEVQ----NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 122
           +E+N+    +  V     N  + ++L  RH                     LA+ GP   
Sbjct: 57  IEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASL 116

Query: 123 LIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           +I ++ + +  F+V  SLGE+A   PV   F V+  RF+ P+F  A    Y   W +   
Sbjct: 117 VIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLP 176

Query: 183 LELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL      I++W   +   AW++IF+ +IT+ N+  VK +GE EF ++ +K++AIIGF 
Sbjct: 177 LELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFT 236

Query: 243 IYCFCMVC-GAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTE 301
           I    + C G    G +G +YW NPGA+       + +  +F G  S  + AAF++ G E
Sbjct: 237 ILGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSGIE 291

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV--ST 359
           +  ++A E+ +PRKT+P+A K+  + I   Y+  L  +G LVPY+DP+L   TS V  + 
Sbjct: 292 MTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAA 351

Query: 360 SPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSK 419
           SP ++AI+N G K L  + NA+IL +IIS ANS +Y  SR +  ++     PK L +  K
Sbjct: 352 SPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDK 411

Query: 420 GGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            G P  A   T  FG L+++  S   ++VF WL  ++G++  F W+ I+ISHIRF QA+ 
Sbjct: 412 RGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMI 471

Query: 480 YRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGS----SFLAAYISIF 535
            +  S DE+P+ ++     + Y    +        +T+  P    S    SF   Y+S+ 
Sbjct: 472 KQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLP 531

Query: 536 LFIAVWILFECIFRC-RFIWKIEDVDIDSDRRDI-------EAIVWEDHEPK-TFWDKFW 586
           + I  +I  +  F+   ++  +E++D+D+ R+ +       E I  E    K +F  +FW
Sbjct: 532 ILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFW 591

Query: 587 NV 588
           +V
Sbjct: 592 HV 593

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  281 bits (718), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 193/601 (32%), Positives = 302/601 (50%), Gaps = 50/601 (8%)

Query: 11  EEKHMYNEPVTTLLHDVE--ASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSME 68
           + K+ Y   + T  ++VE  ++  + + GS S+ +  +K+   LR F       D+F   
Sbjct: 28  DGKNSYISDLETNDNEVEYISTDLNDKYGSSSINESPAKKKSNLRRF------VDSFKRA 81

Query: 69  ENLQDED---------EGEVQNAEVKRELKQ----RHXXXXXXXXXXXXXXXXXXXXPLA 115
           E++   D         E E + A V+  LKQ    RH                     L 
Sbjct: 82  EHMIPADDKINEMTTAEPEAEMASVEDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALV 141

Query: 116 NAGPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYW 174
            AGP G +  Y  MG+  + + QS GEMA  +  +   F  +    + P F         
Sbjct: 142 KAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVL 201

Query: 175 FSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIK 234
           F+     +  +       ++WT +V    ++ IF+VLI ++N+F  + Y E EF+    K
Sbjct: 202 FTMVDCLSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCK 261

Query: 235 VIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINA 293
           V+ + GF I    + V GAG  G +G  YWRNPGA+       +K    F G V++L+ A
Sbjct: 262 VLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVATLVTA 316

Query: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-E 352
           AF F GTE + +TA E +NPRK +P A KKV++RI+  Y+ S++ IG LVP+  P+L   
Sbjct: 317 AFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGS 376

Query: 353 ATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412
            ++  + SP+++A+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  LSK   APK
Sbjct: 377 GSAATAASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPK 436

Query: 413 FLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472
           +     + G P  A+  +A+FG +A+  TS    +VF WLL I+G++  F W+ I +SHI
Sbjct: 437 WFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHI 496

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFL 528
           RF  A+K +G S  E+ FKA+     +YYS F M      Q + A AP    + +  +F 
Sbjct: 497 RFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFF 556

Query: 529 AAYISIFLFIAVWILFECIFRCRFIW--------KIEDVDIDSDRR--DIEAIVWEDHEP 578
             Y+++ + I  +  ++       IW        K ED+D+ S R+  D E +  ED+E 
Sbjct: 557 ENYLAMPILIGFYFGYK-------IWKKDWTLYIKAEDIDLISHRQIFDEELLKQEDYEL 609

Query: 579 K 579
           K
Sbjct: 610 K 610

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  281 bits (719), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 162/506 (32%), Positives = 266/506 (52%), Gaps = 13/506 (2%)

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGS 131
           +D+DE  +   ++ ++L  RH                     L   GP   +I ++ + +
Sbjct: 129 RDKDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVST 188

Query: 132 LAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQV 191
             F+V  SLGE+A   PV   F+V+  +F+ P+F  A    Y   W +   LEL      
Sbjct: 189 ALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASIT 248

Query: 192 IQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I++W   +   AW+SIF+V I + N+  VK +GE EF ++ +K++AIIGF I    + CG
Sbjct: 249 IRYWNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCG 308

Query: 252 AGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310
            G +   +G +YW +PGA+  G  S +K    F G  S  + AAF+F G E+  ++A E+
Sbjct: 309 GGPSHEYIGGKYWHDPGAF-VGTTSGSK----FKGLCSVFVTAAFSFSGIEMTAVSAAES 363

Query: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQN 368
            NPR+T+P+A K+  + I   Y+  L  +G LVPYNDP+L   +S V  ++SP ++AI+N
Sbjct: 364 RNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIEN 423

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVF 428
                LP + NA+IL  I+S ANS++Y  SR +  +SK +  PK  ++  + G P  A+ 
Sbjct: 424 GHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAIC 483

Query: 429 ATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDEL 488
               FG L+++  S    +VF WL  ++G++  F W+ I++ HIRF Q +  + IS DEL
Sbjct: 484 FVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDEL 543

Query: 489 PFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILF 544
           PF ++     + Y    +        +T+  P    K N +SF   Y+S  + +  +I  
Sbjct: 544 PFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAH 603

Query: 545 ECIFRC-RFIWKIEDVDIDSDRRDIE 569
           +  F+  R+      +D+ S R+ ++
Sbjct: 604 KVYFKNWRWYIPASKMDLHSGRKQVD 629

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  279 bits (714), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 179/596 (30%), Positives = 302/596 (50%), Gaps = 26/596 (4%)

Query: 1   MTNP-KQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGV 59
           M++P    +++E+   +    + L ++   S T      +    E+S+     R F    
Sbjct: 1   MSDPIVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHR-FVDSF 59

Query: 60  NGQDTFSMEEN--LQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANA 117
              ++  +EE+  L+D  +    N  +K+ +K RH                     L+ A
Sbjct: 60  RRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLA 119

Query: 118 GPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFS 176
           GP   +I Y+ +  + + + Q+ GEM    P +  +F  ++  F+S +FG A  +++   
Sbjct: 120 GPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQ 179

Query: 177 WAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVI 236
           W     LEL      +++W   +    +I IF+V +  ++ F VK YGE EF   S K++
Sbjct: 180 WLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKIL 239

Query: 237 AIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAF 295
            + GF+I    + CG AGV G +G +YWR+PG++  G         RF G    L++A F
Sbjct: 240 MVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYF 294

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-EAT 354
           +F G EL  ++  E +NPRK+ P A K+ V+RIL  Y+ +++ IG  VP+N+ +L     
Sbjct: 295 SFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGG 354

Query: 355 SYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
           S    SP+++A      +V+PHI NAVIL ++IS ANS +Y   R++  L++   APKFL
Sbjct: 355 SATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414

Query: 415 SRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
           +   + G P  A+   ++ G + ++  S   ++ F WL  I G++  F W  I +SHIRF
Sbjct: 415 NYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRF 474

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNG---------S 525
            +A+K +G S DE+ +KA      +YY  FF       Q + A +P  NG          
Sbjct: 475 RKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFE 534

Query: 526 SFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           S+LAA + IF+++  +++++  F   F+  ++ +D+D  RR  D E +  ED E K
Sbjct: 535 SYLAAPLWIFMYVG-YMVYKRDF--TFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  280 bits (717), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 170/526 (32%), Positives = 272/526 (51%), Gaps = 24/526 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQS 139
            N  +K+ ++ RH                     L NAGP G +I Y  MGS+ + + Q+
Sbjct: 126 DNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQA 185

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK 198
            GEMA  +  +   + V+    +   FG A  ++Y   W     LEL      I++WT  
Sbjct: 186 TGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTS 245

Query: 199 VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGP 257
           V    +++IF+ LI I+N+F  K Y E EF+    KV+ +IGF I    +  G AG  G 
Sbjct: 246 VNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGY 305

Query: 258 VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +G  YW  PGA+       + +   F G   +L+ AAF + GTE + +TA E +NPR  +
Sbjct: 306 LGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAI 360

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIVAIQNSGTKVLPH 376
           P A KKV++RI+  Y+ S+L IG LVP++  +L  +  S  S SP+++A    G +V+PH
Sbjct: 361 PSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPH 420

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
             NAVIL +++S  NS  Y  SR+L  L++   APK+     + G P  A+  +A+FG +
Sbjct: 421 FINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVI 480

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S    +VF WLL I+G++  F W  I +SHIRF  A+K +G S  E+ + A+   
Sbjct: 481 AFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGV 540

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-R 551
             ++Y+ F M      Q + A AP    + +  +F   Y+++ + I +++ ++  ++   
Sbjct: 541 WGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWT 600

Query: 552 FIWKIEDVDIDSDRR--DIEAIVWEDHEPKT------FWDK---FW 586
            + K ED+D+ S R+  D + +  ED E +       FW +   FW
Sbjct: 601 LLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVDFW 646

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  278 bits (710), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 178/541 (32%), Positives = 276/541 (51%), Gaps = 25/541 (4%)

Query: 10  IEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEE 69
           I+ + +  EP+T   +   AS      GS              + F       +  +++ 
Sbjct: 22  IDSEFLTQEPITIPSNGSAASAEEAGSGS------------KWQDFKDSFKRVEPIAVDP 69

Query: 70  NLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           NL + ++  +  A+  +K  LK RH                     L   GP   LI + 
Sbjct: 70  NLTEAEKVAIVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
             G++ +++  +LGE+A   P++  FT ++ RF+  +FG AN + Y   W +   LE+  
Sbjct: 130 STGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVS 189

Query: 188 VGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
               + FW T       ++++FWV+I I+N+F VK YGE EF  + IKVI ++GF+I   
Sbjct: 190 ASITVNFWGTDPKYRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 247 CMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            + CG G  G     +YW +PGA+     + +    +F G  S  + +AF+F G+ELVG+
Sbjct: 250 ILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGL 304

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIV 364
            A E+  PRK+VP+A K+V +RI  FYI SLL IGLLVPYND  L  A+S   + SPF++
Sbjct: 305 AASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVI 364

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           AI+  G K LP + N VIL  ++S  NS IY  SR +  L++ +  P+  +   + G P 
Sbjct: 365 AIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPL 424

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           + +  T+ FG +A++  S     VF WLL ++G++  F W  I I HIRF +AL  +G  
Sbjct: 425 VGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRD 484

Query: 485 RDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSS---FLAAYISIFLFIAVW 541
            DEL FK+      +Y+  F +      Q + A  P     S   F  AY+S  L +A++
Sbjct: 485 LDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMY 544

Query: 542 I 542
           I
Sbjct: 545 I 545

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  278 bits (712), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 168/511 (32%), Positives = 270/511 (52%), Gaps = 21/511 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQS 139
           +  ++K+ +  RH                     L N GP G  I Y  MGS  + + Q+
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK 198
            GEMA ++  ++ +F  +    + PA G +  ++Y   W     LEL      I++WT  
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 199 VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGP 257
           V    ++ IF+VL  ++NLF  + Y E EF+  + KV+ I GF I    + CG AG  G 
Sbjct: 195 VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGY 254

Query: 258 VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +G +YW +PGA     +   K    F G +++++ AAF F  TE + +TA E ANPR+ +
Sbjct: 255 LGGKYWHDPGA-----LYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRRAI 309

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTEATSYVSTSPFIVAIQNSGTKVLPH 376
           P A KK+V+R+L  ++  ++ +G LVPYN D  +    S    SP+++AI + G KV+PH
Sbjct: 310 PSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVPH 369

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
             NAVIL +++S  NS  Y  SR+L  LS+   AP +L+   + G P  A+  + +FG +
Sbjct: 370 FINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLI 429

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S   + VF WLL I+G++  F W+ I +SHIRF +AL  +G S  EL +K++   
Sbjct: 430 AFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGV 489

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRCRF 552
             +YY++  M      Q + A AP    K + ++F   Y+++ + IA++  +    R   
Sbjct: 490 VGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKR--- 546

Query: 553 IWK----IEDVDIDSDRR--DIEAIVWEDHE 577
            WK    +E +D+ S R+  D + +  ED E
Sbjct: 547 DWKLYIPLEQIDLVSHRKVFDEDLLKQEDAE 577

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  280 bits (717), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 163/539 (30%), Positives = 272/539 (50%), Gaps = 21/539 (3%)

Query: 56  PTGVNGQDTFSMEENLQDEDEGEVQNAEVKRE--LKQRHXXXXXXXXXXXXXXXXXXXXP 113
           P     ++ +++ ++L+D       + ++ ++  +K RH                     
Sbjct: 124 PNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKS 183

Query: 114 LANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYM 172
           L  +GP G ++ Y  +  + + V Q+ GEMA   P +   F  +   F+S  FG A  ++
Sbjct: 184 LHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWI 243

Query: 173 YWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
           +  +W     LEL      +++WT  +    ++ IF++ +  ++   ++ Y E EF+  S
Sbjct: 244 FALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNS 303

Query: 233 IKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
            K++ I GF+I+   + CG AG  G +G +YW +PG +     + +    RF      LI
Sbjct: 304 CKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVLI 358

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           NA F++ GTEL  ++  E  NPRK VP A K  V+R+   Y+ +++ IG  VPYN P L 
Sbjct: 359 NAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLM 418

Query: 352 EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
              +    SP+++A Q  G K++PH  NAVIL ++IS ANS ++ G R+L  L++   AP
Sbjct: 419 GNANSKDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAP 478

Query: 412 KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           KFL+   + G P +A+   ++FG +A+  TS   D+VF WL  I G++  FAW  I +SH
Sbjct: 479 KFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSH 538

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAA 530
           IRF  A+KY G S DE+ +KA      +YY  FF       Q + A  AP   G     +
Sbjct: 539 IRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAIS 598

Query: 531 YISIFLFIAVWILFECIFRCRFIWK--------IEDVDIDSDRRDIEAIVWEDHEPKTF 581
           +   +L   +W+ F   + C  I+         ++D+D+D  RR  +A      + +++
Sbjct: 599 FFESYLAFVIWVFF---YLCYMIYNKDWTILIPLKDIDVDYQRRIYDADFLRQEKEESY 654

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  280 bits (716), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 183/595 (30%), Positives = 297/595 (49%), Gaps = 45/595 (7%)

Query: 8   AEIEEKHMYNEPVTTLLHDVEASQTH----RRRGSLSLKDEKSKELYPLRSFPTGVNGQD 63
           A+ EE       +   +   + ++ H       G+ S  D ++  LY     P  +    
Sbjct: 86  ADFEEHTTKPSRIRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHH 145

Query: 64  TFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 123
              + +N + +        E+K+ +K RH                     L  AGP G +
Sbjct: 146 DAQINDNSKSD--------ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLI 197

Query: 124 IAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           I +  MGS  + + Q++GE+A  +  +   F  +    +  AF  A  ++Y   W     
Sbjct: 198 IGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCP 257

Query: 183 LELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIAIIGF 241
           LEL      I++WT KV    ++ IF++LI  +NL      Y E EF   S K++ +IGF
Sbjct: 258 LELVTASMTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGF 317

Query: 242 LIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
            I    ++CG AG  G +G +YW +PGA     +  + +  RF G +++L+NAAF F  +
Sbjct: 318 FILGITVICGGAGTDGYIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMS 372

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVST 359
           E +G+TA E +NPRK +P A KK+++RIL  ++ S+  +G LVPYN  +L  +T S V  
Sbjct: 373 EFIGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKA 432

Query: 360 SPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSK 419
           SP+++AI   G +V+PH  NAVIL +++S ANS  Y  SR+L  L++   APK  S   +
Sbjct: 433 SPYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDR 492

Query: 420 GGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            G P + +   A+FG +A+  TS   D+VF WLL I+G++  F W+ I ISHIRF +A+ 
Sbjct: 493 EGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMH 552

Query: 480 YRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-------KFNGSSFLAAYI 532
            +G S  EL F++++    + Y++  M      Q + A  P       K +  +F   Y+
Sbjct: 553 VQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYL 612

Query: 533 SIFLFIAVWILFECIFRCRFIWKIE--------DVDIDSDRR--DIEAIVWEDHE 577
           ++ + +A +  ++       IWK +        ++D+ S R   D E I  E+ E
Sbjct: 613 AMPILLAFYFGYK-------IWKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDE 660

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  277 bits (709), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 164/513 (31%), Positives = 270/513 (52%), Gaps = 15/513 (2%)

Query: 73  DEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSL 132
           D+ + ++  + + ++L  RH                     L   GP   +I +  + + 
Sbjct: 75  DDIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTA 134

Query: 133 AFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVI 192
            F+V  SLGE+A   PV   F V+  RF+ P+F  +    Y   W +   LEL      I
Sbjct: 135 LFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTI 194

Query: 193 QFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA 252
           ++W   +   AW++IF+ LI I NL  VK +GE EF ++ +K++AIIGF I    + CG 
Sbjct: 195 RYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGG 254

Query: 253 GVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
           G  G     +YW +PGA+       +    +F G  S  + AAF++ G E++ ++A E+ 
Sbjct: 255 GPKGGYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQ 309

Query: 312 NPRKTVPRAIKKVVFRILTF-YIGSLLFIGLLVPYNDPKLTEATSYV--STSPFIVAIQN 368
           NPRKT+P A K+  F I+TF YI  L  +G LV YND +L   +S V  + SP ++AI+N
Sbjct: 310 NPRKTIPTAAKRT-FWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIEN 368

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVF 428
            G K LP + NA+IL  I+S ANS +Y  SR +  ++     PK LS   K G P  A+F
Sbjct: 369 GGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIF 428

Query: 429 ATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDEL 488
            T  FG L+++  S   ++VF WL  ++G++  F W+ I+I+HIRF QA+  +  S DE+
Sbjct: 429 TTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEM 488

Query: 489 PFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILF 544
           P+ ++     +YY +  +        +T+  P      +  +F   Y+S  + IA +I  
Sbjct: 489 PYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGH 548

Query: 545 ECIFRC-RFIWKIEDVDIDSDRRDIEAIVWEDH 576
           +  F+  R +  +E++D+ + R++++  + ++ 
Sbjct: 549 KLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEE 581

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  276 bits (706), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 166/474 (35%), Positives = 247/474 (52%), Gaps = 14/474 (2%)

Query: 62  QDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVG 121
            + ++ E++L  ED  +  ++ VKR+LK RH                     LA  GP+ 
Sbjct: 35  NNEYAEEQSLNREDTFD-PDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLA 93

Query: 122 ALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITF 181
            L+ +  +G LAF + +S+GEM T  P    FT  ++RF S A  A  GY Y   +    
Sbjct: 94  LLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVL 153

Query: 182 ALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGF 241
           A E + +  ++QFW  +VPL  +I IFW    +  L  V  +GE E+W+A  K++ ++ +
Sbjct: 154 ANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTY 213

Query: 242 LIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
            I+    + G     P  GF+YW +PGA   G          F G  +  +  +  + GT
Sbjct: 214 YIFSIVYISGGVKNRPAFGFQYWNDPGALSNG----------FKGIANVFVFCSTFYSGT 263

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360
           E V + A E+ NPR+ VP AI++  +RIL  Y+G  +F G+ VPYND  L  AT  V  S
Sbjct: 264 ESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNFATK-VLKS 322

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           P  +AI  +G     H+ NA IL T ISA N ++Y+GSR L  L+   LAPK L+ T + 
Sbjct: 323 PIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRR 382

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVP  A+      G ++ M  S      + +++N++GV  F  W  IS++H+RF +A K 
Sbjct: 383 GVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKL 442

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISI 534
           +G +RDELP+KAKL P     S          QG++ F P F+  +F+ AYI I
Sbjct: 443 QGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYILI 495

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  277 bits (709), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 185/579 (31%), Positives = 289/579 (49%), Gaps = 31/579 (5%)

Query: 17  NEPVT-TLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDED 75
           +E VT + L+D      H        +   S +    RS P G +  +T S++ +L D  
Sbjct: 20  SESVTASELYDSRPHAQHEEHEGAWCRFRDSFKRAQKRSVPQGGD-LETASVQTDLTD-- 76

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
                   ++R ++ RH                     L   GP G +I Y  +  +A+ 
Sbjct: 77  ------GRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYI 130

Query: 136 VTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194
           + Q+ GEMA   P +  +F  +S  F+S  FG A+ ++Y   W   F LEL      I++
Sbjct: 131 MMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKY 190

Query: 195 WTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AG 253
           WT  V    +I+IF+V I  ++ F  + YGE EF     KV+ I GF+I    + CG AG
Sbjct: 191 WTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAG 250

Query: 254 VTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
            +G +G RYW +PGA+  G         +F G+   L+   F++ GTEL  +T  E ++P
Sbjct: 251 NSGYIGARYWHDPGAFAVG-----DPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSP 305

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSYVSTSPFIVAIQNSGT 371
           R+ +  A K+ ++RIL  Y+ +++ IG LVP+   +L  +   S    SP+++A+   G 
Sbjct: 306 RRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGV 365

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431
           KV+PHI NAVIL  ++S  NS +Y G R+L  L++   APKFL+   + G P +A+ A +
Sbjct: 366 KVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACS 425

Query: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           V G LA++  S   + VF WL  I G++  F W  I +SHIRF QA+KY G S  +L +K
Sbjct: 426 VIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYK 485

Query: 492 AKLMPGL--AYYSSFFMXXXXXXQGFTAFAP-KFNGSSFLAAYISIFLFIAVWILFECIF 548
           +  + GL  + Y   F       Q + A AP   NG + + ++   +L   +W +F   +
Sbjct: 486 S--ITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGY 543

