Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.24na 1ON62762731590.0
Smik_5.22na 1ON62862829350.0
Suva_5.2na 1ON62762728650.0
YEL065W (SIT1)na 1ON62862828650.0
NCAS0D02350na 1ON63457721480.0
TPHA0M00120singletonON61958621420.0
NDAI0I02650na 1ON63861021430.0
Kpol_358.4na 1ON61761120950.0
SAKL0C12122gna 2ON61160420680.0
TDEL0G04740singletonON60155919830.0
Kwal_23.5241na 2ON59156019710.0
KLTH0A01562gna 2ON61557018850.0
Kwal_23.4853na 3ON60354717760.0
KLTH0G09504gna 3ON62458217680.0
Kpol_416.6singletonON59759716540.0
NCAS0A11500singletonON61461015710.0
Kpol_416.5singletonON60754915610.0
TPHA0G03780singletonON61261114980.0
Kpol_513.33singletonON62657514920.0
TDEL0B00140singletonON63260714650.0
NDAI0A02050singletonON61761114440.0
TPHA0B00180singletonON63359314090.0
SAKL0G06600gsingletonON62957313920.0
KAFR0D00930singletonON61456813590.0
Suva_8.12na 4ON63357913600.0
CAGL0E04092gna 4ON64555913471e-179
KAFR0C02660singletonON59155913351e-178
Skud_8.3na 4ON63162913361e-177
Smik_8.1na 4ON62758113271e-176
YHL040C (ARN1)na 4ON62757913261e-176
KNAG0J02980singletonON63658413241e-175
NDAI0H00140na 4ON63261313121e-174
TBLA0C01040singletonON66957813001e-171
KAFR0I01560singletonON63257712891e-170
KLTH0D00506gsingletonON61660612521e-165
ZYRO0G07414gsingletonON70753812331e-161
TPHA0K02330singletonON63154412171e-159
SAKL0G03300gsingletonON61658611991e-157
KLLA0C19272gsingletonON62354311971e-156
KLLA0A10439gsingletonON63458711971e-156
Kwal_56.22298singletonON61059911741e-153
SAKL0F00792gsingletonON61757911681e-152
KLTH0D18150gsingletonON60756711491e-149
TDEL0H00130singletonON62155611381e-147
Kwal_23.2794singletonON61955111151e-144
KLLA0C00220gsingletonON62453711081e-143
KLTH0A07964gsingletonON61955110911e-141
YHL047C (ARN2)singletonON62055210891e-140
SAKL0E00132gsingletonON62061110801e-139
KLTH0D00110gsingletonON62055110781e-139
KLTH0B10450gsingletonON62055110781e-139
Kwal_34.15711na 4ON61855510731e-138
SAKL0F00110gsingletonON62055710691e-137
TBLA0F00470singletonON73261910461e-132
NCAS0I00110na 4ON45241310101e-131
Skud_18.6singletonON61059410231e-130
YKR106W (GEX2)singletonON6155729691e-122
YCL073C (GEX1)singletonON6155719671e-122
Kwal_14.722singletonON6115839661e-122
KLLA0E14609gsingletonON6395949591e-121
KLTH0B00110gsingletonON6275529241e-116
KLLA0D19945gsingletonON6445989011e-112
KLTH0G00198gna 4ON4584397853e-97
Smik_11.370singletonON4404417382e-90
YOL158C (ENB1)singletonON6065536664e-78
Smik_21.4singletonON6055545756e-65
Suva_26.1singletonON5344865541e-62
TDEL0H01600singletonON6046165511e-61
Skud_6.14singletonON6366364723e-50
Suva_10.9singletonON6375704689e-50
Smik_6.22singletonON6365484662e-49
TDEL0A03210singletonON5845003503e-34
NCAS0I00100singletonON1631302733e-27
Smik_11.369singletonON1681212725e-27
Smik_17.11singletonON5443441554e-10
Skud_16.503singletonON5433771483e-09
YPR198W (SGE1)singletonON5433471431e-08
KLTH0C10120gsingletonON6513771432e-08
NCAS0C03460na 5ON6303871271e-06
Skud_7.560na 5ON6423811271e-06
Smik_16.81na 5ON6253861252e-06
KNAG0K01020singletonON5993821216e-06
KLTH0C10142gsingletonON5735491172e-05
Kwal_26.9616singletonON5623761162e-05
KLLA0A04631g8.272ON5791201144e-05
KLTH0D16962gsingletonON5712111144e-05
Kpol_543.448.272ON6432841136e-05
TDEL0F039908.272ON6312971127e-05
SAKL0A00726gsingletonON5982491111e-04
ZYRO0C01430g8.272ON5902891092e-04
KLTH0B00132gsingletonON5683621092e-04
Kwal_56.237548.272ON5892101092e-04
Skud_14.406na 6ON5642011063e-04
Smik_13.2722.473ON5611521064e-04
YNR072W (HXT17)singletonON5641631064e-04
YEL069C (HXT13)na 7ON5641631055e-04
Skud_13.2442.473ON5621231055e-04
SAKL0A08228gsingletonON5693801046e-04
Ecym_73992.473ON5632361047e-04
Skud_4.5singletonON5732461047e-04
AGR076C8.272ON6861451038e-04
Suva_13.2652.473ON5611521020.001
YJR158W (HXT16)singletonON5671631020.001
KLTH0G13464g8.272ON5932951020.001
YDL245C (HXT15)singletonON5671631020.001
Smik_5.19na 7ON5672401010.001
Smik_14.401na 6ON6361631010.001
TBLA0A03450singletonON5731651010.002
CAGL0J01375g2.473ON5643881010.002
YMR088C (VBA1)2.473ON5621231000.002
Skud_6.12singletonON470197990.002
Smik_6.20singletonON5691981000.002
TBLA0F030408.272ON9061411000.002
YJL214W (HXT8)singletonON569196980.003
Skud_7.620singletonON468197970.003
Smik_25.4singletonON315197960.004
SAKL0D00814g8.858ON570192970.004
Smik_10.8singletonON569197970.005
KAFR0F04080singletonON549189960.005
KAFR0E02030singletonON548189960.005
KAFR0F02800singletonON551189960.005
NDAI0H022002.473ON571155950.008
Kpol_541.168.843ON52872940.009
TBLA0B029408.858ON661170940.010
SAKL0H16808g8.272ON657179940.010
Ecym_13888.858ON572173930.013
TBLA0E01970singletonON578164930.014
AFL207C5.394ON539184930.014
TBLA0D032708.843ON55073920.015
SAKL0C05588gsingletonON677250930.016
NCAS0B002908.843ON54271920.018
TBLA0A03480singletonON574168920.018
NDAI0E002108.858ON613150920.018
TBLA0B00840singletonON63779920.018
ABL040W2.473ON567102910.022
SAKL0F00198gsingletonON537353910.023
Kwal_14.1585na 8ON570121910.023
SAKL0C00154gsingletonON571246910.024
TBLA0D03280singletonON58073910.024
NCAS0A078102.473ON568306910.025
TBLA0D05800singletonON574160900.027
TDEL0G03260