Query: 549 RC-----RFIWKIEDVDIDSDR--RDIEAIVWEDHEPKT 580
                    +  ++D+DI+  R   D E I  E  E KT
Sbjct: 544 MVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKT 582

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  278 bits (711), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 174/515 (33%), Positives = 275/515 (53%), Gaps = 20/515 (3%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAF 134
           DE  ++  E+KR++ QRH                     L +AGP G LI Y  MG+  +
Sbjct: 108 DEVVIKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVY 167

Query: 135 SVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQ 193
            V Q+ GE+  T+  +   F  +    ++P+F  + G++Y   W     LEL      I+
Sbjct: 168 CVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIK 227

Query: 194 FWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-A 252
           +WT KV    ++ IF++LI ++N F  K Y E +F+   +K+  I GF I    + CG A
Sbjct: 228 YWTTKVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGA 287

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G  G +G +YW NPGA+        K    F G  S  + +AF F G+E V ++A E AN
Sbjct: 288 GHDGYLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQAN 342

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTK 372
           PRK++P A K +++RI+  Y+ S+  +G LVP++ P+L  ++    TSP++VAI   G K
Sbjct: 343 PRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVK 402

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAV 432
           V+PH+ NAVIL  ++S +NS  +  SR+L  LS+   APK+     + G P  A+  +A+
Sbjct: 403 VVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISAL 462

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
           FG + +  TS     VF WLL I+G++  F +  I +SHIR   A+K +G S  EL F++
Sbjct: 463 FGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRS 522

Query: 493 KLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSF----LAAYISIFLFIAVWILF 544
           ++    ++Y+   +      + + A AP    K +  SF    LAA I I  +   ++++
Sbjct: 523 QVGTYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFG-YMIW 581

Query: 545 ECIFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHE 577
           +  FR  FI + +D+D+D  R+  D + I  ED E
Sbjct: 582 KKDFRI-FI-RSKDIDLDFKRQVFDEDLIKQEDEE 614

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  277 bits (708), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 186/530 (35%), Positives = 278/530 (52%), Gaps = 21/530 (3%)

Query: 63  DTFSMEENLQDEDEGEV--QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           +T  ++ +L   ++  +   NA +KR LK RH                     LA AGP 
Sbjct: 53  ETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPA 112

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           G LI +   G++ + +  ++GE+A   PV   +T ++ RF+  +FG A   +Y   W IT
Sbjct: 113 GILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLIT 172

Query: 181 FALELSVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAII 239
             LE+      + +W T      A++++F+V+I  +NLF VK YGE EF  + IKVIA+I
Sbjct: 173 LPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVI 232

Query: 240 GFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           GF+I    +VCG G  G     R W NPGA+  G          F G  S  + AAF+F 
Sbjct: 233 GFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG----------FKGVCSVFVTAAFSFA 282

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-V 357
           G+ELVG+ A E ANPRK++P A K+V +RI  FYI +LL +GLLVPY   +L   +S   
Sbjct: 283 GSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDA 342

Query: 358 STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417
           + SPF+++IQN+G K LP + N VIL  ++S  N  ++  SR +  L+     PK     
Sbjct: 343 AASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYI 402

Query: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477
            + G P + +  T VFG L+++  S    +VF+WLL ++G++  F W  I + HIR  +A
Sbjct: 403 DRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRA 462

Query: 478 LKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISI 534
           L  +  +  EL F A      + YS   +      Q + A  P   K + ++F  AY+S 
Sbjct: 463 LAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSF 522

Query: 535 FLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPKTF 581
            ++I  +I  +   +  +   K  D+DIDS RR  DIEA+  E  E K F
Sbjct: 523 PIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAEEKAF 572

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  276 bits (707), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 174/540 (32%), Positives = 278/540 (51%), Gaps = 18/540 (3%)

Query: 51  PLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           P R F      +DT S   +L+D +       ++++ ++ RH                  
Sbjct: 31  PFRRFVDSFRREDT-SRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVAN 89

Query: 111 XXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAAN 169
              L   GP G LI YL +  +++ +  + GEMA   P +  +F  +S  F+S  FG A 
Sbjct: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 149

Query: 170 GYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFW 229
            +++   W   F LEL     VI++W   V    ++ IF++ I  ++ F  + YGE EF 
Sbjct: 150 VWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFI 209

Query: 230 VASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWGPGI-ISKNKNEGRFLGWV 287
               KV+ I+GF+I    +  GA G TG +G RYWRNPG++  G  + K K      G  
Sbjct: 210 FNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLK------GTA 263

Query: 288 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347
             L+ A F+F G EL  ++  E  NP+  +P A KK V+RIL  Y+ +++ IG LVP++ 
Sbjct: 264 YVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDS 323

Query: 348 PKLT-EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSK 406
            +L    ++ V  SP+++AI+  G KVLPHI NAVIL ++IS  NS +Y   R+L  L++
Sbjct: 324 DRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQ 383

Query: 407 NKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLF 466
              APK L    + G P I++   A+FG +A+   S   +K+F WL  I G++  F W  
Sbjct: 384 QGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTS 443

Query: 467 ISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KF 522
           I +SH RF QA+K +G S + L ++A      + Y+ FF       Q + A  P    K 
Sbjct: 444 ICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKV 503

Query: 523 NGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           +  SF   Y++  L++ +++ +    R    +  ++ +D+D+ RR  D+E +  E++E K
Sbjct: 504 DVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK 563

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  277 bits (709), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 169/536 (31%), Positives = 280/536 (52%), Gaps = 28/536 (5%)

Query: 63  DTFSMEENLQDEDEGE---VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
           D+F   ++  D ++ E     + E K+ +K RH                     L+ AGP
Sbjct: 69  DSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGP 128

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
              +IAY  +  + + + Q+ GEMA   P +  SF  ++  F+S  FG A  +++   W 
Sbjct: 129 ASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWL 188

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
               LEL      I++W   +    ++ IF+V +  ++ F V+ YGE EF   + K++ I
Sbjct: 189 TVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMI 248

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
            GF+I+   + CG AG  G +G +YW +PGA+     + +    RF G   +L+NA F++
Sbjct: 249 GGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSY 303

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT--S 355
            G EL  ++  +  NPRK+ P A K  V+RI+  Y+ +++ IG +VP+N  +L  A+  +
Sbjct: 304 GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN 363

Query: 356 YVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415
            +  SP+++A    G KV+PHI NAVIL  +IS ANS++Y G R+L  L++   AP+FLS
Sbjct: 364 GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLS 423

Query: 416 RTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475
              + G P  A+  +A+ G + +  TS   ++VF WL  I+G++  F W  I  SHIRF 
Sbjct: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSSFLAA 530
           +A+K +  S D L +KA      +Y+   F       Q + A +P     K + +SF A+
Sbjct: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFAS 543

Query: 531 YISIFLFIAVWILFECIFRCRF-----IWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           Y++    + +W++F   + C +     +  +  VD+D+ R+  D E +  ED E K
Sbjct: 544 YLA----MPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENK 595

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  277 bits (708), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 171/527 (32%), Positives = 274/527 (51%), Gaps = 20/527 (3%)

Query: 66  SMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIA 125
           S E +L+D  +     + +K+ +K RH                     L+  GP   +I 
Sbjct: 57  STENDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIG 116

Query: 126 YLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
           Y+ +  + + + Q+ GEMA   P +  +F  ++  F+S  FG A  ++++  W   F LE
Sbjct: 117 YVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLE 176

Query: 185 LSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L      I++W  K+    +I IF+V +  ++ F VK YGE EF   S KV+ I GF+I 
Sbjct: 177 LITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIIL 236

Query: 245 CFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELV 303
              + CG AG  G +G +YWR+PG++  G      +  +F G    L+ A F++ G EL 
Sbjct: 237 SIVINCGGAGKDGYIGAKYWRDPGSFAEG-----DSVEKFKGICYILVTAYFSYGGAELF 291

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-EATSYVSTSPF 362
            ++  E  NPRK+ P+A K+ ++RIL  Y+ +++ IG  VP+N+ +L     S    SP+
Sbjct: 292 SLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPY 351

Query: 363 IVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGV 422
           ++A    G KV+PH  NAVIL ++IS ANS +Y   R++  L++   APKFL    + G 
Sbjct: 352 VLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGR 411

Query: 423 PYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482
           P  A+   AVFG + ++  S+  ++VF WL  I G++  F W  I +SH+RF Q +K  G
Sbjct: 412 PLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHG 471

Query: 483 ISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSSFLAAYIS--IF 535
            S +E+ F+A      + Y   F       Q + A AP     K +  SF  +Y++  I+
Sbjct: 472 RSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIW 531

Query: 536 LFIAV-WILFECIFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           LF    ++L++  F   F+  ++ +D++  RR  D E I  ED E K
Sbjct: 532 LFFYFGYMLYKRDF--TFLVPLDKIDLNFHRRIYDPELIRQEDEENK 576

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  277 bits (708), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 171/537 (31%), Positives = 278/537 (51%), Gaps = 26/537 (4%)

Query: 63  DTFSMEENLQDEDEGEVQ--------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPL 114
           D+F   E+ + ED+ +++        N  +K+ +K RH                     L
Sbjct: 57  DSFRRAESQRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGL 116

Query: 115 ANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMY 173
             AGP   +I Y+ +  + + + Q+ GEM    P +  +F  ++  F+S +FG A  +++
Sbjct: 117 KLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLF 176

Query: 174 WFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASI 233
              W     LEL      I++W   +    +I+IF+V +  ++ F VK YGE EF   S 
Sbjct: 177 CIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSC 236

Query: 234 KVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLIN 292
           K++ I GF+I    + CG AGV G +G  YWRNPG++  G      +  RF G    L+ 
Sbjct: 237 KILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADG-----SSATRFKGICFILVT 291

Query: 293 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLT 351
           A F+F G EL  ++  E ANPRK+ P A K+ ++RIL  Y+ +++ IG  VP+ ND  + 
Sbjct: 292 AYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMG 351

Query: 352 EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
             +S    SP+++A    G KV+PHI NAVIL ++IS ANS +Y   R++  L++   AP
Sbjct: 352 SGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP 411

Query: 412 KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           KFL+   + G P  A+   +  G + ++  S+  ++ F WL  I G++  F W  I +SH
Sbjct: 412 KFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSH 471

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSS 526
           IRF +A+K +G S DE+ +K+      +YY   F       Q + A +P     K +  S
Sbjct: 472 IRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVES 531

Query: 527 FLAAYISIFLFIAVWILFECIFRCRF--IWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           F  +Y++  L+I +++ +  I+   F  +  ++ +D+D  RR  D E +  ED E K
Sbjct: 532 FFQSYLAAPLWIFMYLGY-MIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  276 bits (707), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 191/604 (31%), Positives = 301/604 (49%), Gaps = 38/604 (6%)

Query: 4   PKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELY-PLRSFPTGVNGQ 62
           PK E +I+ + +  EP+   + + E S + +       +  K K+ + PL          
Sbjct: 10  PKNELQIDSEFLREEPLE--ISNFEESSSSQGPQPSGSRWRKFKDSFKPL---------- 57

Query: 63  DTFSMEENLQDEDE--GEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           D   + +++ D ++      +A +K  LK RH                     L  AGP 
Sbjct: 58  DEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPA 117

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           G LI +   G++ + +  ++GE++   P++  FT ++ RF+  +FG AN + Y   W   
Sbjct: 118 GILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCV 177

Query: 181 FALELSVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAII 239
             LE+      + +W T       ++++FWV+I I+NLF VK YGE EF  + IKV+ +I
Sbjct: 178 LPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVI 237

Query: 240 GFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           GF+I    + CG G  G     +Y+ +PGA+       +    RF G  S  + AAF+F 
Sbjct: 238 GFIIMGIVLNCGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFA 292

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-V 357
           G+EL+GI A E+A PRK+VP+A K+V +RI  FY+ SLL +GLLVPY D +L  A+S   
Sbjct: 293 GSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDA 352

Query: 358 STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417
           + SPF++AI + G + LP + N VIL  ++S  NS +Y  SR L  L++    PK     
Sbjct: 353 AASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYI 412

Query: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477
            + G P   +  T+ FG +A++  S    +VF WLL ++G++  F W  I   HIRF  A
Sbjct: 413 DRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAA 472

Query: 478 LKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISI 534
           L  +G S DELPFKA      + +  F +      Q + A  P   K +   F  +Y+S 
Sbjct: 473 LTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSF 532

Query: 535 FLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPKTF---------W 582
            + +A +   +   R  + +  +  +DID+ RR  D++ +  E  E K           W
Sbjct: 533 PVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTRPWWYRW 592

Query: 583 DKFW 586
             FW
Sbjct: 593 YSFW 596

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  275 bits (704), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 178/536 (33%), Positives = 278/536 (51%), Gaps = 37/536 (6%)

Query: 41  LKDEKSK------ELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXX 94
           +KD KS       E+ PL S    V          +L+D D+       + R L  RH  
Sbjct: 20  VKDPKSAPVVQNYEVTPLDSISDAVT---------DLEDHDK---IRESLNRSLSPRHIN 67

Query: 95  XXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFT 154
                              L   GP    I Y  MG + +     LGEM+TF+P++ SF 
Sbjct: 68  MISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTFMPISGSFC 127

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW---THKVPLAAWISIFWVL 211
            ++++F   +F  A    YWF+ A++ A +L+ +  V+ +W    H  P  A   +FWV 
Sbjct: 128 SYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFPYWAASLLFWVF 187

Query: 212 ITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWG 270
           +  +N+  V+ YGE E+W+A +KVIAI+ F I    +  G       +GF+YW    A  
Sbjct: 188 LLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKYWSYKEA-- 245

Query: 271 PGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330
           P +         F G+V+  +++AF++ GTE + +TAGEA NP +  PR +K V +RIL 
Sbjct: 246 PFV-------NGFKGFVTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIVKTVFWRILI 298

Query: 331 FYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAA 390
           FY+ ++ FI + +PY+ P L+  T  V TSPF +  Q +GTK      NAVILT+I+SA 
Sbjct: 299 FYVATMFFISMNIPYDYPNLS--TKSVMTSPFTIIFQMAGTKAAGSFMNAVILTSIVSAG 356

Query: 391 NSNIYVGSRILFGLSKNKLA-PKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVF 449
           N  ++ GSR+L+ +       PK +++T++   PY+AV  T   G L +  +  G   ++
Sbjct: 357 NHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLCFGASFIGAGTLW 416

Query: 450 EWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXX 509
            WL NI GV+   AWL I+++ IRF + L  +G ++ EL FK    P   Y+   F+   
Sbjct: 417 TWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQFKNWTYPYGPYFLVIFVTLI 475

Query: 510 XXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDR 565
              QG++AF P ++ S F + Y+ +F+F   W+++    R RF+ K ED+D  +DR
Sbjct: 476 ILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFKRDRFV-KPEDMDFITDR 529

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  276 bits (707), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 196/584 (33%), Positives = 304/584 (52%), Gaps = 35/584 (5%)

Query: 10  IEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKD--EKSKELYPLRSFPTGVNGQDTFSM 67
           I+ +++  EP+T +  +  A  T +  GS   KD  +  K + P+   P           
Sbjct: 22  IDSEYLTQEPIT-IPSNGSAVSTEKGSGS-KWKDFRDSFKRVEPVEVDP----------- 68

Query: 68  EENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIA 125
             NL + ++     A+  +K +LK RH                     L   GP   LI 
Sbjct: 69  --NLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIG 126

Query: 126 YLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALEL 185
           +  MG++ +++  +LGE+A   P++  FT ++ RF+  +FG A  + Y   W +T  LE+
Sbjct: 127 WGSMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEI 186

Query: 186 SVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
                 + +W T       ++++FW++I  +N+F VK YGE EF  + IKVI IIGF+I 
Sbjct: 187 VSASITVNYWGTDPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIIL 246

Query: 245 CFCMVCGAG-VTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELV 303
              + CG G   G +G +Y+ +PGA+     + +    +F G  S  + AAF+F G+ELV
Sbjct: 247 GIILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELV 301

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPF 362
           G+ A E+ +PRK+VP+A K+V +RI  FYI SLL IGLLVPYND +L  A+S   + SPF
Sbjct: 302 GLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPF 361

Query: 363 IVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGV 422
           ++AI   G K LP + N VIL  ++S  NS I+  SR    L++    P+  +   + G 
Sbjct: 362 VIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGR 421

Query: 423 PYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482
           P + +  T+  G +A++  S   + VF WLL ++G++  F W  I I HIRF +AL  +G
Sbjct: 422 PLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQG 481

Query: 483 ISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGS----SFLAAYISIFLFI 538
            S DEL FK+      +Y+  F +      Q + A  P  NGS     F  AY+S  L +
Sbjct: 482 RSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFP-VNGSPSAEGFFEAYLSFPLVL 540

Query: 539 AVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           A++I  +   R  + +    ++DIDS RR  D+E +  E  E K
Sbjct: 541 AMYIGHKIYKRNWKLLIPAGEMDIDSGRREVDLELLKQEIAEEK 584

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  277 bits (708), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 167/516 (32%), Positives = 279/516 (54%), Gaps = 19/516 (3%)

Query: 61  GQDTFSMEENLQDE-DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
           G  + ++E++ +DE D G+    ++K+ ++ RH                     LA AGP
Sbjct: 96  GVTSETIEQHKKDEGDTGD----KLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGP 151

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
            G +I Y  MGSL + + Q+ GEMA  ++ +   F  +    + P F  A  ++Y   W 
Sbjct: 152 AGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWL 211

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIA 237
               LEL      I++WT KV    ++ IF+V I  +N+    + Y E EF   S K++ 
Sbjct: 212 CVCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILM 271

Query: 238 IIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFT 296
           +IGF I    ++CG   T G +G RYW +PGA+        +   RF G V++L+ AAF+
Sbjct: 272 MIGFFILGIIIICGGAGTDGYIGGRYWHDPGAF-----RGERAVDRFKGVVATLVTAAFS 326

Query: 297 FQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY 356
           F  +E + +TA E +NPR+ +P A KK+++R L  Y+ S++ +G LVPYN  +L  A S 
Sbjct: 327 FGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSN 386

Query: 357 -VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415
            +  SP+++A+ N G +V+PH  NAVI+ +++S +NS  Y   R+L  LS+   APK  S
Sbjct: 387 GIKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFS 446

Query: 416 RTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475
              + G P + +   ++F  +A+  TS   D+VF WLL ++G++  F W+ I +SH+RF 
Sbjct: 447 YVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFR 506

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAY 531
           +A+  +G S  E  F +++    + YS F +      Q + A  P    K + +SF   Y
Sbjct: 507 RAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKVDANSFFENY 566

Query: 532 ISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR 566
           ++  ++IA++I ++C  +  R   K +D+D+ + R+
Sbjct: 567 LAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQ 602

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  276 bits (705), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 164/529 (31%), Positives = 270/529 (51%), Gaps = 22/529 (4%)

Query: 52  LRSFPTGVNGQDTFSMEENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXX 109
           + +F  G        ++ NL   +   +  A   +KR LK RH                 
Sbjct: 50  IHNFVDGFREYKLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVG 109

Query: 110 XXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAAN 169
               L   GP   ++A++  GS+ +SV Q++GE+   +PV+ S+  +  RF+ P+FG A 
Sbjct: 110 SGKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFAI 169

Query: 170 GYMYWFSWAITFALELSVVGQVIQFWT--HKVPLAAWISIFWVLITIMNLFPVKYYGEFE 227
            Y Y     +T  LE+      + +W   HK     ++++F+V + ++N   VK YGE E
Sbjct: 170 AYNYLVGNLVTMPLEIVAASITVDYWNVDHKYA-DGFVALFYVTVLLINFLGVKGYGEAE 228

Query: 228 FWVASIKVIAIIGFLIYCFCMVCGAGV--TGPVGFRYWRNPGAWGPGIISKNKNEGRFLG 285
           F  + IKV+AI+GF+I    +VCG G   TG +G +YW NPG +  G          F G
Sbjct: 229 FVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG----------FKG 278

Query: 286 WVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPY 345
           + +  + +AF+F G+E+  + A E+ NPR+ +P+A K+V +RI  FY+ SL  IG LVPY
Sbjct: 279 FAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPY 338

Query: 346 NDPKL-TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGL 404
            +  L   ++   S SPF++AI+ +G   LP + N VIL  ++S  N+ ++  SR    L
Sbjct: 339 TNKHLFASSSVDASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSL 398

Query: 405 SKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAW 464
           +     PK  +   + G P   +  + VFG L+++ +S     VFEW+L ++G+  FF W
Sbjct: 399 AHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTW 458

Query: 465 LFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNG 524
             I + H+RF Q L+ +G S DEL FKA+     + Y    +      Q + A  P    
Sbjct: 459 GSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKS 518

Query: 525 SS---FLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRRDIE 569
            S   F   Y+S+ + I  ++  +   R  R +   +++D+D+ RR+++
Sbjct: 519 PSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVD 567

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  276 bits (705), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 184/588 (31%), Positives = 296/588 (50%), Gaps = 40/588 (6%)

Query: 3   NPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNG- 61
            P  + E  EK  Y          V   +  R    L++ +  S +  P +    G NG 
Sbjct: 7   TPDDDVEDIEKSFY----------VSGKEQARVSTDLAVDEPISVQPEPRK----GWNGF 52

Query: 62  QDTFSMEE------NLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
            DTF   E      NL + ++  ++ A   + R LK RH                     
Sbjct: 53  VDTFRRAEMPVIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKA 112

Query: 114 LANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           LA AGP G LI +    ++   +  SLGE+A   PV+  +  ++ RF+  ++G AN + Y
Sbjct: 113 LATAGPAGVLIGWGLTATMILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNY 172

Query: 174 WFSWAITFALELSVVGQVIQFW-THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
                +   LE+      + +W T      A++++FWV+I  +NLF V+ +GE E   + 
Sbjct: 173 MMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSL 232

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
           IKVI IIGF+I    ++ G G    V G +YW +PG +       N    +F G  S  +
Sbjct: 233 IKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPF-----VGNAPSDKFKGVCSVFV 287

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            AAF+F G+EL+G+ A E   PRK++P+A K+V +RI  FYI SLL +GLLVP N+  L 
Sbjct: 288 TAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLL 347

Query: 352 EATSY-VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLA 410
                  + SPF++A+     +VLP I N VILT +IS  NS++Y  SR +  L+++   
Sbjct: 348 APQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFL 407

Query: 411 PKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISIS 470
           PK      + G P  A+  T++FG L ++  +    ++F+WLL I+G++ FF WL I+++
Sbjct: 408 PKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLA 467

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTA-FAPKFNGSS--- 526
           H+RF  ALK +G + +EL F +      + Y+   +      Q + A + P  +G+S   
Sbjct: 468 HMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKP 527

Query: 527 ----FLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRRDIE 569
               F   Y+S  + I +++  +   R  +F  K +++DID+ RR+++
Sbjct: 528 SPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELD 575

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  275 bits (703), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 172/536 (32%), Positives = 272/536 (50%), Gaps = 37/536 (6%)

Query: 63  DTFS--MEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           D+F    ++++   DE    ++++K+ +K RH                     LA AGP 
Sbjct: 41  DSFKKKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPG 100

Query: 121 GALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAI 179
           G +I Y    ++ + + Q+ GE+   +  +T ++T +S   + PA G +  ++Y   W  
Sbjct: 101 GLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMT 160

Query: 180 TFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAII 239
            F L+L      I++WT   P   +++I + LI  +NLF  K Y E EF   + KV+ ++
Sbjct: 161 VFPLQLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMV 219

Query: 240 GFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           GF+I    + CG AG  G +G RYW  PGA+  G          F G       AAF + 
Sbjct: 220 GFVILGIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYG 269

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS 358
           G E++ +TA E  NPRK++P A KKV++RIL  Y+ + L +  LVPY+ P+LT   S   
Sbjct: 270 GIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASR 329

Query: 359 TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTS 418
            SPF++AI + G  V+PHI NAVIL  ++S  NS++Y   R+L  LS+   APK  +   
Sbjct: 330 ASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVD 389

Query: 419 KGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQAL 478
           + G P +        G LA++  S   + VF WLL I+G++  F W+ I +SH+RF  A+
Sbjct: 390 RQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAM 449

Query: 479 KYRGISRDELPFKAKLMPGLAYYSSFFMXXXX----XXQGFTAFAPKFNG---------S 525
           K +G S  E+ +K++      Y+ S+F           Q + A AP  NG          
Sbjct: 450 KAQGRSLGEVGYKSQ----TGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQ 505

Query: 526 SFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           S+LAA + IF++    I ++     R      +VD++S R+  D + +  ED + K
Sbjct: 506 SYLAAPVLIFIYFGYKIYYK---DWRLCIPATEVDLNSHRKIFDEDELKQEDLDWK 558

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  275 bits (702), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 163/513 (31%), Positives = 271/513 (52%), Gaps = 17/513 (3%)

Query: 63  DTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 122
           D+ S+  N    + GE  N    ++L  RH                     L   GP   
Sbjct: 61  DSDSLHGNNVAFEYGENLN----KDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASL 116

Query: 123 LIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           +I ++ + S  F+V  +LGE+A   P+   F V+  RF+ P+F  A    Y   W ++  
Sbjct: 117 IIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLP 176

Query: 183 LELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL      I++W  ++   AW++IF+V I ++N+  VK++ E EF ++ IK++AI+GF 
Sbjct: 177 LELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFF 236

Query: 243 IYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTE 301
           I    + V G    G +G +YW +PGA+       +    RF G  S  + AAF++ G E
Sbjct: 237 ILGIVLAVGGGPTGGYIGGKYWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVE 291

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV--ST 359
           +  ++A E+ NPRKT+P+A K+  + I   YI  L  IG+LVPYND +L   +S V  S 
Sbjct: 292 MTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASA 351

Query: 360 SPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSK 419
           SP ++AI+N+G K LP + NA+IL  ++S ANS +YV SR++  ++     PK  S+  K
Sbjct: 352 SPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDK 411

Query: 420 GGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            G P  ++FAT   G L+++  S   ++VF WL  I G++  F W+ I+++HIRF  ALK
Sbjct: 412 RGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALK 471

Query: 480 YRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIF 535
           ++  S DEL + ++     ++Y    +        + +  P      +  +F   Y+S  
Sbjct: 472 FQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFP 531

Query: 536 LFIAVWILFECIFRC-RFIWKIEDVDIDSDRRD 567
           + IA +I  +   +  +++  +E++DID  +++
Sbjct: 532 ILIASYIGHKVYIKNWKWVIPLEEIDIDLGKKN 564

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  276 bits (705), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 170/520 (32%), Positives = 270/520 (51%), Gaps = 34/520 (6%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQS 139
           + A +KR++K RH                     LA  GP G  I Y  MGS  +S+ Q+
Sbjct: 98  KGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQA 157

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK 198
            GE+A   P +T +F  +    + PA   A   +Y   W   F LE+      I++W   
Sbjct: 158 AGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTS 217

Query: 199 VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGP 257
           +    W  IF+V+I  +N+     Y E +F+  + K++   GF I    + CG AG +  
Sbjct: 218 INPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVY 277

Query: 258 VGFRYWRNPGAWGPGIISKNKNEG--RFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
           +G +YW +PGA+       N + G  RF   VS+L+ AAF F  +E V +TA E ANPRK
Sbjct: 278 IGGKYWNDPGAF-------NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRK 330

Query: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TEATSYVSTSPFIVAIQNSGTKVL 374
            +P A K+V++RI+  Y+ S++ +G LVPYN P+L    +S V +SP+++A+ + G KV+
Sbjct: 331 AIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVV 390

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFG 434
           P   NAVIL +++S  N + Y  SRIL  LS+   APKF     + G P  A+   A+ G
Sbjct: 391 PSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVG 450

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            + ++  S+  + VF WL+ ++G++  F W  I ISH+RF +A++ +  S  EL F++++
Sbjct: 451 CICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQV 510

Query: 495 MPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSSFLAAYISIFLFIAVWILFECIFR 549
               +YY  F M      Q + A  P       +  +F A Y+++ +F+A++  F+    
Sbjct: 511 GVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFK---- 566

Query: 550 CRFIWKIE--------DVDIDSDRR--DIEAIVWEDHEPK 579
              IWK +        ++D+ S R+  D E +  ED E K
Sbjct: 567 ---IWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEEYK 603

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  275 bits (703), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 165/522 (31%), Positives = 275/522 (52%), Gaps = 18/522 (3%)

Query: 68  EENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           E N   ++E   ++ ++K+ +K RH                     L+ AGP   +I Y 
Sbjct: 107 ETNKGHQNE---KSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYA 163

Query: 128 FMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
            MG+  + + Q+ GE+A  +  +   F  +    + PA G +  ++Y   W     LEL 
Sbjct: 164 IMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELV 223

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                I++WT KV    ++ IF+VLI  +N F  + Y E EF+    KV+ + GF I   
Sbjct: 224 TASMTIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGI 283

Query: 247 CMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            +  G AG  G +G +YW +PGA+     + +K+  RF G + + + AAF F  TE + +
Sbjct: 284 IITAGGAGNDGYLGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATEFIAL 338

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTEATSYVSTSPFIV 364
           TA E +NPRK +P A KKV++RI+  ++ S+  IG LVPYN D  L    S +  SP+++
Sbjct: 339 TAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVI 398

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           A+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L++   APK+     + G P+
Sbjct: 399 AVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPF 458

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
            A+  +A+FG +A+  TS    +VF WLL I+G++  F W+ I +SHIRF +A++ +G S
Sbjct: 459 RAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRS 518

Query: 485 RDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAV 540
             E+ + ++     + Y++  +      Q + A AP    K +  +F   Y+++ + IA 
Sbjct: 519 LGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAF 578

Query: 541 WILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           +  +    R  +   + +D+D+D+ R+  D   +  ED E K
Sbjct: 579 YFGYRVWKRDWKLFIRAKDIDLDTHRQIFDENILRQEDEEYK 620

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  275 bits (703), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 168/515 (32%), Positives = 277/515 (53%), Gaps = 20/515 (3%)

Query: 62  QDTFSMEENLQDEDEGEV--QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
           Q T  +E  L     GEV  +N+++K+ +K+RH                     L +AGP
Sbjct: 98  QTTSDLESGL-----GEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGP 152

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
            G +I Y  MGS  + + Q+ GE+A  +  + S+F ++    +  AFG A  ++Y   W 
Sbjct: 153 GGLVIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWL 212

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
               LEL      I++WT  V    ++SIF+VLI ++N F  + Y E EF+  S KV+ +
Sbjct: 213 CVCPLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMM 272

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
            GF I    + CG AG +G +G +YW +PGA+     + N+    F G +++   AAF F
Sbjct: 273 AGFFILGIIITCGGAGTSGYIGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAF 327

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV 357
             +E + +TA E +NPRK +P+A K +++RIL  ++ S+  IG LVPYN P L  + S  
Sbjct: 328 GASEFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDA 387

Query: 358 S-TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416
           +  SP++VA+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L++   APK  + 
Sbjct: 388 TKASPYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTY 447

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
             K G P +A+  + +F  +A+   S   ++VF WLL I+G++  F W+ I ISH+RF +
Sbjct: 448 IDKRGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRR 507

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYI 532
           ALK +G S  E+ FK+++    + Y++  +      Q + A AP      +  +F   Y+
Sbjct: 508 ALKVQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYL 567

Query: 533 SIFLFIAVWILFECIFRCRFIW-KIEDVDIDSDRR 566
           ++ + + ++  ++   R    W     +D+ S R+
Sbjct: 568 AMPILLVLYFGYKIRKRDWKFWIPAHRIDLVSHRK 602

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 168/496 (33%), Positives = 254/496 (51%), Gaps = 21/496 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSL 140
           N  VKR LK RH                     L   GP+  L+ +  +G +AF+V +S+
Sbjct: 46  NTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESI 105

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVP 200
           GE+ T  P    FT  ++RF   A  A  GY Y   +    A E + +  ++QFW  +VP
Sbjct: 106 GEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 165

Query: 201 LAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV-G 259
           L  +I IFW    I  L  V  +GE E+W++  K++ ++ + I+    + G     P  G
Sbjct: 166 LYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFG 225

Query: 260 FRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 319
           F YW +PG+   G          F G     +  +  + GTE V + A E+ NP K VP 
Sbjct: 226 FHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPL 275

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFN 379
           A+++ ++R+L  YIG  +F G  VP++DP L+ AT+ V  SP  +AI  +G     H+ N
Sbjct: 276 AVRQTLWRVLIVYIGIAVFYGATVPFDDPNLS-ATTKVLKSPISIAISRAGWAGGAHLVN 334

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYM 439
           A IL T ISA N ++Y+GSR L  L+   LAPK L+ T + GVP  A+      G ++ M
Sbjct: 335 AFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLM 394

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S G    + +++N++GV  F  W  IS +H+R  +A   +G S +ELP+KA L P   
Sbjct: 395 NVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTP 454

Query: 500 YYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYI----SIFLFIAVWILFECIFRCRFIWK 555
            +S          QG+T+F P F+  +F+ AYI    +I L++A+ +     FR   I  
Sbjct: 455 IFSLIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAICVFKNHHFR---IVD 510

Query: 556 IEDVDIDSDRR-DIEA 570
           ++ VD+D  RR DI+A
Sbjct: 511 LKSVDLDEGRRKDIDA 526

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  271 bits (693), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/505 (33%), Positives = 256/505 (50%), Gaps = 22/505 (4%)

Query: 72  QDEDEGEVQ-NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMG 130
            D D  E   N  VKR LK RH                     L   GP+  L+ ++ +G
Sbjct: 19  DDRDVSEFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIG 78

Query: 131 SLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190
            +AF+V +S+GEM T  P    FT  ++RF S A  A  GY Y   +    A E + +  
Sbjct: 79  IIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSS 138

Query: 191 VIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVC 250
           ++QFW  +VPL A+  IFW++  I  L  V  +GE E+W++ +K++ +I + I+    + 
Sbjct: 139 ILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMS 198

Query: 251 GAGVTGPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGE 309
           G     P  GF YW++PG+   G          F G     +  +  + GTE V +TA E
Sbjct: 199 GGVRNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATE 248

Query: 310 AANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNS 369
           + NP K+VP A+++ ++RI+  YIG  +F G  VP+NDP L+  T  V  SP  +AI  +
Sbjct: 249 SKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNLSVNTK-VLKSPIAIAISRA 307

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429
           G     H+ NA IL + ISA N ++Y+GSR L  L+   LAPKFL+ T K GVP  A+  
Sbjct: 308 GWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITI 367

Query: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489
               G ++ M  S G    + +++N++GV  F  W  IS +H+R  +A   +G   +ELP
Sbjct: 368 FNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELP 427

Query: 490 FKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYI----SIFLFIAVWILFE 545
           +KA   P    +S          QG+T+  P F    F+ AYI    +I L++ V +   
Sbjct: 428 YKALFYPWTPIFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCVFKN 486

Query: 546 CIFRCRFIWKIEDVDIDSDRR-DIE 569
             FR   I  +  V++D  RR D+E
Sbjct: 487 HNFR---IVDLTSVNLDEGRRKDME 508

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  273 bits (699), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 183/585 (31%), Positives = 289/585 (49%), Gaps = 36/585 (6%)

Query: 26  DVEASQTHR----RRGSLSLKDEKSKELYPLRSFPTGVNGQ------DTFS-MEENLQDE 74
           DV +SQ  R     + S+   +EKS E Y   +     N        D+F   E+N   E
Sbjct: 11  DVLSSQELRTDASNKKSVDQINEKSVESYASNAEVGATNPTMFRRFVDSFKPAEDNKHSE 70

Query: 75  DEGEVQ-----------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 123
            + +V+           +  +K+ +K RH                     L   GP   +
Sbjct: 71  VDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALV 130

Query: 124 IAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           I Y  +  + + + Q+ GEMA   P +  +F  ++  F+S  FG A  +++   W     
Sbjct: 131 IGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLP 190

Query: 183 LELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL     +I++WT KV    ++ IF+V +  ++   VK YGE EF     K++ I GF+
Sbjct: 191 LELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFI 250

Query: 243 IYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTE 301
           I+   + CG AG  G +G +YW +PGA+       N  E RF G    L++  F++ GTE
Sbjct: 251 IFSIVVNCGGAGHDGYIGGKYWHSPGAFA----GTNAAE-RFKGVCYVLVSGYFSYGGTE 305

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTS 360
           L  ++  E  NPRK+ P A K+ ++RIL  Y+ +++ IG  VP+ND +L  A  S    S
Sbjct: 306 LYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHAS 365

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           P+++A    G +V+PHI NAVIL  +IS ANS++Y   R+L  L++   APKF++   + 
Sbjct: 366 PYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDRE 425

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           G P  A+ A AVFG +A+   S   ++VF WL  I G++  F W  I +SH+RF QA+K 
Sbjct: 426 GRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKL 485

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFLF 537
           +G   +E+ + A      + Y   F       Q + A AP        SF  +Y++  ++
Sbjct: 486 QGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYLAFPIW 545

Query: 538 IAVWILFECIFR-CRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           IA +  +    +   F+  ++ +D+D  RR  D E +  ED E K
Sbjct: 546 IAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENK 590

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  273 bits (698), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 196/586 (33%), Positives = 307/586 (52%), Gaps = 25/586 (4%)

Query: 5   KQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDT 64
           K +A IE  ++  + ++  L   + S T           E + +    R+F       + 
Sbjct: 16  KGQAVIENCYLGQDVISETLSYKDLSNT---------TPESTIDKSRWRNFLDSFKRIEV 66

Query: 65  FSMEENLQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 122
             ++ NL D ++  ++ A   ++ +LK RH                     L  AGP G 
Sbjct: 67  EEVDPNLTDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGI 126

Query: 123 LIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           LI +   G++ F++  +LGE+A   PV+  F  ++ RF+  +FG AN + Y F W +   
Sbjct: 127 LIGWGITGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALP 186

Query: 183 LELSVVGQVIQFWTHKVPLA-AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGF 241
           LE+      + +W   V     ++++FW+++ I+N+F V+ YGE EF  + IKVIA+IGF
Sbjct: 187 LEIVAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGF 246

Query: 242 LIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300
           +I    +VCG G  G     RYW +PGA+     + +    RF G+ S  + AAF+F G+
Sbjct: 247 IILGIILVCGGGPVGGYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAGS 301

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VST 359
           ELVGI + E+ NPRK+VP+A K+V +RIL FYI  LL +GLLVPY DP+L  ++    S 
Sbjct: 302 ELVGIASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASA 361

Query: 360 SPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSK 419
           SPF++AI   G   LP + N VIL +++S  NS+IY  SR L  LS+    PK ++   +
Sbjct: 362 SPFVIAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDR 421

Query: 420 GGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            G P + +   + FG +A++  S   +++F WLL I+G++ F  W  I   HIRF  ALK
Sbjct: 422 KGRPLVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALK 481

Query: 480 YRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYISIFL 536
             G S DELPFK+ +    +Y+           Q + A  P     N   F +AY++  +
Sbjct: 482 VNGRSDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPI 541

Query: 537 FIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
            +A +I  +   R  + +  ++D+DID+ RR  DI  +  E  E K
Sbjct: 542 VLAFYIAHKLWKRNWKLLIPLKDIDIDTGRRETDINLLKQEIAEEK 587

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  271 bits (693), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 178/523 (34%), Positives = 265/523 (50%), Gaps = 21/523 (4%)

Query: 65  FSMEE----NLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 120
           FS EE    N++  ++ +  N  VKR LK RH                     L+  GP+
Sbjct: 22  FSKEEPDTHNIKSFEQFD-PNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPL 80

Query: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
             L+ +  +G +AF+V +S+GEM T  P  S F+  S+RF S A  A +GY Y   +   
Sbjct: 81  SLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAV 140

Query: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
            A E + +  ++QFW  +VPL  +I IF V   +  +  V  +GEFE+W+A  K+I +I 
Sbjct: 141 LANEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIA 200

Query: 241 FLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQG 299
           + I+    + G     P  GF YW NPGA   G          F G     +  +  + G
Sbjct: 201 YYIFSIIYISGGIKNRPAFGFHYWNNPGALADG----------FKGIAVVFVFCSSFYSG 250

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVST 359
           TE V + A E+ NP K VP AIK+  +RI+  Y+G  +F G  VPYND  L   T  +  
Sbjct: 251 TESVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALK- 309

Query: 360 SPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSK 419
           SP  +AI  +G +   H+ NA IL T +SA N ++Y+GSR L  L+   LAPKFL  T K
Sbjct: 310 SPIAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDK 369

Query: 420 GGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            GVP  A+      G ++ M  S G    + +++N++GV  F  W  IS++H+RF +A  
Sbjct: 370 RGVPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWD 429

Query: 480 YRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIA 539
            +G S  ELP+K+ L P    +S          QG+T F P F+   F+ AYI +   + 
Sbjct: 430 LQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFVP-FSAKDFVDAYILLPAAVI 488

Query: 540 VWILFECIFRCRF-IWKIEDVDIDSDRR-DIEAI-VWEDHEPK 579
           ++I+   +    F +  +  VD++  RR D+++    ED E K
Sbjct: 489 LYIVISLVKIGGFKLVDLRTVDLEEGRREDLDSDGTDEDSEGK 531

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  272 bits (695), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 166/530 (31%), Positives = 265/530 (50%), Gaps = 28/530 (5%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           ++ +   +G    + +KR LK RH                     +A  GP+G +I +  
Sbjct: 63  DSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAI 122

Query: 129 MGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188
            GS        LGE+    PV  +F  +  RFL P+       +Y   W     LE+   
Sbjct: 123 AGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAA 182

Query: 189 GQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
              +Q+W   +    W++IF+ +I  +NLF V+ +GE EF  ++IK I + GF+I C  +
Sbjct: 183 AMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVL 242

Query: 249 VCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
           +CG G     +G +YW +PG    G          F G +S L+ A+++  G E+  + +
Sbjct: 243 ICGGGPDHEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLAS 292

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367
           GE  +P K +P AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF++AI+
Sbjct: 293 GET-DP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIK 349

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
               K LP I NAVIL +++S  NS I+  SR L  ++   L P +     + G P + +
Sbjct: 350 LHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGI 409

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
            A ++FG LA++  S    +VF WL+ I G+A    WL I++SHIRF  A+K +G S DE
Sbjct: 410 MANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDE 469

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----------KFNGSSFLAAYISIFL 536
           L F + +    + YS+         Q + +  P           K    ++L A I +F+
Sbjct: 470 LEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFI 529

Query: 537 FIAVWILFEC-IFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHEPKTFWD 583
           FI   I ++C   +   +  ++D+D+++DR+  DIE +  E  E K + D
Sbjct: 530 FIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLD 579

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  271 bits (694), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 167/581 (28%), Positives = 282/581 (48%), Gaps = 38/581 (6%)

Query: 28  EASQTHRRRGSLSLKDEKSKELYPLRSFPTGV---------NGQDTFS-MEENLQDEDEG 77
            + +   RR  +   + KSK+L    S  +           N ++ F    ++ +   +G
Sbjct: 12  SSEELKERRSKVEFVEYKSKQLTSSSSHNSKSSHHDDDGQYNNRNIFQRCVDSFKPPLDG 71

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVT 137
               + +KR LK RH                     +A  GP+G ++ +   GS      
Sbjct: 72  SFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTV 131

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTH 197
             LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W  
Sbjct: 132 HGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNS 191

Query: 198 KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP 257
            +    W++IF+ +I  +NLF  + +GE EF  +++K I + GF+I C  ++CG G    
Sbjct: 192 SIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHE 251

Query: 258 -VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
            +G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P K 
Sbjct: 252 FIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP-KG 299

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPH 376
           +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF++AI+    KVLP 
Sbjct: 300 LPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLPS 358

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
           I NAVIL +++S  NS I+  SR L  ++   L P +     + G P + + A ++FG L
Sbjct: 359 IVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLL 418

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S    +VF WL+ I G+A    WL I++SH+RF  A+K +G S DEL F + +  
Sbjct: 419 AFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGI 478

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAP-------KFNGSSFLAAYISIFLFIAVWILFECIFR 549
             + YS+         Q + +  P       K     F   Y+   + + ++++ +  +R
Sbjct: 479 WGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYYR 538

Query: 550 CRF-----IWKIEDVDIDSDRR--DIEAIVWEDHEPKTFWD 583
           C+      + +++D+D+++DR+  DIE +  E  E K + D
Sbjct: 539 CQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKKKYLD 579

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  272 bits (695), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 161/507 (31%), Positives = 253/507 (49%), Gaps = 26/507 (5%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G      +KR LK RH                     +A  GP+  +I +   GS    
Sbjct: 77  DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIG 136

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
               LGE+    PV  +F  +S RFL P+       +Y   W     LE+      +Q+W
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW 196

Query: 196 THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
              +    W++IF+  I  +NLF  + +GE EF  +S+KV+ I GF+I C  ++CG G  
Sbjct: 197 NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPD 256

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              VG +YW +PG    G          F G +S L+ A+++  GTE+V + +GE  +P 
Sbjct: 257 HDFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DP- 304

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVL 374
           K +P AIK+  +RIL F++ SL  IG LVPY +  L   +S V+ SPF++AI+    KVL
Sbjct: 305 KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVL 363

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFG 434
           P I NAVIL +I+S  NS I+  SR L  ++   L P+F     + G P   +   ++FG
Sbjct: 364 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFG 423

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            LA++  S+   +VF+WL+ I G+A    WL I+ISHIRF  A+K +G S DEL F + +
Sbjct: 424 LLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAV 483

Query: 495 MPGLAYYSSFFMXXXXXXQGFTAFAP-------KFNGSSFLAAYISIFLFIAVWILFECI 547
               + YS+         Q + A  P             F  +Y+   + I +++  +  
Sbjct: 484 GIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIF 543

Query: 548 FRCRF-----IWKIEDVDIDSDRRDIE 569
           +R +      +  +  +D+++DR++I+
Sbjct: 544 YRYKTGKWWSMLPLNKIDLETDRKNID 570

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  272 bits (695), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 179/596 (30%), Positives = 296/596 (49%), Gaps = 26/596 (4%)

Query: 1   MTNP-KQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGV 59
           M+ P    +++E+   +    + L ++   S T      +    E+S+     R F    
Sbjct: 1   MSEPIVMSSKMEKNTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESRNGLVHR-FVDSF 59

Query: 60  NGQDTFSMEEN--LQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANA 117
              ++  +EEN  L+D       N  +K+ +K RH                     L  A
Sbjct: 60  RRAESQCLEENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLA 119

Query: 118 GPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
           GP   +I Y+ +  + + + Q+ GEM   +  +  +F  ++  F+S +FG A  +++   
Sbjct: 120 GPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQ 179

Query: 177 WAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVI 236
           W     LEL      I++W   +    +I IF+V +  ++ F VK YGE EF   S K++
Sbjct: 180 WLTVLPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKIL 239

Query: 237 AIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAF 295
            + GF+I    + CG AGV G +G +YWR+PG++  G      N  RF G    L+ A F
Sbjct: 240 MVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADG-----SNATRFKGICFILVTAYF 294

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATS 355
           +F G EL  ++  E +N RK+ P A K+ V+RIL  Y+ +++ IG  VP+N+ +L  + S
Sbjct: 295 SFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGS 354

Query: 356 YVS-TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
             +  SP+++A      +V+PHI NAVIL ++IS ANS +Y   R++  L++   AP+FL
Sbjct: 355 AATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFL 414

Query: 415 SRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
           +   + G P  A+   A+ G + ++  S   ++ F WL  I G++  F W  I +SHIRF
Sbjct: 415 NYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRF 474

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNG---------S 525
            +A+K +G S  EL +KA      +YY  FF       Q + A +P  NG          
Sbjct: 475 RKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFE 534

Query: 526 SFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
            +LAA + IF+++  ++L+   F    +  ++ +D+D  RR  D E +  ED E K
Sbjct: 535 GYLAAPLWIFMYLG-YMLYNKDF--TLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  272 bits (696), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/483 (32%), Positives = 254/483 (52%), Gaps = 18/483 (3%)

Query: 71  LQDEDEGEVQNAEV-----KRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIA 125
           LQ+ D  + Q+  +     +R+L  R                      +   GP   LIA
Sbjct: 99  LQNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIA 158

Query: 126 YLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALEL 185
           +     +   +++ +  M T++PVT SF  F++RF+  + G A G+ Y+   A     E+
Sbjct: 159 FCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEI 218

Query: 186 SVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
           + V  V+++WT K+P AA IS+  +L   +NL+ V ++GE EF+++  KV+  IG +I+ 
Sbjct: 219 TAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFT 278

Query: 246 FCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVG 304
             ++ G      V GF+ W NPGA+   I   + + GRF G++S L+ A + F G + +G
Sbjct: 279 VVVMAGGNPQHTVLGFKNWSNPGAFAEYI--SDGSVGRFHGFMSCLVFALYVFWGVDYLG 336

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTS 360
             A EA NPRK +P + +KV  R++ FYIG  + +G+L+PYNDP +  A          S
Sbjct: 337 NAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGAS 396

Query: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420
           P++ A++  G +VLPHI N +ILT+IISA NS++Y  SR+L  L+ +  AP+    T+K 
Sbjct: 397 PYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKK 456

Query: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVP     A  V   LAY+  S   + V  W LN+   A    ++FI +S+++F +    
Sbjct: 457 GVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLA 516

Query: 481 RGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF------APKFNGSSFLAAYISI 534
           + +    LP+ +  +P LA++S F++       G+T F         F  S F+  +  +
Sbjct: 517 QNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLV 576

Query: 535 FLF 537
           FLF
Sbjct: 577 FLF 579

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 173/509 (33%), Positives = 274/509 (53%), Gaps = 24/509 (4%)

Query: 67  MEENLQDEDEGEVQNAEVK----RELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 122
           ++ N    D+ E Q+A ++    R L  RH                     L   GP   
Sbjct: 41  VDTNNSVSDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSL 100

Query: 123 LIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           LI Y+ MG + +    SLGEM+TF+P++ S+  +S++F+S ++  A     W+S A++ A
Sbjct: 101 LINYVIMGGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVA 160

Query: 183 LELSVVGQVIQFW---THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAII 239
            +L+ +  V+ +W   TH  P  A   +FW LI  +N+  VK YGE E+W+A +KV+A+I
Sbjct: 161 SDLTALQLVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVI 220

Query: 240 GFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
            F I      CG       +GF+ W +  A  P +      +G F G+V+  + ++F++ 
Sbjct: 221 IFFIMAIIANCGHNQQHEYIGFKNWSHGDA--PFV------QG-FKGFVTIFVTSSFSYG 271

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS 358
           GTE V +T GEA NP +  P+ IK V +RIL FY+ ++ F+G+ +PY+ P L   T  V 
Sbjct: 272 GTETVTLTGGEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNL--KTKSVL 329

Query: 359 TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP--KFLSR 416
           TSPF +  Q +GTK      NAVI+T+ ISA N  ++ GSRIL+ +      P  +F ++
Sbjct: 330 TSPFTIVFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTK 389

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
           T++   PY+AV  T   G L +  +  G  ++F WL NI GV+   +WL I++  IRF +
Sbjct: 390 TNRNKAPYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRK 449

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFL 536
            L+ +G    EL F+    P   ++   F+      QG++AF P ++ SSF + Y+ + +
Sbjct: 450 GLEAQG-KVHELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIV 507

Query: 537 FIAVWILFECIFRCRFIWKIEDVDIDSDR 565
           F A WI +  I R RF  K +D+D  +D+
Sbjct: 508 FPACWIFWWVIKRDRFK-KAKDMDFITDK 535

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  270 bits (689), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 171/515 (33%), Positives = 272/515 (52%), Gaps = 15/515 (2%)

Query: 76  EGEVQNAE---VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSL 132
           EG+  + E    +R+L  R                      + + GP   LIA+     +
Sbjct: 34  EGQAPSLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVV 93

Query: 133 AFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVI 192
              ++Q +  M T++PVT SF  F++RF+  + G + G+ Y+   A     E++ V  V+
Sbjct: 94  FIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVV 153

Query: 193 QFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA 252
           +FWT K+P AA ISI   L   +NLF V  +GE EF+++  KVI  IG + +   ++ G 
Sbjct: 154 EFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGG 213

Query: 253 GVTGPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
                V GF+ W NPGA+    ISK  + G+F G++S LI A + F G + +G  A EA 
Sbjct: 214 NPQHKVLGFKNWSNPGAFAE-YISKG-SAGKFHGFMSCLIFALYVFWGVDYLGNAASEAM 271

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY----VSTSPFIVAIQ 367
           NPRK +P + +KV  R++ FYIG  + +G+LVP+ND  + +A S        SP++ A++
Sbjct: 272 NPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMK 331

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
             G  VLPHI N +ILT+IISA NS++Y  SR+L  L+    APK L + +K GVP    
Sbjct: 332 TLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPK-LFKITKRGVPIYCC 390

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
            A  +   LAY+  S   + V  W LN+   A    ++FI IS+++F +  K + I    
Sbjct: 391 VAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKT 450

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFEC 546
           LP+ +  +P L ++S F++       G+  F    ++  SF+ +Y  I  FI ++   + 
Sbjct: 451 LPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKL 510

Query: 547 IFRCRFIWKIEDVDIDSDRRDI--EAIVWEDHEPK 579
             + RF+  +E +D+ S   ++  E   WE++ PK
Sbjct: 511 YKKTRFVKPVE-MDLFSGIAELAEEDAYWEENPPK 544

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/527 (31%), Positives = 258/527 (48%), Gaps = 29/527 (5%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G    + +KR LK RH                     LA  GP+  +I +   G+    
Sbjct: 70  DGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIG 129

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
               LGE+   +PV  +F  +S RFL P+       +Y   W     LE+      ++FW
Sbjct: 130 TIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFW 189

Query: 196 THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
           T  V    W+++F+ +I  +NL  V+ +GE EF  +S+KVI I GF+I C  ++ G G T
Sbjct: 190 TQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPT 249

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              VG RYW +PG    G          F G  + ++ A+++  G+E+  + +GE  +P 
Sbjct: 250 HQYVGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP- 297

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVL 374
           K +P AIK++ +RIL F++ SL  +G LVPY +  L   +S    SPF++A+     KV+
Sbjct: 298 KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVV 356

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFG 434
           PHI N VIL +I+S  NS I+  SR L  ++   L P       +GG P + + A ++FG
Sbjct: 357 PHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFG 416

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            LA++   +    VF WL+ I G+A    WL I++SH+RF  A+K +  S DEL F + +
Sbjct: 417 LLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSV 476

Query: 495 MPGLAYYSSFFMXXXXXXQGFTAFAP-------KFNGSSFLAAYISIFLFIAVWILFECI 547
               + Y+          Q + A  P       K    +F   Y+   + IA++   +C 
Sbjct: 477 GVWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCY 536

Query: 548 FRCRF-----IWKIEDVDIDSDRR--DIEAIVWEDHEPKTFW-DKFW 586
           FR        I K+ +VD+D+ R   DIE I  E  E K F  +K W
Sbjct: 537 FRITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAW 583

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  270 bits (690), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 170/535 (31%), Positives = 275/535 (51%), Gaps = 23/535 (4%)

Query: 63  DTFSMEE----NLQDEDEGEVQNA---EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLA 115
           D+F   E    N  D ++GEV +A   ++K+ +K RH                     L 
Sbjct: 43  DSFKRVEGEVRNSSDLEDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLH 102

Query: 116 NAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYW 174
             GP G LI Y F+  +++ + Q+ GEMA   P +  +F  +S  F+S  FG A  +++ 
Sbjct: 103 FGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFC 162

Query: 175 FSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIK 234
             W     LEL     V+++WT K+    ++ IF++ I  ++    + YGE EF   S K
Sbjct: 163 IQWTTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCK 222

Query: 235 VIAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINA 293
           V+ + GF+I    + CGA G  G +G +YW  PGA+  G         RF G    L+ A
Sbjct: 223 VLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTA 277

Query: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-E 352
            F++ G EL  ++  E  NPRK +P A  K V+RIL  Y+ +++ IG LVP++  KL   
Sbjct: 278 YFSYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGS 337

Query: 353 ATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412
            +S V  SP+++A+   G K++PHI NAVIL ++IS  NS +Y G R+L  L++   APK
Sbjct: 338 GSSGVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPK 397

Query: 413 FLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472
            L    + G P +A+   +VFG +A++  S   + +F WL  I+G++  F W  I +SH 
Sbjct: 398 ILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHF 457

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSF----- 527
           RF +A+K +G S + L +++      + Y+  F       Q + A  P  NG  F     
Sbjct: 458 RFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSL 517

Query: 528 LAAYISIFLFIAVWILFECIFRCRFIWK-IEDVDIDSDRR--DIEAIVWEDHEPK 579
             + +++ L++++ + +  + +   I   +  + +DS RR  D+E +  ED E K
Sbjct: 518 FKSCLALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQEDLEYK 572

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  270 bits (690), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 169/538 (31%), Positives = 273/538 (50%), Gaps = 25/538 (4%)

Query: 68  EENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           E++  +E   E  +  +K+ +K RH                     L+  GP   +I Y+
Sbjct: 50  EKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYI 109

Query: 128 FMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
            +  + + + Q+ GEMA   P +  SF  ++  F+S   G A  +++   W     LEL 
Sbjct: 110 LVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELI 169

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                IQ+W   +    WI IF+V +  +++F VK YGE EF   + K++ I GF+I+  
Sbjct: 170 TGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSI 229

Query: 247 CM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            +   GAG  G +G +YW+NPG++     + + + GRF      L+ A F++ GTEL  +
Sbjct: 230 VVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVL 284

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIV 364
           +  E ANPR++ P+A K+ ++RIL  Y+ +++ IG  VP+++ +L  A  S    SP+++
Sbjct: 285 SVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVL 344

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           A    G KV+PHI NAVIL  + S  NS++Y   R+   L++   APK L+   + G P 
Sbjct: 345 AASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPI 404

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           IA+ A AV G +A+   S+  ++VF WL  I  ++  F W  I +SHIRF  A+K +G  
Sbjct: 405 IALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKD 464

Query: 485 RDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILF 544
            +EL +KA      + +   F       Q + A +P   G+     +   +L   +W+ F
Sbjct: 465 LNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPP-GGTISAEGFFESYLAFPLWLFF 523

Query: 545 ECIFRC-----RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK------TFWDK---FW 586
              +        F+ K+ED+D+D+ RR  D E +  ED E K      +FW K   FW
Sbjct: 524 YFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKIRNSSFWIKMKYFW 581

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  269 bits (687), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 163/531 (30%), Positives = 262/531 (49%), Gaps = 28/531 (5%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           ++ +   +G    + +KR LK RH                     LA  GP+  +I +  
Sbjct: 48  DSFKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTI 107

Query: 129 MGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188
            GS        LGE+    PV  +F  +S RFL P+       +Y   W     LE+   
Sbjct: 108 AGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIAS 167

Query: 189 GQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
              IQ+W   +    W++IF+ +I  +NLF  + +GE EF  ++IK I I GF+I C  +
Sbjct: 168 AITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVL 227

Query: 249 VCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
           +CG G     +G +YW +PGA   G          F G +S L+ A+++  GTE+  + +
Sbjct: 228 ICGGGPDHEFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLAS 277

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367
           GE  +P K +P AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF++AI+
Sbjct: 278 GET-DP-KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIK 334

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
               K LP I NAVIL +I+S  NS I+  SR L  ++   L P+F     + G P   +
Sbjct: 335 LHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGI 394

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
              ++FG LA++  S+   +VF+WL+ I G+A    WL I++SHIRF  A+K +  + DE
Sbjct: 395 VTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDE 454

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-------KFNGSSFLAAYISIFLFIAV 540
           L F + +    + YS+         Q + +  P             F  +Y+   + + +
Sbjct: 455 LEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLI 514

Query: 541 WILFECIFRCRF-----IWKIEDVDIDSDRR--DIEAIVWEDHEPKTFWDK 584
           + + +  +R  F     +  ++D+D+++ R+  DI+ I  E  E K +  K
Sbjct: 515 FCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  269 bits (687), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 168/525 (32%), Positives = 261/525 (49%), Gaps = 32/525 (6%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFS 135
           +G    + +KR LK RH                     +A  GP+G ++ +   GS    
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
               LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 196 THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
              +    W++IF+V+I  +NLF V+ +GE EF  ++IK I + GF+I C  ++ G G  
Sbjct: 190 NSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPD 249

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              VG +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVL 374
           K +P AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF++AI+    KVL
Sbjct: 298 KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVL 356

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFG 434
           P I N VIL +++S  NS I+  SR L  ++   L P +     + G P + + A ++FG
Sbjct: 357 PSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            LA++  S     VF WL+ I G+A    WL I++SHIRF  A+K +G   DEL F + +
Sbjct: 417 LLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAV 476

Query: 495 MPGLAYYSSFFMXXXXXXQGFTAFAP-----------KFNGSSFLAAYISIFLFIAVWIL 543
               + YS+         Q + +  P           K    ++L A I +F+FIA  I 
Sbjct: 477 GIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIY 536

Query: 544 FECIFRCRFIWKI---EDVDIDSDRR--DIEAIVWEDHEPKTFWD 583
           ++C  +    W I   +D+D+++DR+  DIE +  E  E K + D
Sbjct: 537 YKC--QTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMYLD 579

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  269 bits (687), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 179/598 (29%), Positives = 288/598 (48%), Gaps = 39/598 (6%)

Query: 10  IEEKHMYNEPVTT---LLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTG---VNG-- 61
           +++KH  +E   T   +L     S     R S    D+   ++Y  RS   G     G  
Sbjct: 1   MDDKHSIDEFSVTHEYILPSSSKSMEGIGRSSSYKNDKTFIDVYSRRSSTEGPPVAKGTK 60

Query: 62  --QDTFSME-ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAG 118
             ++ F    ++ +  ++G    + +K+ LK RH                     LA  G
Sbjct: 61  PPRNIFQRAIDSFKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGG 120

Query: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           P+  +I +   GS        LGE+    PV  +F  +S RFL P+       +Y   W 
Sbjct: 121 PLAVIIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWF 180

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
               LE+      +Q+W   +    W++IF+V I  +NLF V+ +GE EF  ++IKVI I
Sbjct: 181 FVLPLEIISSAMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITI 240

Query: 239 IGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
            GF++ C  ++ G G     VG RYW NPG    G          F G +S ++ A+++ 
Sbjct: 241 SGFILLCIILIAGGGPDHVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSL 290

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV 357
            GTE+  + +GE  +P K +P AIK+V +RIL F++ SL  +G LVPY +  L   +S V
Sbjct: 291 GGTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-V 347

Query: 358 STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417
             SPF++AI+    KVLP I NAVIL +I+S  NS I+  SR L  ++   L P +    
Sbjct: 348 DNSPFVIAIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYI 407

Query: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477
            + G P + +   ++FG LA++  S    +VF+WL+ I G+A    WL I++SHIRF  A
Sbjct: 408 DRAGRPLVGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLA 467

Query: 478 LKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-------KFNGSSFLAA 530
           +K +G S +EL F + +    + YS+         Q + +  P       +     F  +
Sbjct: 468 MKAQGRSLNELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQS 527

Query: 531 YISIFLFIAVWILFECIF--RCRFIWK---IEDVDIDSDRR--DIEAIVWEDHEPKTF 581
           Y+   + + +WI  +  +  +   IW    + ++D+D  R+  D++ +  E HE K +
Sbjct: 528 YLCALIMVCIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHERKMY 585

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  270 bits (690), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 163/528 (30%), Positives = 273/528 (51%), Gaps = 23/528 (4%)

Query: 66  SMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIA 125
           S  + L  +  G+  +A +++ ++ RH                     L+ AGP   +I 
Sbjct: 102 SKSKQLHGQKNGD-DDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIG 160

Query: 126 YLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
           Y  MGS  + + Q+ GEMA  +  +  +F  +    +         ++Y   W     LE
Sbjct: 161 YGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLE 220

Query: 185 LSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L      I +WT KV    ++ IF+VLIT++N F  K Y E EF+  S KV+ + GF I 
Sbjct: 221 LVTASMTIDYWTTKVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFIL 280

Query: 245 CFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELV 303
              +   GAG  G +G +YW NPGA+       +K+  RF   +S+   AAF F  +E +
Sbjct: 281 AIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFI 335

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSYVSTSP 361
            I A E +NPR+ +P A K +++RIL  ++ S+  +G LVPY+  +L  +  ++    SP
Sbjct: 336 AIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASP 395

Query: 362 FIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGG 421
           +++A+ + G +V+PH  NAVIL +++S ANS  Y   RIL+ L++   APK+     + G
Sbjct: 396 YVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREG 455

Query: 422 VPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481
            P  A+  T +FG +A+   S   + VF WLL+I G++  F W  I +SHIRF +A+K +
Sbjct: 456 RPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQ 515

Query: 482 GISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLF 537
           G S DE+ FK+++    + Y++  M      + + + AP      +  +F   Y+++ + 
Sbjct: 516 GRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPIL 575

Query: 538 IAVWILFECIFRCRFIWKI----EDVDIDSDRR--DIEAIVWEDHEPK 579
           I ++  ++ I++    WK+    +D+D+ S R   D E +  E+ E K
Sbjct: 576 IVLYFGYK-IYKKD--WKLFIRAKDIDLISHRTIFDGELVRQEEEEYK 620

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  268 bits (686), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 163/528 (30%), Positives = 261/528 (49%), Gaps = 28/528 (5%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           ++ +  ++G      +K+ LK RH                     LA  GP+  +I +  
Sbjct: 63  DSFKPPEDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAV 122

Query: 129 MGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188
            GS        LGE+    PV  +F  ++ RFL P+       +Y   W     LE+   
Sbjct: 123 AGSQIVGTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIAS 182

Query: 189 GQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
              +Q+W   +    +++IF+ +I  +NLF  + +GE EF  +++K+I I GF+I C  +
Sbjct: 183 AITVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVL 242

Query: 249 VCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
           + G G     +G +YW NPG+   G          F G +S L+ A+++  GTE+  + +
Sbjct: 243 IAGGGPDHEYIGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLAS 292

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367
           GE  +P K +P AIK+V +RIL F++ SL  +G LVPY +P L   +S V  SPF++AI+
Sbjct: 293 GET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSS-VDNSPFVIAIK 349

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
               KVLP I NAVIL +I+S  NS I+  SR L  ++   L P +     + G P   +
Sbjct: 350 IHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGI 409

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
              ++FG LA++  S+   +VF+WL+ I G+A    WL I+I H+RF  A+K +  + DE
Sbjct: 410 IINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDE 469

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-------KFNGSSFLAAYISIFLFIAV 540
           L F + +    + YS          Q + A  P             F   Y+   + I +
Sbjct: 470 LEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVL 529

Query: 541 WILFECIFRCR--FIWK---IEDVDIDSDRR--DIEAIVWEDHEPKTF 581
           +I  +  +R      W+   ++D+D+D+DR+  DIE I  E HE K +
Sbjct: 530 FIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMY 577

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  268 bits (686), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 167/538 (31%), Positives = 267/538 (49%), Gaps = 26/538 (4%)

Query: 63  DTFSMEENLQDEDEGEVQNAE---------VKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           ++F   E       G++++A          +KR +K RH                     
Sbjct: 53  NSFKRAEKHSTPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKS 112

Query: 114 LANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYM 172
           L   GP G +I Y  +  +A+ + Q+ GEMA   P +  +F  +S + +S  FG A  ++
Sbjct: 113 LRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWL 172

Query: 173 YWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
           Y   W     LEL      I++W   +    +I+IF+V I  ++ F  + YGE EF    
Sbjct: 173 YCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGI 232

Query: 233 IKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
            KV+ IIGF+I    + CG AG    +G +YW +PGA+  G         +F G    L+
Sbjct: 233 CKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVG-----SGATKFKGVAYVLV 287

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL- 350
              F++ GTEL  +T  E +NPR+ +    K+ ++RIL  Y+ +++ IG LVP+   +L 
Sbjct: 288 TGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELM 347

Query: 351 -TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL 409
            +   S    SP+++A+   G K++PHI NAVIL  +IS  NS +Y G RIL  L++   
Sbjct: 348 GSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGY 407

Query: 410 APKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISI 469
           AP+FL+   + G P +A+ A +VFG LA++  S   + VF WL  I G++  F W  I +
Sbjct: 408 APRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIML 467

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNG 524
           SH+RF QA++Y      EL +KA      +     F       Q + + AP     K + 
Sbjct: 468 SHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDV 527

Query: 525 SSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
            SF  +Y++  L++ ++  +  +FR    I  ++D+D+D  R   D + +  ED E K
Sbjct: 528 LSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLEHK 585

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  268 bits (686), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 167/531 (31%), Positives = 271/531 (51%), Gaps = 18/531 (3%)

Query: 60  NGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
           +GQ     + +L+      +  + +K+ +K RH                     L  +GP
Sbjct: 77  DGQRAGFDDNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGP 136

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
              ++AY  +  + + + Q+ GEMA   P +  +F  +   F+S  FG A  +++   W 
Sbjct: 137 APLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWL 196

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
               LEL      I++W  K+    ++ IF+V +  ++ F V+ YGE EF   S K++ I
Sbjct: 197 TVLPLELITSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMI 256

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
            GF+I+   + CG AG  G +G +YW +PGA+     + + N GRF G    L+ A F++
Sbjct: 257 AGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSY 311

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLTEATSY 356
            GTEL  ++  E  NPRK+ P+A K+ ++RI+  Y+ +++ IG  VP+ ND  +    S 
Sbjct: 312 GGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSA 371

Query: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416
              SP+++A    G +++PH  NAVIL ++IS ANS++Y   R+L  L++   APKFL+ 
Sbjct: 372 THASPYVLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTY 431

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
             + G P  A+   ++FG + +   S   ++VF WL  I G++  F W  I +SH+RF Q
Sbjct: 432 IDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQ 491

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP---KFNGSSFLAAYIS 533
           A+K +G   +EL +KA      + Y  FF       Q + A AP   K    SF  +Y++
Sbjct: 492 AMKVQGRDLNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLA 551

Query: 534 ---IFLFIAVWILFECIFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
               F F   ++L+   F   F+  +E +D+D  RR  D E I  E  E K
Sbjct: 552 FPIFFTFYFGYMLWNKDF--TFLIPLESIDLDFHRRVYDPEFIRQEREEKK 600

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  268 bits (684), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 176/591 (29%), Positives = 289/591 (48%), Gaps = 32/591 (5%)

Query: 17  NEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDE 76
           N   +T   D+  + +  R    SL   K+   Y  R+F       +  ++ E   D ++
Sbjct: 26  NNLASTNDDDISIASSQNR----SLSHRKNTSYY--RNFIDSFKRAEHGNLNEKSADLED 79

Query: 77  GEVQ---NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLA 133
           G       + +K+ LK RH                     LA  GP   +I Y+ +  + 
Sbjct: 80  GTASIQSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIV 139

Query: 134 FSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVI 192
           + + Q+ GEMA   P +  +F  +   F+S ++G A  +++   W     LEL      I
Sbjct: 140 YFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTI 199

Query: 193 QFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG- 251
           Q+WT  +    ++ IF+V + +++   VK YGE EF     K++ I GF+I+   + CG 
Sbjct: 200 QYWT-DLNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGG 258

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
           AG  G +G +YW  PG++  G         RF G    L+   F++ GTEL  ++  E A
Sbjct: 259 AGNDGYIGGKYWHTPGSFAEG-----GPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQA 313

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIVAIQNSG 370
            PRK  P A KK ++RIL  Y+ +++ IG  VP+N  +L  A  S    SP+++A    G
Sbjct: 314 EPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHG 373

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFAT 430
            KV+PHI NAVIL +++S ANS++Y   R+L  L++   APK L+   + G P +A+   
Sbjct: 374 VKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLC 433

Query: 431 AVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
           AVFG +A++ +S   ++VF WL  I G++  F W  I  SH+RF  A+K +    DE+ +
Sbjct: 434 AVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGY 493

Query: 491 KAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLA-AYISIFLFIAVWILFECIFR 549
           KA      +++ S F       Q + A +P  +G +  A ++   +L + +W+ F  ++ 
Sbjct: 494 KATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYS 553

Query: 550 C-----RFIWKIEDVDIDSDRR--DIEAIVWEDHEPKT------FWDKFWN 587
                   +  +  +D+D+ RR  D + I  ED E K       FW + +N
Sbjct: 554 VYNKEWTILTDLSKIDLDAHRRIYDPDLIRQEDAENKEKLKNSPFWVRVYN 604

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  267 bits (682), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 172/543 (31%), Positives = 277/543 (51%), Gaps = 33/543 (6%)

Query: 72  QDEDEGEVQN-------AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALI 124
           QD + G + +        EV R LK RH                     L++ GP   LI
Sbjct: 45  QDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLI 104

Query: 125 AYLFMGSLAFSVTQSLGEMATFIPVT--SSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           +Y  M    +++   + EM   IP++  SS    +  +L+       G+  +++ ++   
Sbjct: 105 SYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVP 164

Query: 183 LELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFL 242
            E++    +I++WT     A +++IF +L T+++L PVK +GE EF V+ IK++ I+G +
Sbjct: 165 TEITACALLIEYWT-DANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLI 223

Query: 243 IYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF-QG 299
           +    +  G G      +GF YW  PGA+   ++    + G FL    ++I + F F   
Sbjct: 224 LVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLV--KGSTGAFLAVWKAIIKSGFAFVMI 281

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY--- 356
            E+    + EAA PRK +PRA ++ V+R+  FY+   L IG++V Y++  L EA S    
Sbjct: 282 PEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKA 341

Query: 357 -VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415
             + SPF++ IQ +G ++LPHI NA ILT+  S + S +Y  SR+L  L+    APKF S
Sbjct: 342 NAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFS 401

Query: 416 RTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475
           + +K GVPY +V AT++FG LAY+  S     VF WL NI  ++GF  W+F+SI+++RF 
Sbjct: 402 KVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFR 461

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISI 534
           +   Y  I+ D +P++ +    LAY S+ F        GF  F A  +N S F   Y++I
Sbjct: 462 KITDYLKIN-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTI 520

Query: 535 FLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHE--------PKTFWDKFW 586
             F+ V  +   I+     W   D+D+   R  +  I   D E        PK + ++ W
Sbjct: 521 G-FVGVLFIGSSIYYKE--WTFRDMDV-VGREIMPKIDQADQEEKEEYLPPPKNWVERVW 576

Query: 587 NVV 589
            +V
Sbjct: 577 RIV 579

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  266 bits (679), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 171/508 (33%), Positives = 274/508 (53%), Gaps = 24/508 (4%)

Query: 64  TFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 123
           +F+ +EN   E        ++ R LK R                      L   GP    
Sbjct: 33  SFTTDENYDPEAN---IREDLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLF 89

Query: 124 IAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFAL 183
           + Y  MG + +    +LGEM+T++P++ SF V++++F S +F  A  + YWF+ A++ A 
Sbjct: 90  MNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVAS 149

Query: 184 ELSVVGQVIQFWT---HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240
           +L+ +  V+ +W    H  P  A   IFW ++  +N+  V++YGE E+W+A +K+IAII 
Sbjct: 150 DLTALQLVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIII 209

Query: 241 FLIYCFCMVCGAGVTGP-VGFRYW-RNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           F I    +  G       +GF+ W R    +  GI           G+ S  ++A+F + 
Sbjct: 210 FFILSIVVNVGKNPQHEYIGFKNWTRGEAPFVDGI----------KGFASLFVSASFAYG 259

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVS 358
           GTE + +T GEA NP +  P+ +K V +RIL FY+GS  FI + +PY+ P L   +  + 
Sbjct: 260 GTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKS--IV 317

Query: 359 TSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP-KFLSRT 417
           TSPF +  Q +GTK      NAVI+T++ISA N  ++ GSRI++ +      P + +SRT
Sbjct: 318 TSPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRT 377

Query: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477
           ++  VPY++V  TA  GAL +  +  G   ++ WL NI GV+   AWL I I+ IRF + 
Sbjct: 378 NRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKG 437

Query: 478 LKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLF 537
           L+ +G +  EL +K    P   Y+   F+      QG++AFAP +N S+F + Y+ +F+F
Sbjct: 438 LEKQGKTH-ELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVSNFFSYYLELFVF 495

Query: 538 IAVWILFECIFRCRFIWKIEDVDIDSDR 565
              +I++  + R RF+ K ED+D  +DR
Sbjct: 496 PVCFIIWWLVKRDRFV-KYEDMDFTTDR 522

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  266 bits (679), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 175/544 (32%), Positives = 271/544 (49%), Gaps = 32/544 (5%)

Query: 35  RRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXX 94
           +R ++ +++   K++ P   F + V   D   ++E+  D    + Q   VKR LK RH  
Sbjct: 7   KRETVDIEETAKKDIKPY--FASNVEAVD---IDED-PDVSRYDPQTG-VKRALKNRHIS 59

Query: 95  XXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFT 154
                              L   GP+  L+ +  +G +AFSV +S+GEM T  P    FT
Sbjct: 60  LLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEMITLYPSGGGFT 119

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITI 214
             ++RF S A  A  GY Y   +    A E + +  ++QFW  +VPL  +I IFW    I
Sbjct: 120 TLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEI 179

Query: 215 MNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGI 273
             L  V  +GE E+W+A +K++ ++ + I+    + G     P  GF YW +PGA   G 
Sbjct: 180 FQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSPGALSHG- 238

Query: 274 ISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI 333
                    F G     +  +  + GTE V + A E+ NP K VP A+++ ++RIL  YI
Sbjct: 239 ---------FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVRQTLWRILVVYI 289

Query: 334 GSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSN 393
           G  +F G  VP++DP L+ +T  V  SP  +AI  +G     H+ NA IL T ISA N +
Sbjct: 290 GIAVFYGATVPFDDPNLSASTK-VLKSPIAIAISRAGWAGGAHLVNAFILITCISAINGS 348

Query: 394 IYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLL 453
           +Y+GSR L  L+   LAPK L+ T + GVP  A+      G ++ M  S G    + +++
Sbjct: 349 LYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGAANAYSYIV 408

Query: 454 NITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQ 513
           N++GV  F  W  IS +H+R  +A   +G S +ELP++A   P     S          Q
Sbjct: 409 NLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLSLAANIFLALIQ 468

Query: 514 GFTAFAPKFNGSSFLAAYI----SIFLFIAVWILFECIFRCRFIWKIE--DVDIDSDRR- 566
           G++ F P F+  +F+ AYI     I L+I +     C+F+      ++   +++D  RR 
Sbjct: 469 GWSYFVP-FDAGNFVDAYILLPVGILLYIGI-----CVFKSNHFRTVDLRSINLDEGRRK 522

Query: 567 DIEA 570
           D+EA
Sbjct: 523 DMEA 526

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  265 bits (677), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 171/528 (32%), Positives = 270/528 (51%), Gaps = 28/528 (5%)

Query: 43  DEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXX 102
           D   +E+Y + S         +  ++E   D D  +    ++ R L  RH          
Sbjct: 14  DSGKQEIYEVSS---------SLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGII 64

Query: 103 XXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                      L N GP    + Y  +G + +     LGEM+TF+P++ SF  ++++F S
Sbjct: 65  GTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGS 124

Query: 163 PAFGAANGYMYWFSWAITFALELSVVGQVIQFW---THKVPLAAWISIFWVLITIMNLFP 219
            +F  A  + YWF+ A++ A +L+ +  V+ +W    H  P      IFW  +  +N+  
Sbjct: 125 ESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIH 184

Query: 220 VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNK 278
           V+ YGE E+W+A +KVIAI+ F I    +  G       +GF+ W +  A  P +     
Sbjct: 185 VRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEA--PFV----- 237

Query: 279 NEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLF 338
               F G+ S  ++A F + GTE + +T GEA+NP +  P+ +K V +RIL FY+ S  F
Sbjct: 238 --NGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFF 295

Query: 339 IGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGS 398
           IG+ +PY+ P L+  T  V TSPF +  Q +GT+      NAVILT++ISA N  ++ GS
Sbjct: 296 IGMNIPYDYPGLS--TKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGS 353

Query: 399 RILFGLSKNKLAP-KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITG 457
           RI++ ++ +   P K + RT++   PY+AV  T   G L    +  G   ++ WL NI G
Sbjct: 354 RIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVG 413

Query: 458 VAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTA 517
           V+   AWL I I+ IRF + L+ +G   D L FK    P   Y+   F       QG+ A
Sbjct: 414 VSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQA 472

Query: 518 FAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDR 565
           F P ++ + F + Y+ +F+F  V+I++    R  F+ K ED+D  +DR
Sbjct: 473 FDP-WSVTDFFSVYLELFVFPFVYIIWWLWKRDWFV-KYEDMDFVTDR 518

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  265 bits (676), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 174/525 (33%), Positives = 282/525 (53%), Gaps = 22/525 (4%)

Query: 45  KSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXX 104
           K K +Y   S   GV+  ++    E+   + E  ++  ++KR+L  RH            
Sbjct: 33  KVKAVYSTHSVLEGVHSLESI---ESASFDPESNIRE-DLKRDLSPRHINMISIAGVIGT 88

Query: 105 XXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPA 164
                    L   GP    + Y   G + +     LGEM+T++P++ SF  ++++F S +
Sbjct: 89  GLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSES 148

Query: 165 FGAANGYMYWFSWAITFALELSVVGQVIQFW---THKVPLAAWISIFWVLITIMNLFPVK 221
           F  A  + YWF+ A++ A +L+ +  V+ +W    H  P  A   +FWV + ++N+  V+
Sbjct: 149 FACALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHHFPYWAASLLFWVFVLLLNVISVR 208

Query: 222 YYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNE 280
            YGE E+W+A +KVIAII F I    +  G       +GF  W +  A  P +       
Sbjct: 209 LYGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHKYIGFHNWNHGDA--PFV------- 259

Query: 281 GRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIG 340
             F G+ S  ++A+F + GTE + +T GEA NP +  P+ IK V +RIL FY+ S  FI 
Sbjct: 260 NGFKGFASLFVSASFAYGGTESITLTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIA 319

Query: 341 LLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRI 400
           + VPY+ P L  AT  V TSPF +  Q +G+K      NAVI+T++ISA N  ++ GSR+
Sbjct: 320 MNVPYDYPGL--ATKSVMTSPFTIVFQMAGSKGAGSFMNAVIMTSVISACNHALFAGSRV 377

Query: 401 LFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAG 460
           ++ +S +   PK++++T++   PY+AV  T   G L +  +  G   V+ WL NI GV+ 
Sbjct: 378 MYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGVSN 437

Query: 461 FFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP 520
             AWL I+I+ IRF + L+ +G +  EL FK    P   Y+   F+      QG++AF P
Sbjct: 438 QIAWLCIAITSIRFRRGLELQGKTH-ELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDP 496

Query: 521 KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDR 565
            ++ S+F + Y+ +F+F A ++++    R +FI K ED+D  +D+
Sbjct: 497 -WSTSNFFSVYLELFVFPACYLIWWLYKRDKFI-KYEDMDFVTDK 539

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  265 bits (676), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 154/521 (29%), Positives = 266/521 (51%), Gaps = 23/521 (4%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           + L+ E+E      ++K+ +K RH                     LA AGP G +I Y  
Sbjct: 55  KELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAV 114

Query: 129 MGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
              + + + Q+ GE+   +  +  ++T +S   + PA G +  ++Y   W     L+L  
Sbjct: 115 ASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVT 174

Query: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               +++WT+  P   ++++F+V+I ++N+F  K Y E EF     KV+ I GF+I    
Sbjct: 175 AAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIA 233

Query: 248 MVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGIT 306
           + CG AG +G +G +YW +PG++  G          F G       AAF++ G E++ +T
Sbjct: 234 INCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLT 283

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSYVSTSPFIV 364
           A E  NPRK++P A KKV++RIL  Y+ + + +  LVPYN  +L  +   S    SP ++
Sbjct: 284 ASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVI 343

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           A+ + G K++PHI NAVIL ++IS  NS++Y   R+L  LS+   APKFL+   + G P 
Sbjct: 344 AVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPL 403

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           I    T +   +A++  S   + +F WLL I+G++  F W  I +SH+RF  A+  +G+S
Sbjct: 404 ICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLS 463

Query: 485 RDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSSFLAAYISIFLFIA 539
             ++ +K++     ++++          Q + A AP     + N  +F   Y++  + + 
Sbjct: 464 LGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLG 523

Query: 540 VWILFECIFRC-RFIWKIEDVDIDSDRR--DIEAIVWEDHE 577
            +  ++   +  R      +VD+ S R   D E +  ED+E
Sbjct: 524 AYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEILRQEDYE 564

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  263 bits (673), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 171/540 (31%), Positives = 288/540 (53%), Gaps = 27/540 (5%)

Query: 39  LSLKDEKSKELYPLRSFPTGVN-----GQDTFSMEENLQDEDEGEVQ---NAEVKRELKQ 90
           +S+ +  +    P   +  G+N      +    ++ +L  E++ + +     +++R LK 
Sbjct: 1   MSMSESSASGYIPEEDYYKGLNTPPKKNEVVVELDPSLTTEEDYDPEANIREDLQRALKP 60

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVT 150
           RH                     L   GP    + Y  MG + +     LGEM+T++P++
Sbjct: 61  RHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPIS 120

Query: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKV---PLAAWISI 207
            SF  ++++F S +F  A  + YWF+ A++ A +++ +  V+ +W  +    P  A   +
Sbjct: 121 GSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGFPYWAASLL 180

Query: 208 FWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNP 266
           FW L+ ++N+  V++YGE E+W+A +KVIAII F I    +  G       +GF+ W + 
Sbjct: 181 FWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYIGFKNWNHG 240

Query: 267 GAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVF 326
            A  P +         F G+ S  ++A+F + GTE + +T GEAANP +  P+ +K V +
Sbjct: 241 EA--PFV-------DGFKGFASLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKTVFW 291

Query: 327 RILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTI 386
           RIL FY+GS  FI + +PY+ P L   T  V TSPF +  Q +GTK      NAVI+T++
Sbjct: 292 RILVFYVGSTFFIAMNIPYDYPGLD--TKSVVTSPFTLVFQMAGTKAAGSFMNAVIMTSV 349

Query: 387 ISAANSNIYVGSRILFGLSKNKLAP-KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGG 445
           ISA N  ++ GSR+++ +      P K +SRT++  VPY++V  T+  G L +  +  G 
Sbjct: 350 ISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGASFIGA 409

Query: 446 DKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFF 505
             V+ WL NI GV+   AWL I I+ IRF + L+ +G +  EL +K    P   Y+   F
Sbjct: 410 GTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELRYKNWTYPYGPYFLVIF 468

Query: 506 MXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDR 565
           +      QG++AF P ++ ++F + Y+ +F+F   +I++    R RF+ K+ED+D  +DR
Sbjct: 469 VTFIILVQGWSAFDP-WDVTNFFSYYLDLFVFPFCFIIWWLYKRDRFV-KLEDMDFVTDR 526

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  264 bits (675), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 170/579 (29%), Positives = 278/579 (48%), Gaps = 39/579 (6%)

Query: 31  QTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSME-----------ENLQDEDEGEV 79
           +   R+      + KSK+L    S  + ++ QD    E           ++ +   +G  
Sbjct: 15  EVKERKSKSEFVEYKSKQLTSSSSHNSNLSHQDDDDGEHSNRNIFQRCVDSFKPPLDGSF 74

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQS 139
             + +KR LK RH                     +A  GP+G ++ +   GS        
Sbjct: 75  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 134

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKV 199
           LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W   +
Sbjct: 135 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 194

Query: 200 PLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-V 258
               W++IF+ +I  +NLF  + +GE EF  +++K I + GF+I    ++CG G     +
Sbjct: 195 DPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFI 254

Query: 259 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 318
           G +YW +PG    G          F G ++ L+ A+++  G E+  + +GE  +P K +P
Sbjct: 255 GAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGET-DP-KGLP 302

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIF 378
            AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF++A++    KVLP I 
Sbjct: 303 GAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAMKLHHIKVLPTIV 361

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAY 438
           NAVIL +++S  NS I+  SR L  ++   L P +     + G P + + A ++FG LA+
Sbjct: 362 NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 421

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S     VF WL+ I G+A    WL I++SHIRF  A+K +G S DEL F + +    
Sbjct: 422 LVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWG 481

Query: 499 AYYSSFFMXXXXXXQGFTAFAP-----------KFNGSSFLAAYISIFLFIAVWILFEC- 546
           + YS+         Q + +  P           K    ++L A I +F+F+   I ++C 
Sbjct: 482 SAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQ 541

Query: 547 IFRCRFIWKIEDVDIDSDRR--DIEAIVWEDHEPKTFWD 583
             +   +  ++D+D+++DR+  DIE I  E  E K   D
Sbjct: 542 TGKWWGVKSLKDIDLETDRKDIDIEIIKQEIMERKMHLD 580

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 171/548 (31%), Positives = 282/548 (51%), Gaps = 25/548 (4%)

Query: 62  QDTFSMEENLQDEDEGEVQNAE-----VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLAN 116
           +  FS+     +  +G V + E     + R LK RH                     L+ 
Sbjct: 24  KTQFSIHSTGDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSI 83

Query: 117 AGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFS--QRFLSPAFGAANGYMYW 174
            GP   LIAY  M    +SV   + EM T IP+    T++S  + +++       G+  +
Sbjct: 84  CGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLF 143

Query: 175 FSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIK 234
           ++ A+    E++    ++Q+WT   P A +ISIF VL   + + PVK +GE EFWV+SIK
Sbjct: 144 YAQAMIAPAEVTACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIK 202

Query: 235 VIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLIN 292
           ++ I+G +I    +  G G      +GF YW+ PGA+ P ++      G+FL + +++I 
Sbjct: 203 ILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPYLV--EGGTGKFLAFWTAIIK 260

Query: 293 AAFTFQGT-ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           + F+F    E+V   A EA  PR+ +PRA K+ ++R+  FY+  +L +G++V Y++ +L 
Sbjct: 261 SGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLL 320

Query: 352 EATSYVSTS----PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
            A +   +S    PF++ I+ +G +VLPHI NA ILT+  S     +Y  SR L  ++  
Sbjct: 321 NAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACK 380

Query: 408 KLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
             AP+ L+  +K GVPY     T++F  LAY+  S     VF WL NI  ++GF +W+ +
Sbjct: 381 GDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLV 440

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-KFNGSS 526
           SI++IRF   +    ++ D +PF+      LAY +  F        GF  F    ++ S+
Sbjct: 441 SIAYIRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSN 499

Query: 527 FLAAYIS----IFLFIAVWILFECIFRCRFIWKIE-DVDIDSDRRDIEAIVWEDHEPKTF 581
           F AAYI+    + LF+   I ++  +RCR I +IE D+       + E   ++   P+ +
Sbjct: 500 FFAAYITLGFVLVLFVGSTIYYK-EWRCRDIAEIEQDILPKITLAEAEEYEYDIPVPRNW 558

Query: 582 WDKFWNVV 589
            +K W V+
Sbjct: 559 LEKIWMVI 566

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 173/530 (32%), Positives = 270/530 (50%), Gaps = 28/530 (5%)

Query: 67  MEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAY 126
           M ++ +   +G   +  +KR+LK RH                     LA  GP+  +I +
Sbjct: 53  MIDSFKPPLDGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGW 112

Query: 127 LFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
              GS        LGE+    PV  +F  +S R L P+       +Y   W     +EL 
Sbjct: 113 SIAGSQMVGTIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELI 172

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +QFWT KV    W++IF+V++  +NLF VK +GE EF  + +KVI IIGF+I   
Sbjct: 173 ASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSI 232

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            ++CG G     +G  YW +PGA   G          F G  S  + A+++  G+E+V +
Sbjct: 233 ILICGGGPDHRFIGTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCL 282

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVA 365
            + E  +P K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V+ SPF++A
Sbjct: 283 CSAET-DP-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIA 339

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
           I+ SG +VLP I NAVIL +I+S  NS I+  SR L  ++   L P+      + G P +
Sbjct: 340 IKLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLV 399

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
            +   ++FG LA++  S     VF+WL+ I G+A    WL I+ISHIRF  A+K +  S 
Sbjct: 400 GIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSL 459

Query: 486 DELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSS-----------FLAAYISI 534
           DEL FK+ +    + YS+         Q + +  P    +S           +L A + +
Sbjct: 460 DELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLV 519

Query: 535 FLFIAVWILFECIFRCRFIWK-IEDVDIDSDRR--DIEAIVWEDHEPKTF 581
           F+F+   I F+C     F +K + ++D+++DR+  DIE +  E  E + +
Sbjct: 520 FVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMY 569

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 164/531 (30%), Positives = 264/531 (49%), Gaps = 23/531 (4%)

Query: 60  NGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
           NG D      ++Q +D        +K+ +K RH                     L  AGP
Sbjct: 60  NGIDLEDGTNSIQSDDN-------LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGP 112

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
              +I Y  +  + + V Q+ GEMA   P +   F  ++  F+S  FG A  +++   W 
Sbjct: 113 ASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWL 172

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
               LEL      I++W  K+    ++ I +V +  ++ F V+ YGE EF   S K++ I
Sbjct: 173 TVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMI 232

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
            GF+I    + CG AGV G +G +YWR+PGA+     + +    RF G    L+ A F++
Sbjct: 233 GGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSY 287

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SY 356
            G EL  ++  E  NPR++ P A K+ ++RIL  Y+ +++ IG  VP+N  +L  A  S 
Sbjct: 288 GGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSA 347

Query: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416
              SP+++A+   G KV+PHI NAVIL ++ S ANS +Y   R+L  L++   APK+ + 
Sbjct: 348 THASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNY 407

Query: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476
             + G P  A+   ++FG +A+   S   + +F WL  I G++  F W  I +SH+RF  
Sbjct: 408 VDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRL 467

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLA-AYISIF 535
           A+K +G S +EL + +      + Y  FF       Q + A +P  +   + A A+   +
Sbjct: 468 AMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESY 527

Query: 536 LFIAVWILFECIFRC-----RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           L   VW+ F   +        F+  ++ +D+D+ RR  D E +  ED E K
Sbjct: 528 LAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  263 bits (672), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 176/557 (31%), Positives = 283/557 (50%), Gaps = 21/557 (3%)

Query: 33  HRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRH 92
           HR   S    +E+      + S    V+G+D     E L  +D    ++  +K+ +K RH
Sbjct: 42  HRFVDSFKRPEEEYNGGDGIHSTHERVSGEDF----ERLAPDDSS--KHKTLKQNIKPRH 95

Query: 93  XXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTS 151
                                L N GP   LI Y  + ++ + V QS  E+A  +  ++ 
Sbjct: 96  VLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSG 155

Query: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVL 211
            F  +    +  AF  +  ++Y   W     LEL      I++W   +   A++ IF+V+
Sbjct: 156 GFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVV 215

Query: 212 ITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWG 270
           + ++N      Y E EF+  + KV+ +IGF I    + CG AG  G +G  YW +PGA+ 
Sbjct: 216 LIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAF- 274

Query: 271 PGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330
                 N    RF G V+ L+NAAF + G E   +TA E  NP+K++  A KK+V+RI+ 
Sbjct: 275 ----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIG 330

Query: 331 FYIGSLLFIGLLVPYNDPKLTEATSYVS-TSPFIVAIQNSGTKVLPHIFNAVILTTIISA 389
            Y+ +   +G LVPYN P+L  + S  +  SPF++AI + G KV+PHI NAVIL +++S 
Sbjct: 331 IYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSV 390

Query: 390 ANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVF 449
           ANS +Y  SRIL  LS+   APK  +   + G P   +  + VFG L ++  S   + VF
Sbjct: 391 ANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVF 450

Query: 450 EWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXX 509
            WLL I+G++  F W  IS+SH+RF +++  +G S DEL +++      AYY+   +   
Sbjct: 451 TWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLI 510

Query: 510 XXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIEDVDIDSD 564
              Q + A +P    K + ++F   Y+++ + I +++ ++  +R  R I    +VD+ S 
Sbjct: 511 LIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSH 570

Query: 565 RR--DIEAIVWEDHEPK 579
           R+  D E +  E  E K
Sbjct: 571 RKIFDAEIMQSEQLEEK 587

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  261 bits (667), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 169/524 (32%), Positives = 259/524 (49%), Gaps = 36/524 (6%)

Query: 69  ENLQDEDEGEVQ-NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
           + L+ +   E   ++ VKR LK RH                     L   GP+  L+ + 
Sbjct: 26  QRLETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFG 85

Query: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
            +G + FS+ +S+GE+ T  P    F   ++RF S    A +GY Y   +    A E + 
Sbjct: 86  IIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNT 145

Query: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
           +  ++QFW  +VP+  +  IFW    +  L  V  +GE E+W+A  K++ ++ F I+   
Sbjct: 146 ISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIV 205

Query: 248 MVCGAGVTG--PVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            + G G+ G  P+GF+YW+NPGA   G          F G     +  +  + GTE V +
Sbjct: 206 YMSG-GIPGKPPIGFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTESVAL 254

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVA 365
            A E+ NPRK VP A+++  +RIL  Y+G   F G+ VPYNDP L   T  +  SP  +A
Sbjct: 255 AATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSLK-SPISIA 313

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
           +  +G     H+ NA IL T ISA NS++Y+GSR L  L+   LAP+ L+ T K GVP  
Sbjct: 314 LSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVP 373

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
           A+      G ++ M  S G    + +++N++GV  F  W  ISI+H+RF +A   +G S 
Sbjct: 374 ALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSL 433

Query: 486 DELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFE 545
            ELP++A   P    +S          QG+T+  P F    F+ AYI   L  A  +L+ 
Sbjct: 434 SELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYI---LLPAAGLLYV 489

Query: 546 CIFRCRFIWK--------IEDVDI-DSDRRDIEAIVWEDHEPKT 580
            I      WK        I  +++ +  RRD++    ED + +T
Sbjct: 490 GI----NFWKNRNFKTVNIHGINLEEGQRRDLD----EDSDDET 525

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  261 bits (667), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 164/565 (29%), Positives = 277/565 (49%), Gaps = 32/565 (5%)

Query: 18  EPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEG 77
           E   + L +  A Q   ++ S  L  E+S+ L   R+   G+  +      ++ +   +G
Sbjct: 8   EKAASELSNTSAVQRVLKKRSSVL--EESRLLEESRTNKRGLVRRCI----DSFKPPVDG 61

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVT 137
                 +KR LK RH                     LA  GP+  LI +   G+      
Sbjct: 62  SFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTI 121

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTH 197
             LGE+    PV  +F  +S RFL P+       +Y   W     LE+      ++FWT 
Sbjct: 122 HGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTT 181

Query: 198 KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP 257
            V    W+++F+ LI  +NLF V+++G+ +F  + IK++ I GF+I C  ++ G G T  
Sbjct: 182 SVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHE 241

Query: 258 -VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
            +G RYW +PGA   G          F G  + ++ A+++  G+E+  + +GE  +P K 
Sbjct: 242 FIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KE 289

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPH 376
           +P AIK++ +RI+ F++ SL  +G LVPY + +L   ++ V+ SPF++AI+    +VLPH
Sbjct: 290 IPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSN-VNNSPFVIAIKMHNIRVLPH 348

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
           I N VIL +I+S  NS I+  SR L  ++   L P+      + G P   +   ++FG L
Sbjct: 349 IINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLL 408

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S+    VF WL+ + G+A    WL I++SHIRF  A+K +G S DEL F + +  
Sbjct: 409 AFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGM 468

Query: 497 GLAYYSSFFMXXXXXXQGFTAF-------APKFNGSSFLAAYISIFLFIAVWILFECIFR 549
             + YS          Q + +         P+    +F   Y+   + + +++  +  +R
Sbjct: 469 WGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYR 528

Query: 550 CRF--IWKI---EDVDIDSDRRDIE 569
                 WKI    ++D++S R++I+
Sbjct: 529 STTGQWWKILPLAEIDLESGRKNID 553

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  261 bits (667), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 171/563 (30%), Positives = 277/563 (49%), Gaps = 27/563 (4%)

Query: 39  LSLKDEKSKELYPLRS----------FPTGVNGQDTFSMEENLQDEDEGEVQNAE-VKRE 87
           LS   EKS  ++PL S          F       +    + +L+D  +    + + +K+ 
Sbjct: 22  LSEITEKSTPVFPLDSTLKRRTHFTKFVDSFRRAEDKHADSDLEDGSKSITSDDDHMKKA 81

Query: 88  LKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFI 147
           +K RH                     LA AGP   ++ Y  +  + + + Q+ GEMA   
Sbjct: 82  MKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTY 141

Query: 148 P-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWIS 206
           P + +SF  ++  F+S  FG A  +++   W     LEL      I++W   +    +I 
Sbjct: 142 PTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIV 201

Query: 207 IFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRN 265
           IF+V +  ++ F VK YGE EF   S K++ I GF+I    + CG AG  G +G +YW N
Sbjct: 202 IFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWIN 261

Query: 266 PGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325
           PGA+     +      RF G    L+   F++ GTEL  ++  E  NPRK+ P A K+ +
Sbjct: 262 PGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSI 316

Query: 326 FRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFIVAIQNSGTKVLPHIFNAVILT 384
           +RIL  Y+ +++ IG  VP++  +L  A  S    SP+++A    G KV+PH  NAVIL 
Sbjct: 317 YRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHFINAVILI 376

Query: 385 TIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTG 444
           +++S ANS +Y   R++  L++   APK+ +   + G P  A+    +FG + ++  S  
Sbjct: 377 SVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQ 436

Query: 445 GDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSF 504
            ++ F WL  I G++  F W  I ISHIRF  A+K +G S +EL ++A      + YS F
Sbjct: 437 EEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVF 496

Query: 505 FMXXXXXXQGFTAFAP-----KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIED 558
           F       Q + A +P     K++   F  +Y++  L++  +  +    R   F+  ++ 
Sbjct: 497 FNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDK 556

Query: 559 VDIDSDRR--DIEAIVWEDHEPK 579
           +D+D  RR  D E +  ED E K
Sbjct: 557 IDLDFHRRIYDPELLRQEDAETK 579

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  261 bits (668), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 164/523 (31%), Positives = 269/523 (51%), Gaps = 20/523 (3%)

Query: 72  QDEDEGE-VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMG 130
           QD+ EG+ V NA +K+ LK RH                     L+NAGP   LI Y  + 
Sbjct: 86  QDDPEGDMVSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVS 145

Query: 131 SLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVG 189
              + + Q+ GE+A   P +  SF  ++ + +S  FG A  ++++  W   F +EL  + 
Sbjct: 146 VNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMT 205

Query: 190 QVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMV 249
             ++FWT +V    ++ IF+V + I++   V+ YGE EF++   KV+ +IGF+I+  C+ 
Sbjct: 206 FAVRFWTTRVDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVA 265

Query: 250 CG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308
            G AG +G +G +YW +PGA+       +  EGRF G    L++A F++ GTEL  ++  
Sbjct: 266 AGGAGDSGYIGAKYWHDPGAF-----VSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVN 320

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA----TSYVSTSPFIV 364
           E  NPRKT+P A K  ++RI+  Y+ +++ +G  VP N P+L  +        S SP+++
Sbjct: 321 EQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVL 380

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           A      +VLPH  NAV++  ++S +NS +Y   R++  L++    PK+     + G P 
Sbjct: 381 AASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPT 440

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
            A+    + G +A+  +S   + +F WL  I G++  F W  I +SH+RF  A+K +G  
Sbjct: 441 RALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKD 500

Query: 485 RDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGSSFLAAYISIFLFIAVWIL 543
            +EL +K+      + Y  FF       Q + A  AP   G    + +   +L + +W+ 
Sbjct: 501 INELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLT 560

Query: 544 FECIFRC-----RFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
           F   F        F+  +  VD+DS RR  D E +  ED E K
Sbjct: 561 FYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPELLRQEDEEHK 603

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  260 bits (664), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 143/425 (33%), Positives = 219/425 (51%), Gaps = 14/425 (3%)

Query: 67  MEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAY 126
           M ++ +   +G   +  +K+ LK RH                     LA  GP+  +I +
Sbjct: 56  MVDSFKPPLDGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGW 115

Query: 127 LFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
              G+        LGE+    PV  +F  +  RFL P+       +Y   W     LE+ 
Sbjct: 116 TVAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEII 175

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +++W   VP  AW++IF+  I ++NL  V+ +GE EF  + IKV+ IIGF+I C 
Sbjct: 176 AAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCV 235

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            ++CG G     VG +YW +PG    G          F G  +  + A+++  GTE+  +
Sbjct: 236 VLICGGGPKHEFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACL 285

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVA 365
            +GE  +P K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF++A
Sbjct: 286 ASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIA 342

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
           I+  G K LP + NAVIL +++S  NS I+  SR L  ++   L P+      + G P +
Sbjct: 343 IRLHGIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLV 402

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
            +     FG LA++  S+  D VF WL+ I G+A    WL I++SHIRF  A+K +G+S 
Sbjct: 403 GILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSL 462

Query: 486 DELPF 490
           DEL F
Sbjct: 463 DELEF 467

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  262 bits (670), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 162/498 (32%), Positives = 268/498 (53%), Gaps = 16/498 (3%)

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVT 137
           E ++ E+K+ +K RH                     L  AGP G L+ +  MG+  + + 
Sbjct: 143 ENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCII 202

Query: 138 QSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT 196
           Q++GEMA  +  +   F  +    + PAFG +  ++Y   W     LEL      I++WT
Sbjct: 203 QAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWT 262

Query: 197 HKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
            KV    ++ IF+VLI  +N+      Y E EF   S K++ +IGF I    ++CG    
Sbjct: 263 TKVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGN 322

Query: 256 -GPVGFRYWRNPGAW-GPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
            G +G +YW  PGA+ G   I       RF G +++L+NAAF F  +E +G+TA E +NP
Sbjct: 323 DGYIGGKYWHEPGAFRGEHAID------RFKGVMATLVNAAFAFGMSEFIGVTASEQSNP 376

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTEATSYVSTSPFIVAIQNSGTK 372
           RK +P A KK+++RI+  ++ S+  +G LVPY+ D  L  +   V  SP+++A+   G K
Sbjct: 377 RKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVK 436

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAV 432
           V+PH  NAVIL +++S ANS  Y  SR+L  L++   APK      + G P + +   ++
Sbjct: 437 VVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASL 496

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
           FG +A+  TS   D+VF WLL I+G++  F W+ I +SH+RF +A+  +G S  EL F++
Sbjct: 497 FGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRS 556

Query: 493 KLMPGLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIF 548
           ++    + Y++  M      Q + A AP    K +  +F   Y+++ + +A++  ++   
Sbjct: 557 QVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYT 616

Query: 549 RCRFIW-KIEDVDIDSDR 565
           +   I+ + +D+D+ S R
Sbjct: 617 KNWTIFIRAKDIDLVSHR 634

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  260 bits (664), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 157/524 (29%), Positives = 263/524 (50%), Gaps = 24/524 (4%)

Query: 62  QDTFSMEENLQD--EDEGEVQNA--------EVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
           +D+F   + ++D  E EG+ + A        ++K  +K RH                   
Sbjct: 39  KDSFKRADVVEDVHEKEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASG 98

Query: 112 XPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANG 170
             L   GP G LI YL   ++ + V Q+  E+   +  +  ++  +    +   FG A  
Sbjct: 99  KALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVA 158

Query: 171 YMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWV 230
            +Y   WAI   LEL      I++WT  V    +++IF++ I  ++ F  + Y E EF  
Sbjct: 159 LVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIF 218

Query: 231 ASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSL 290
            ++KV+ + GF+I    + CGA   G +G +YW NPG +  G  S N  +G    WV S 
Sbjct: 219 NTLKVLLMAGFIIMGISLNCGASKLGYIGAKYWSNPGTFA-GERSINHLKGICSVWVQS- 276

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
              AF + G+E + +TA E ANPR++VP A K+ ++R++  ++  +  I  LVPY   +L
Sbjct: 277 ---AFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQL 333

Query: 351 --TEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNK 408
             +   S    SPF++A    G K++PHI NA+ILT++IS  NS +Y   RIL  L++N 
Sbjct: 334 LSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENG 393

Query: 409 LAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFIS 468
           L PK  +   + G P   +    VFG L+++  S   + VF WL  I G++  F W  I+
Sbjct: 394 LCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIA 453

Query: 469 ISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFN 523
           +SHIRF  A+K +G S  EL + +      +YY+ FF       Q + A AP     + +
Sbjct: 454 LSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELD 513

Query: 524 GSSFLAAYISIFLFIAVWILFECIFR-CRFIWKIEDVDIDSDRR 566
             SF   Y++  + +  ++ ++  +R  + +  ++ +D+++ R+
Sbjct: 514 AESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQ 557

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  259 bits (661), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 174/529 (32%), Positives = 275/529 (51%), Gaps = 23/529 (4%)

Query: 42  KDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXX 101
           KD+ + E Y   +     +  +  S+E    D +  E     + R L  RH         
Sbjct: 9   KDKVTPEQYISIADENYSSDLEQPSLEGLTTDNNVRE----HLNRSLSPRHVNMIAIAGV 64

Query: 102 XXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFL 161
                       L   GP   LI Y  +G + ++   SLGEM+T++P++ SF  F+++F 
Sbjct: 65  IGTGLYLGTGRALHLGGPASLLINYSIIGLIVYATLLSLGEMSTYMPISGSFCSFAKKFG 124

Query: 162 SPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-THKVPLAAWIS--IFWVLITIMNLF 218
           S +F  A    YWF+ A++ A +L+ +  V+ +W T +     WI+  IFWV +  +N+ 
Sbjct: 125 SESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKTSESGFPYWIASLIFWVFLLFLNVI 184

Query: 219 PVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKN 277
            VK YGE E+W+A +KVIAII F I       G       +GFR W    A  P +    
Sbjct: 185 HVKIYGEAEYWLAMLKVIAIIIFFILSIVANVGHNEQHEYIGFRNWTRGDA--PFV---- 238

Query: 278 KNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
                F G+ +  ++A+F + GTE + +T+GE  NP +  P+ IK V +RIL FYI ++ 
Sbjct: 239 ---NGFRGFATLFVSASFAYGGTESITLTSGETKNPVRNTPKVIKTVFWRILIFYIFTVF 295

Query: 338 FIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           FIG+ VPY+ P L+E +  V TSPF +  Q  G+K      NAVILT+++SA N  ++ G
Sbjct: 296 FIGMNVPYDYPNLSEKS--VMTSPFTIVFQMVGSKAAGSFMNAVILTSVVSACNHALFAG 353

Query: 398 SRILFGLS-KNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNIT 456
           SRILF L  +    PK ++RT+   VPY+AV  T   G L +  +  G   ++ WL N+ 
Sbjct: 354 SRILFNLGLEGYFFPKLVTRTNWYQVPYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQNLV 413

Query: 457 GVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFT 516
           GV+   AWL I +  IRF + L  +G +  EL F     P   Y+    +      QG++
Sbjct: 414 GVSNQIAWLSIGVISIRFRRGLSRQGKTH-ELKFVNWTYPYGPYFVIISVSFIILVQGWS 472

Query: 517 AFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDR 565
           + +P  + +SF + Y+ +F+F+A W+++    R  F+ + +D+D  +D+
Sbjct: 473 SSSP-MDVTSFFSYYVELFIFLACWLVWWAFKRDGFV-REKDMDFVTDK 519

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  258 bits (659), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 156/461 (33%), Positives = 232/461 (50%), Gaps = 26/461 (5%)

Query: 34  RRRGSLSLKDEK---SKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQ 90
           ++ G+   +D++   +K+ Y    F   +   D+F   EN      G      +KR LK 
Sbjct: 33  KKHGAYHYEDDQVQPNKKAYKRNLFHRCI---DSFKPPEN------GSFDPDSLKRSLKS 83

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVT 150
           RH                     LA  GP+  +I +L  G+        LGE+    PV 
Sbjct: 84  RHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGEITVRFPVV 143

Query: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWV 210
            +F  +  RFL P+       +Y   W     LE+      IQFW   +    W++IF+V
Sbjct: 144 GAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPVVWVAIFYV 203

Query: 211 LITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAW 269
            I  +NLF V+ +GE EF  +SIKVI I GF+I C  ++ G G T   VG RYW +PGA 
Sbjct: 204 TIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVGARYWHDPGAL 263

Query: 270 GPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRIL 329
             G          F G  S  + A+++  G+E+  + +GE  +P K +P AIK+V +RI+
Sbjct: 264 AHG----------FKGVASVFVTASYSLGGSEMACLASGET-DP-KELPSAIKQVFWRII 311

Query: 330 TFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISA 389
            F++ SL  +G LVPY +  L   +S V+ SPF++A      KVLP I NAVIL +I+S 
Sbjct: 312 FFFLVSLTLVGFLVPYTNQNLLGGSS-VNNSPFVIACNLYHIKVLPSIINAVILVSIMSV 370

Query: 390 ANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVF 449
            NS I+  SR L  ++   L P+      + G P + +   ++FG LA++  S+   +VF
Sbjct: 371 GNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSSSMSEVF 430

Query: 450 EWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
            WL+ I G+A    WL I++SHIRF  A+K +  + DEL F
Sbjct: 431 NWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEF 471

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  258 bits (660), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 167/575 (29%), Positives = 286/575 (49%), Gaps = 39/575 (6%)

Query: 39  LSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAE-------VKRELKQR 91
           L L  + S  L P  S    +  Q   S+ + + D D+G   + E       + R LK R
Sbjct: 5   LELSQQASISLSPYIS--NRIKEQAFSSVNDVIGDSDQGSYSDIENFKPPQKIVRGLKTR 62

Query: 92  HXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTS 151
           H                     L+  GP   LIAY+ +    +S+   + EM   IP+  
Sbjct: 63  HIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPG 122

Query: 152 SFTVFS--QRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFW 209
             +++S  + +L+       G+  +++ A+    E++    ++Q+WT     A +ISIF 
Sbjct: 123 EASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTDANS-AIFISIFI 181

Query: 210 VLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPG 267
           V+  ++ + PVK +GE EFWV+SIK++ I+G +I    +  G G      +GF YW+NPG
Sbjct: 182 VVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPG 241

Query: 268 AWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT-ELVGITAGEAANPRKTVPRAIKKVVF 326
           A+ P +     N GRFL   +++I + F+F    E V   + E   PR+ +P+A ++ ++
Sbjct: 242 AFNPHL--AEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIY 299

Query: 327 RILTFYIGSLLFIGLLVPYNDPKLTEAT----SYVSTSPFIVAIQNSGTKVLPHIFNAVI 382
           R+  FYI   L +G++V +N+ +L  A     S  + SPF++ IQ +G K+LPHI NA I
Sbjct: 300 RLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIINACI 359

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETS 442
           LT+  S     +Y  SR L+ ++    APK  ++ ++ G PY +    ++F  LAY+  S
Sbjct: 360 LTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCS 419

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYS 502
                VF WL NI  ++GF +W+F+S+++IRF + +    ++ D +PF+      LAY +
Sbjct: 420 KSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLAYLT 478

Query: 503 SFFMXXXXXXQGFTAFAP-KFNGSSFLAAYISIFLFIAVWILFECIFRC---RFIWKIE- 557
             F        G+  F    +N S F A+Y++I   I ++++    ++    R   +IE 
Sbjct: 479 CGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQWTFRDFKEIEV 538

Query: 558 ------DVDIDSDRRDIEAIVWEDHEPKTFWDKFW 586
                 D+  + +R D+  +      P+ F +K W
Sbjct: 539 EILPKIDIADEEERNDVIPV------PRNFMEKVW 567

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  259 bits (661), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 152/520 (29%), Positives = 265/520 (50%), Gaps = 17/520 (3%)

Query: 72  QDEDEGEVQNAE-VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMG 130
           +D D G  +  + +K  +K RH                     L   GP G +I Y+   
Sbjct: 55  KDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTS 114

Query: 131 SLAFSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVG 189
           ++ + V Q+  E+   +  +  ++  +    +   FG A   +Y   WA    LEL    
Sbjct: 115 TMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTAS 174

Query: 190 QVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMV 249
             +++WT  V    +++IF+V +  ++ F  + Y E EF   S+KV+ + GF+I    + 
Sbjct: 175 MTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLT 234

Query: 250 CGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGE 309
            GA   G +G +YW +PGA+G      ++   RF G  S  + AAF + G+E + +TA E
Sbjct: 235 AGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAE 289

Query: 310 AANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSYVSTSPFIVAIQ 367
            ANPR++VP+A K+ ++R++  ++  ++ IG LVP+N  +L   E  S    SPF++A  
Sbjct: 290 QANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAA 349

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427
             G +V+PHI N +ILT++IS  NS +Y   RIL  L+++ + PK  +   + G P + +
Sbjct: 350 LHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTL 409

Query: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
              ++FG +A++  S   + VF WL  I G++  F W  I++SH+RF +A++ +G S  E
Sbjct: 410 IFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGE 469

Query: 488 LPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSSFLAAYISIFLFIAVWI 542
           L ++A      +YY+ FF       Q + A AP     + +   F   Y++  + +  ++
Sbjct: 470 LGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYL 529

Query: 543 LFECIFR-CRFIWKIEDVDIDSDRR--DIEAIVWEDHEPK 579
            ++   R  R +    +VD+ S R+  D E ++ E+ E K
Sbjct: 530 GYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  258 bits (660), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 164/553 (29%), Positives = 275/553 (49%), Gaps = 38/553 (6%)

Query: 60  NGQDTFSMEENLQDEDEG----EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLA 115
           N +  + +++ +  ED      E Q  +V R+LK RH                     L+
Sbjct: 39  NEKSAYQVDQIIDVEDASMELIEGQEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALS 98

Query: 116 NAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQR--FLSPAFGAANGYMY 173
             GP   LI+Y+ M    + +   L EM   +P++   ++F+    +L+       G   
Sbjct: 99  VCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINL 158

Query: 174 WFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASI 233
           +++ ++    E++    +IQ+WT     A +ISIF V+   + + PV ++GE EFWV+ I
Sbjct: 159 FYAMSMIAPSEITATAILIQYWTDANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSII 217

Query: 234 KVIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLI 291
           K+  I G +I    +  G        +GF YW++PGA+ P ++  N   G+FL   +++I
Sbjct: 218 KLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPGNT--GKFLACWTAII 275

Query: 292 NAAFTFQGT-ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
            + F++    E+V   A EA +PR+ +PR  ++ V+R+  FY+   L IG++V Y++ +L
Sbjct: 276 KSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRL 335

Query: 351 TEAT----SYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSK 406
             A     S  + SPF++ IQ  G +VLPHI NA ILT+  S   S +Y  SR+L  ++ 
Sbjct: 336 LNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAV 395

Query: 407 NKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLF 466
           N   PK  + T++ G PY +  A +VF  LAY+  S     VF WL NI  ++GF  W+ 
Sbjct: 396 NGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWML 455

Query: 467 ISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAF-APKFNGS 525
           + + ++RF + +++  ++ D++PF+ + M  LAY S  F        G+  F A  +N S
Sbjct: 456 VCVVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVS 514

Query: 526 SFLAAYISI----FLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHE---- 577
            F A Y ++     L+I   I ++ I       K+ D+D +     I  I   D E    
Sbjct: 515 DFFACYTTLGLAAVLYIGAAIYYKTI-------KLRDLD-EVAAEIIPKIAMADEEEKGE 566

Query: 578 ----PKTFWDKFW 586
               PK + +K W
Sbjct: 567 VPIVPKNWLEKVW 579

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/539 (30%), Positives = 273/539 (50%), Gaps = 22/539 (4%)

Query: 60  NGQDTFSMEENLQDEDEGE-VQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLAN 116
           +G +  S+E   +D + G  VQ  +  +++ ++ RH                     +A 
Sbjct: 14  SGAEADSVESVAEDVEAGAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIAC 73

Query: 117 AGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWF 175
           AG  G LI Y  +G +     QS+GE+    P ++  F  + +RF+ P+ G +  +++  
Sbjct: 74  AGIGGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCL 133

Query: 176 SWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKV 235
            W I   LEL      I++W   +  + ++S+F+ LI ++N F    Y E EF   S+KV
Sbjct: 134 QWMIVLPLELVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKV 193

Query: 236 IAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAA 294
           + IIGF+I    +  G  G +G +GFRY  +PG +       NKN         +L+NAA
Sbjct: 194 VVIIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMF-------NKNYNIIKATAGTLVNAA 246

Query: 295 FTFQGTELVGITAGEAA--NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT- 351
           F+  G E + ++A E    N  K++ RA  +V  RI  FY+ S+  +GLLVP+N P L  
Sbjct: 247 FSCGGVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMG 306

Query: 352 EATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
             ++ + +SP++ A+  +G  V+PHI NAVIL  +IS ANS +Y  SR L  L++   AP
Sbjct: 307 SGSNMIHSSPYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAP 366

Query: 412 KFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           K+ ++ +K G P   +F +A+FG ++++      + +F WLL+I+G++  F W  I I+H
Sbjct: 367 KYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAH 426

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-KFNGSSFLAA 530
           IRF  A+K RG S + L +K+      +Y ++         Q + +  P + NG   +  
Sbjct: 427 IRFRDAIKSRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQ 486

Query: 531 YISIFLFIAVWILFECIFRC-----RFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDK 584
           +   ++ + V +LF    +        + +  +VDI +D RDI     ED + K     
Sbjct: 487 FFQNYMAVPVALLFYIGHKVYTKNWSLLIRASNVDITTD-RDIYCPTIEDPKIKVLMQN 544

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  259 bits (661), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 178/604 (29%), Positives = 292/604 (48%), Gaps = 50/604 (8%)

Query: 2   TNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNG 61
           +N   + + +   + +EP T L+H    S    +R        KSKE+        G NG
Sbjct: 38  SNDYSQRDSDNTSIESEPRTKLVHRFVDS---FKRAQDVPTGRKSKEI--------GNNG 86

Query: 62  ---------QDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXX 112
                    +D+  +E +  D     + N  +K+ +K RH                    
Sbjct: 87  GSKTKGGFEEDSLDLEGSDHDSI---ITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAK 143

Query: 113 PLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGY 171
            L   GP   +I Y+ +  + + + Q+ GEMA   P +  +F  +S  F+S AFG A  +
Sbjct: 144 GLHFGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVW 203

Query: 172 MYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWV 230
           ++   W     LEL      I++W  K+    +I IF+V +  ++LF  V  YGE EF  
Sbjct: 204 IFCIQWLTVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLF 263

Query: 231 ASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEG-RFLGWVS 288
              K++ +IGF+I    +   GAG    +G ++W +PGA+        K  G RF G   
Sbjct: 264 NLCKILMVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAFA------GKTAGSRFKGICY 317

Query: 289 SLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-D 347
            L++  F++ GTEL  ++  E +NPR++ P+A K  ++RIL  Y+ +++ IG  VPY+ D
Sbjct: 318 VLVSGYFSYGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSD 377

Query: 348 PKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
             +    S    SP+++A   +G K+ PH  NAVIL ++IS ANS++Y   R++  L++ 
Sbjct: 378 ELMGSGGSATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQ 437

Query: 408 KLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
             APKFL    + G P +A+ A  + G + ++  S   ++VF WL  I G++  F W  I
Sbjct: 438 GYAPKFLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSI 497

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KF 522
            +SH+RF  A+K +  S +EL +KA      + Y   F       Q +TA  P     K 
Sbjct: 498 MLSHVRFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKA 557

Query: 523 NGSSFLAAYISIFLFIAVWILFECIFRC-----RFIWKIEDVDIDSDRR--DIEAIVWED 575
           N +SF A Y++    + +W++F   +       + +  ++ +D+D  RR  D E +  ED
Sbjct: 558 NANSFFANYLA----MPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQED 613

Query: 576 HEPK 579
            E K
Sbjct: 614 EESK 617

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  258 bits (658), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 160/541 (29%), Positives = 269/541 (49%), Gaps = 32/541 (5%)

Query: 69  ENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLF 128
           E ++  D    Q  ++K+ +K RH                     L   GP G +I Y+ 
Sbjct: 62  ETVRTNDYNATQK-KMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVT 120

Query: 129 MGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
             ++ + V Q+  E+  ++  +  ++  +    +   F  A  ++Y   WAI   LEL  
Sbjct: 121 TSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVT 180

Query: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               I++W   +    +++IF+  I  ++ F  + Y E EF   S KV+ ++GF+I    
Sbjct: 181 SSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGIS 240

Query: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
           + CGA  +G +G +YW  PGA+        K    F G  S  + +AF + G+E + +TA
Sbjct: 241 VNCGASKSGYIGGKYWHTPGAF-----VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTA 295

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVST--SPFIVA 365
            E  NPRK+VP+A K+ ++R+L  ++  ++ +G LVPY+ P L  +    ++  SPF++A
Sbjct: 296 AEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIA 355

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
             + G KV+PHI NAVIL ++IS  NS  Y   RIL  L++  + PK  +   + G P +
Sbjct: 356 AASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLV 415

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
            +   A+FG ++++  S   + VF WL  I  ++  F W  IS+SHIRF  A+K +G S 
Sbjct: 416 TMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSL 475

Query: 486 DELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNG-----SSFLAAYISIFLFIAV 540
            EL +KA      ++Y+  F       Q + A AP  NG     ++F   Y++  + +  
Sbjct: 476 GELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFF 535

Query: 541 WILFECIFRCRFIWKI----EDVDIDSDRR--DIEAIVWEDHEPK------TFWDK---F 585
           +  ++  +R    WK+    + VD++S R+  D + I  ED E K      +FW +   F
Sbjct: 536 YFGYKLWYRD---WKLFIPADKVDLESHRKIFDADLIKQEDFEHKERIRNSSFWVRALDF 592

Query: 586 W 586
           W
Sbjct: 593 W 593

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  256 bits (653), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 163/533 (30%), Positives = 269/533 (50%), Gaps = 23/533 (4%)

Query: 62  QDTFSMEENLQDEDEGEVQN--AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
            D  S+EE ++    G + N   ++K+ LK+RH                     L   GP
Sbjct: 28  HDIVSVEETVK---RGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGP 84

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAI 179
           VG LIAYLF+G +      ++ E+A+F+P T +    +++F+  + G      + F W  
Sbjct: 85  VGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGWIS 138

Query: 180 TFAL----ELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKV 235
           T++     ELS    ++++WT   P A +I++F +L  + N++ +++YGE E+    +K+
Sbjct: 139 TYSSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIYTIRFYGELEYIFGWLKL 197

Query: 236 IAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINA 293
           + I   +I    +  G G  G   +GF YWR PG +   ++  +   G+F+G+ +++ + 
Sbjct: 198 VLIFILIISGLVIDLG-GTKGQERLGFHYWREPGPFANYLVGGHI--GKFVGFWAAISSV 254

Query: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEA 353
            +++ G + + I AGE  N R  +    K V  RI+  Y+ ++  + L+VPYND  +   
Sbjct: 255 VYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATG 314

Query: 354 TSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKF 413
           T    +SPF++A+  +G KVLPHI NA+ILT+  SA N  I  GSR LF L+    APK 
Sbjct: 315 TGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKI 374

Query: 414 LSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIR 473
             RTSK G+PY+ V   + F  LAYM  S     VF W   +        W+ IS +HI 
Sbjct: 375 FLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIH 434

Query: 474 FMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-KFNGSSFLAAYI 532
             +ALK +G SR +LP+   + P  A++S           GF  F    F+  SF   Y 
Sbjct: 435 MDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYF 494

Query: 533 SIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKF 585
            I L I ++  ++   + +++ +  +VD++S   DI+       + K  W +F
Sbjct: 495 IIPLAIGLFTFWKLFKKTKYL-RPHEVDLESIFDDIKENPEHIVKTKNAWARF 546

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  256 bits (653), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 167/568 (29%), Positives = 279/568 (49%), Gaps = 45/568 (7%)

Query: 56  PTGVNGQDTFSME----ENLQDED--EGEVQ-------NAEVKRELKQRHXXXXXXXXXX 102
           P G    D    E    E++Q++D   G +        + +++R LK RH          
Sbjct: 18  PIGQGASDMKVKENFVTESIQEDDLERGSIDVLIDEKPSHQMQRGLKSRHMQLIALGCAI 77

Query: 103 XXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPV--TSSFTVFSQRF 160
                      L+  GP   LI+Y+ M    +++   L EM    P+   +S    ++ +
Sbjct: 78  GTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAY 137

Query: 161 LSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPV 220
           L+       G+  +++ A+    E++    +IQ+WT     A ++SIF V+   +   PV
Sbjct: 138 LNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTDANS-AIFVSIFIVITIAVTALPV 196

Query: 221 KYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNK 278
           K +GE EFWV+ IK+I I G +I    +  G G      +GF YW++PGA+ P I     
Sbjct: 197 KVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHI--STG 254

Query: 279 NEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
           N G+FL   +++I + F F    E +   + EA  PR+ +PRA  + V+R++ FYIG  L
Sbjct: 255 NTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGAL 314

Query: 338 FIGLLVPYNDPKLTEA----TSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSN 393
            +G+ V Y++  L  A     S  + SPF++ I+  G KVLPHI NA ILT   SA  + 
Sbjct: 315 VVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAE 374

Query: 394 IYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLL 453
           +Y  SR+L  ++    APK  +R ++ GVPY ++   + F  LAY+  S    +VF WL 
Sbjct: 375 MYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLT 434

Query: 454 NITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQ 513
           NI+ ++GF +W+F+SI+++RF + + Y  ++ D + F+       AY+S  F        
Sbjct: 435 NISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKPFQRIFAYFSGCFFVILSLTN 493

Query: 514 GFTAFAP-KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIED-----------VDI 561
           G+  F    ++ S F A YI+I   + ++I+    ++    W+  D           +D+
Sbjct: 494 GYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKE---WRFRDMEEIRSELIPKIDM 550

Query: 562 DSDRRDIEAIVWEDHEPKTFWDKFWNVV 589
             +    E ++    EP T++ K  NV+
Sbjct: 551 ADEEESNEIVI----EPTTWYGKLGNVL 574

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 166/516 (32%), Positives = 255/516 (49%), Gaps = 38/516 (7%)

Query: 73  DEDEGEVQNAE-------VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIA 125
           +  EG+  NA        VKR LK RH                     LA  GP+  L+ 
Sbjct: 33  ETGEGKNHNASLYDPKTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLG 92

Query: 126 YLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALEL 185
           +  +G +AF++ +S+GEM T  P    FT  ++RF S +  A  GY Y   +    A E 
Sbjct: 93  FSIIGIIAFTIMESIGEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEY 152

Query: 186 SVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
           + +  + QFW  +VPL  +I IFW       +  V  +GE E+W++  K++ ++ F I+ 
Sbjct: 153 NTLSSIFQFWGPQVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFS 212

Query: 246 FCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVG 304
              + G     P  GF YW NPGA   G          F G     +  +  + GTE V 
Sbjct: 213 TIYISGGIKDRPAFGFHYWNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVA 262

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIV 364
            +A E+ NP + +P AI++  +RIL  YIG   F G+ VPYND  L   T  +  SP  +
Sbjct: 263 YSASESKNPNRAIPLAIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALK-SPISI 321

Query: 365 AIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPY 424
           AI  +G +   H+ NA IL T ISA N ++++GSR +  L+   LAPKFL+ T + GVP 
Sbjct: 322 AITRAGWEGGTHLVNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPI 381

Query: 425 IAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
            A+      G ++ M  S G    + +++N++GV  F  W  I ++H+RF +A   +G +
Sbjct: 382 PAITLFNALGLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRT 441

Query: 485 RDELPFKAKLMP-----GLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLAAYI----SIF 535
             ELP+KA   P     G+A  ++ F+      QG+T+F P F    F+ AY+    +  
Sbjct: 442 VKELPYKALFYPYTQIIGIA--ANIFL---ALIQGWTSFVP-FKAGDFVDAYVLLPAAAV 495

Query: 536 LFIAVWILFECIFRCRFIWKIEDVDIDSDRR-DIEA 570
           L+I + +L    F+      +  +D+D  RR D++A
Sbjct: 496 LYIGISLLKTHSFKTV---DLLTIDLDEGRRVDLDA 528

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  254 bits (649), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 172/552 (31%), Positives = 275/552 (49%), Gaps = 23/552 (4%)

Query: 43  DEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQN--AEVKRELKQRHXXXXXXXX 100
             + KE     ++   V   D  S +E L+   +G + N   ++K+ LK+RH        
Sbjct: 4   SSQDKEKVKATAYEADVEDCDIRSTDETLK---QGVLHNDRTKLKQGLKERHIKMLTLVG 60

Query: 101 XXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRF 160
                        L   GPVG LIAYLF+G +      ++ E+A+F+P T +    +++F
Sbjct: 61  VFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQF 120

Query: 161 LSPAFGAANGYMYWFSWAITFAL----ELSVVGQVIQFWTHKVPLAAWISIFWVLITIMN 216
           +  + G      + F W  T++     ELS    ++++WT   P A +I+IF VL  + N
Sbjct: 121 IDESVG------FTFGWISTYSSLMPGELSATAVIMRYWTDISP-AVFITIFGVLFVVTN 173

Query: 217 LFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGII 274
           ++ +++YGE E+    +K+I I   +I    +  G GV G   +GF YWR+PG +   I+
Sbjct: 174 IYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLG-GVKGQERLGFHYWRDPGPFAEYIV 232

Query: 275 SKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIG 334
             +   G+F+G+ S+L +  +++ G + + I AGE  N R  +    K V  RI+  Y+ 
Sbjct: 233 GGSI--GKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLV 290

Query: 335 SLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNI 394
           ++  + L+VPYND  +   T    +SPF++A+  +G KVLPHI NA++LT+  SA N  I
Sbjct: 291 TVFVLTLIVPYNDALIASGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAI 350

Query: 395 YVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLN 454
             GSR LF L+    APK   +TSK G+PY+ V   + F  LAYM  S     VF W   
Sbjct: 351 IEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQE 410

Query: 455 ITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQG 514
           +        W+ IS +HI   +ALK +G SR +LP+   + P  A++S           G
Sbjct: 411 LVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGG 470

Query: 515 FTAFAP-KFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVW 573
           F  F    F+  SF   Y  I L I ++  ++   + R++ + E+VD+ S   DI     
Sbjct: 471 FYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYL-RPEEVDLASIFDDIRENPE 529

Query: 574 EDHEPKTFWDKF 585
              + K  W + 
Sbjct: 530 HIEKSKPIWARL 541

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/515 (29%), Positives = 261/515 (50%), Gaps = 24/515 (4%)

Query: 63  DTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 122
           D+F  +E+   +D       ++ + ++ RH                     L+ +GP+G 
Sbjct: 66  DSFKRKEH---DDSTAGDENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGL 122

Query: 123 LIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITF 181
           +I Y+    + F + Q+ GE+   +  V  +FT +    + PAFG A  ++Y   W I  
Sbjct: 123 IIGYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVL 182

Query: 182 ALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGF 241
            L+L      IQFW   V L  ++   +V++ ++NL   + Y E EF+    K++ + GF
Sbjct: 183 PLQLVTAAMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGF 242

Query: 242 LIYCFCMVCGAGVTGPVGF---RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298
           +I    +  G    GP G+   +YWRNPG +  G          F G  S    AAF++ 
Sbjct: 243 VILGIIITAGGIPNGPDGYIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYG 292

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TEATSYV 357
           G E + ++A E  NP K++P A KKV++RIL  Y+ SL+ +  LVPY  P L   + S  
Sbjct: 293 GVETLVLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGS 352

Query: 358 STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417
            +SPF++AI + G  V+PH+ NAVIL +++S ANS +YV  R+L  L++   APKFL+  
Sbjct: 353 HSSPFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYI 412

Query: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477
            K G P        +FG + ++  S   + VF WLL+I+G+   F W+ I +SHIRF  A
Sbjct: 413 DKRGRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDA 472

Query: 478 LKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSSFLAAYI 532
           ++ +G    E+ +KA+     +Y +          Q + A AP     K + ++F   Y+
Sbjct: 473 MRVQGHPLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYL 532

Query: 533 SIFLFIAVWILFECIFRC-RFIWKIEDVDIDSDRR 566
           +  + +  ++ F+  ++  + +   + +++D++R 
Sbjct: 533 AFPVVLCAYLGFKVYYKQWQLLIPADKIELDNNRN 567

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  253 bits (647), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 159/518 (30%), Positives = 264/518 (50%), Gaps = 20/518 (3%)

Query: 59  VNGQDTFSMEENLQDEDEGEVQN--AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLAN 116
           V  ++  +++E ++   +G + N   ++K+ LK RH                     L  
Sbjct: 22  VQLEEGVTLDETIK---QGVLHNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKK 78

Query: 117 AGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
            GPVG LIAY+ +G +      ++ E+A+F+P T +    S++F+  A G      + F 
Sbjct: 79  TGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVG------FTFG 132

Query: 177 WAITFAL----ELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVAS 232
           W  T++     ELS    V+ +WT   P A +I+IF VL  + N++ +++YGE E++   
Sbjct: 133 WISTYSSLMPGELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFGW 191

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLIN 292
           +K+  I   +I    +  G      +GF YWRNPG +   ++    + G+F+G+ ++L +
Sbjct: 192 LKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLV--GGDTGKFVGFWAALSS 249

Query: 293 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTE 352
             +++ G + + I AGE  N R  +    K V  RI+  Y+ ++  + L+VPYND  +  
Sbjct: 250 VVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIAT 309

Query: 353 ATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412
            +    +SPF++A++ +G KVLPHI NA+ILT+  SA N  I  GSR LF L+    APK
Sbjct: 310 GSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPK 369

Query: 413 FLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472
              +TSK G+P++ V   + F  LAYM  S     VF W   +        W+ IS +HI
Sbjct: 370 IFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHI 429

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-KFNGSSFLAAY 531
              +AL+ +G SR +LP+   + P  A++S           GF  F    F+  SF + Y
Sbjct: 430 HMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRY 489

Query: 532 ISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIE 569
             I L IA++  ++   + R++ +  +VD+ S   DI 
Sbjct: 490 FIIPLAIALFTFWKLFKKTRYL-RPHEVDLQSIFEDIR 526

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  254 bits (649), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 161/567 (28%), Positives = 283/567 (49%), Gaps = 30/567 (5%)

Query: 19  PVTTLLHDVEASQTHRRRGSLSLK--DEKSKELYPLRSF--PTGVNGQDTF--SMEENLQ 72
           P    LHD   ++  +R  +++ K  +E  ++  P ++   P   N    F  S +  L 
Sbjct: 16  PYPHSLHDRGNAEKKKRDFTITEKQNEEPEQQGSPQKTDRKPKLRNEFRKFFDSFKRQLP 75

Query: 73  DEDEGEVQNAE---VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFM 129
            +   E+++ E   +++ +K RH                     L  AGP G ++ Y   
Sbjct: 76  SDQNSELESQEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIA 135

Query: 130 GSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188
             + + + Q+ GE+   +  +T ++T +S   + P+ G A   +Y   W     L+L   
Sbjct: 136 SIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTA 195

Query: 189 GQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
              +++WT+ V    ++++ ++ + I+NLF  + Y E EF     K++ + GF+I    +
Sbjct: 196 AMTVKYWTN-VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVI 254

Query: 249 VCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307
            CG AG    +G  YW NPG +  G          F G  +    AAF++ G E++ ++A
Sbjct: 255 NCGGAGDRRYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSA 304

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSYVSTSPFIVA 365
            E  NP +++P A KKVV+RIL  Y+ + + IG LVPYN  +L  + ++S    SPF++A
Sbjct: 305 AEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIA 364

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
           + + G KV+PH  NAVIL ++IS ANS++Y G R+L  L++  + PK L+   + G P +
Sbjct: 365 VSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLL 424

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
               +  FG + ++ TS   ++VF WLL I+ ++  F W+ + +SHIRF  A+  +G S 
Sbjct: 425 CFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSM 484

Query: 486 DELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAP-----KFNGSSFLAAYISIFLFIAV 540
           DE+ +KA+     ++ +          Q + A AP     K +   F   Y+++ + +  
Sbjct: 485 DEVGYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLA 544

Query: 541 WILFECIFRC-RFIWKIEDVDIDSDRR 566
           +   +  F+  RF    E +D+DS R 
Sbjct: 545 YFGHKMYFKSWRFWIPAEKIDLDSHRN 571

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  250 bits (638), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 143/440 (32%), Positives = 221/440 (50%), Gaps = 18/440 (4%)

Query: 67  MEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAY 126
           M ++ +  ++G   +  +K+ LK RH                     LA  GP+  +I +
Sbjct: 56  MVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGW 115

Query: 127 LFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
              G+        LGE+    PV  +F  +  RFL P+       +Y   W     LE+ 
Sbjct: 116 TIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEII 175

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +++W   V    W++IF+ +I ++NL  V+ +GE EF  + IKVI I+GF+I C 
Sbjct: 176 AAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCI 235

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            ++CG G     VG +YW +PG    G          F G    L+ A+++  GTE+  +
Sbjct: 236 VLICGGGPKKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACL 285

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVA 365
            +GE  +P K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF++A
Sbjct: 286 ASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIA 342

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
           I+  G   LP I NAVIL +++S  NS I+  SR L  ++   L P+      + G P  
Sbjct: 343 IRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLT 402

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
            +    +FG LA++  S     VF WL+ I G+A    WL I+ISHIRF  A+K +G+  
Sbjct: 403 GILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDL 462

Query: 486 DELPFKAKLMPGLAYYSSFF 505
           +EL F    + G+  Y S +
Sbjct: 463 EELEF----VSGVGIYGSVY 478

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  253 bits (646), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 163/526 (30%), Positives = 262/526 (49%), Gaps = 21/526 (3%)

Query: 68  EENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYL 127
            E+++D       + + K+ L  RH                     L   GP   +I Y+
Sbjct: 61  SEDVEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYV 120

Query: 128 FMGSLAFSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
            +  + + + Q+ GEMA   P +  +F  +   F+S ++G A  +++   W     LEL 
Sbjct: 121 LVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELI 180

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFP-VKYYGEFEFWVASIKVIAIIGFLIYC 245
                I++W  K+    ++ IF+V +  ++L   ++ YGE EF   S K++ +IGF+I  
Sbjct: 181 TSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILS 240

Query: 246 FCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVG 304
             +   GAG  G +G +YW  PG++  G         RF G    L++  F++ GTEL  
Sbjct: 241 IVINAGGAGNDGYIGGKYWHEPGSFAEG-----DATSRFKGICLVLVSGYFSYGGTELYV 295

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEAT-SYVSTSPFI 363
           ++  E A PRK  P A KK ++RIL  Y+ +++ IG  VP+N+ +L  A  S    SP++
Sbjct: 296 LSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYV 355

Query: 364 VAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVP 423
           +A    G K++PH  NAVIL ++IS ANS+++ G R+L  L+    APK LS   + G P
Sbjct: 356 LAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRP 415

Query: 424 YIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGI 483
            +A+  + + G +A++  ++  ++VF WL  I G++  F W  I  SH+RF  A+K +G 
Sbjct: 416 LVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGK 475

Query: 484 SRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPKFNGSSFLA-AYISIFLFIAVWI 542
             +EL +KA      + Y +FF       Q + A AP  NG    A A+   +L   +W+
Sbjct: 476 DINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWV 535

Query: 543 LFECIFRCRFIWK-------IEDVDIDSDRR--DIEAIVWEDHEPK 579
              C F      K       ++ +D+DS RR  D E I  ED E K
Sbjct: 536 --ACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENK 579

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  250 bits (638), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 143/440 (32%), Positives = 221/440 (50%), Gaps = 18/440 (4%)

Query: 67  MEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAY 126
           M ++ +  ++G   +  +K+ LK RH                     LA  GP+  +I +
Sbjct: 56  MVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGW 115

Query: 127 LFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELS 186
              G+        LGE+    PV  +F  +  RFL P+       +Y   W     LE+ 
Sbjct: 116 TIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEII 175

Query: 187 VVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +++W   V    W++IF+ +I ++NL  V+ +GE EF  + IKVI I+GF+I C 
Sbjct: 176 AAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCI 235

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            ++CG G     VG +YW +PG    G          F G    L+ A+++  GTE+  +
Sbjct: 236 VLICGGGPKKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACL 285

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVA 365
            +GE  +P K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF++A
Sbjct: 286 ASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIA 342

Query: 366 IQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYI 425
           I+  G   LP I NAVIL +++S  NS I+  SR L  ++   L P+      + G P  
Sbjct: 343 IRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLT 402

Query: 426 AVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISR 485
            +    +FG LA++  S     VF WL+ I G+A    WL I+ISHIRF  A+K +G+  
Sbjct: 403 GILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDL 462

Query: 486 DELPFKAKLMPGLAYYSSFF 505
           +EL F    + G+  Y S +
Sbjct: 463 EELEF----VSGVGIYGSVY 478

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  252 bits (644), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 145/436 (33%), Positives = 229/436 (52%), Gaps = 19/436 (4%)

Query: 60  NGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 119
            G+D   M +   D ++G    A++K+ +K RH                     LA AGP
Sbjct: 45  RGRDVDLMCK--ADAEDG--TTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGP 100

Query: 120 VGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
            G ++ Y+   ++ + + ++ GE+   +  +T ++T +S   + PA G +  ++Y   W 
Sbjct: 101 AGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWM 160

Query: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238
             F L+L     +IQ+WT   P   +++I + +I  +NLF  K Y E EF+    KV+ I
Sbjct: 161 TVFPLQLVTAAMIIQYWTDINP-DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMI 219

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTF 297
           IGF+I    + CG AG +G +G +YW  P  +  G          F G       AAF +
Sbjct: 220 IGFVILGVVINCGGAGTSGYIGDKYWHEPRPFMNG----------FKGLCFVFCYAAFAY 269

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYV 357
            G E++ ++A E  NPRK++  A KKV++RI+  Y+ + + +  LVP + P L    S  
Sbjct: 270 GGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS-- 327

Query: 358 STSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT 417
             SP ++A+   G K++PHI NAVIL  ++S  NS++Y   R+L  L++   APK  +  
Sbjct: 328 RASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYI 387

Query: 418 SKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQA 477
            + G P  A F   VFG LA++  S   D VF WLL I+G++  F W+ I ISHIRF  A
Sbjct: 388 DRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDA 447

Query: 478 LKYRGISRDELPFKAK 493
           +K +G S  E+ +KA+
Sbjct: 448 MKAQGRSMGEVGYKAR 463

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  254 bits (649), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 150/499 (30%), Positives = 264/499 (52%), Gaps = 13/499 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQS 139
           ++A +++ ++ RH                     L  AGP G +I Y  MG+  + + Q+
Sbjct: 123 EDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK 198
            GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL      I +WT K
Sbjct: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242

Query: 199 VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+VLI ++N+F  K Y E +F+  + KV+ I GF I    +   GAG +G 
Sbjct: 243 VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGY 302

Query: 258 VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +G +YW +PGA+       +++  RF   +++   AAF F  +E + I A E +NPR+ +
Sbjct: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAI 357

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQNSGTKVLPH 376
           P A K +++RIL  ++ S+  +G LVPY+  +L  + S     SP+++AI + G +V+PH
Sbjct: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGAL 436
             NAVIL  ++S +NS  Y   RILF LS+   AP++ +   + G P  A+  + +FG +
Sbjct: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S+  ++VF WLL I+G++  F W+ I +SHIRF +A+  +G S  EL F+++L  
Sbjct: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537

Query: 497 GLAYYSSFFMXXXXXXQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-R 551
             + Y++  +      + + + AP      +  SF   Y+++ + I  +  ++   R  +
Sbjct: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWK 597

Query: 552 FIWKIEDVDIDSDRRDIEA 570
              + +++D+ + R   +A
Sbjct: 598 LFIRAKNIDLITHRNIFDA 616

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  253 bits (645), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 178/608 (29%), Positives = 289/608 (47%), Gaps = 39/608 (6%)

Query: 1   MTNPKQEAEIEEKHMYNEPVTT---LLHDVEASQTH----RRRGSLSLKDEKSKELYPLR 53
           M++   +  I E  + N+  ++   L   +  S T+     + GS+   +E S   Y   
Sbjct: 1   MSDKNSDINISETSLINKATSSSNNLTERIHTSTTNDYINEKLGSV---EEVSSFDYVQE 57

Query: 54  SFPTGVNGQ--DTFSMEENLQDEDEGEV-------QNAEVKRELKQRHXXXXXXXXXXXX 104
           +  TG   +  D+F   E   + ++GE        ++ E+K+ +K RH            
Sbjct: 58  AAKTGRFRRWADSFKRAEKSTEAEDGESGSIYNGNESTELKKAMKSRHVVMMSLGTGIGT 117

Query: 105 XXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMA-TFIPVTSSFTVFSQRFLSP 163
                    LA +GP   +I Y  +  + + + Q+ GE+  T+  +  +F V+    +S 
Sbjct: 118 GLLVANAKGLAISGPAPLVIGYGLVSFITYFMIQAAGELGVTYASLPGNFNVYFGTLVSR 177

Query: 164 AFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYY 223
            FG A  ++    W     LEL      I++WT KV    ++ I +V +  +++F VK Y
Sbjct: 178 PFGFATVWLASVQWLTVIPLELITCAITIKYWTEKVNGDIFVLIIYVFLLFIHIFGVKAY 237

Query: 224 GEFEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGR 282
           GE EF   + K++ I GF+I    + V GAG  G +G  YW NPGA+     + +    R
Sbjct: 238 GEAEFLFNTCKILMIAGFIILSIVINVGGAGNDGYIGGSYWNNPGAF-----ASDNAASR 292

Query: 283 FLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLL 342
           F      L+   F++ GTEL  ++  E  NPRK+ P+A K  ++RIL  Y+ +++ IG  
Sbjct: 293 FKSICYILVTGYFSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRILVIYLLTMILIGFN 352

Query: 343 VPYN-DPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRIL 401
           VP++ D  +  A S    SP+++A    G KV+PH  NAVIL  +IS ANS++Y   R++
Sbjct: 353 VPHDSDQLMGSAGSSAHASPYVLAASLHGVKVVPHFINAVILIALISVANSSLYAAPRMM 412

Query: 402 FGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGF 461
             L++   APKFL+   + G P + +   AVFG + +  +S   + VF WL  I G++  
Sbjct: 413 VSLAQQGFAPKFLTYVDREGRPLLGIAVCAVFGVIGFAASSDKEEDVFTWLAAIAGLSEL 472

Query: 462 FAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFTAFAPK 521
           F W    +SHIRF QA+K +G +  E  + +      +     F       Q + A +P 
Sbjct: 473 FTWSAFFLSHIRFRQAMKVQGKNIKECGYLSVTGIWGSIIGLCFNILVFIAQFWVALSPI 532

Query: 522 FN-GSSFLAAYISIFLFIAVWILFECIFRCRFIWK-------IEDVDIDSDRR--DIEAI 571
            N G     A+   +L   +W+ F   F C F +K       +E +D+D  RR  D E +
Sbjct: 533 GNDGKCDAQAFFQSYLAFPIWLAF--YFGCMFYYKDYTLLNPLESIDLDDHRRIYDPEEL 590

Query: 572 VWEDHEPK 579
             ED   K
Sbjct: 591 KKEDLATK 598

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  250 bits (638), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 170/529 (32%), Positives = 276/529 (52%), Gaps = 30/529 (5%)

Query: 42  KDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHXXXXXXXXX 101
           K ++   +Y   S+  GVN   T   E N++++         + R LK RH         
Sbjct: 19  KKQQDHLIYETTSY--GVNEVYTIDPEANIRED---------LTRALKPRHINMISIAGI 67

Query: 102 XXXXXXXXXXXPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFL 161
                       L   GP    I Y  +G + +     L EM+T++P++ SF  ++++F 
Sbjct: 68  IGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEMSTYMPISGSFCTYAKKFG 127

Query: 162 SPAFGAANGYMYWFSWAITFALELSVVGQVIQFW---THKVPLAAWISIFWVLITIMNLF 218
           S +F  A  + YWF+ A++ A +L+ +  V+ +W   ++  P  A   IFW  +  +N+ 
Sbjct: 128 SDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFPYWAASLIFWFFVLSLNVI 187

Query: 219 PVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKN 277
            V++YGE E+W+A +KVIAII F I    +  G       +GF+ W          + + 
Sbjct: 188 HVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYIGFKNWT---------VGEA 238

Query: 278 KNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
                F G+ S  ++A+F + GTE + +T+GE+ NP +  P+ +K V +RIL FYIG+  
Sbjct: 239 PFVDGFKGFASLFVSASFAYGGTESITLTSGESDNPLRNTPKIVKTVFWRILFFYIGTTF 298

Query: 338 FIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           FI + VPYN P L+  +  V TSPF +  + +GT       NAVI+T++ISA N  ++ G
Sbjct: 299 FIAMNVPYNYPGLSSGS--VVTSPFTIVFKMAGTAGAGSFMNAVIMTSVISACNHALFAG 356

Query: 398 SRILFGLSKNKLAPK-FLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNIT 456
           SRI++ +      PK  +SRT++  VPY+AV  T   G L +  +  G   ++ WL NI 
Sbjct: 357 SRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLCFGASFIGAGTLWTWLQNIV 416

Query: 457 GVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMXXXXXXQGFT 516
           GV+   AWL I+I+ IRF Q L+ +  +  EL FK    P   Y+    +      QG++
Sbjct: 417 GVSNQLAWLCIAITSIRFRQGLEAQNKTH-ELKFKNWTYPFGPYFLVVAVTFIILVQGWS 475

Query: 517 AFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDR 565
           +FAP +N S+F + YI +F+F   +I++    R  F+ K +D+D  +D+
Sbjct: 476 SFAP-WNVSNFFSVYIELFVFPFCFIIWWLYKRDPFV-KCKDMDFVTDK 522

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,509,860
Number of extensions: 2345764
Number of successful extensions: 10266
Number of sequences better than 10.0: 408
Number of HSP's gapped: 9070
Number of HSP's successfully gapped: 426
Length of query: 590
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 475
Effective length of database: 40,294,809
Effective search space: 19140034275
Effective search space used: 19140034275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)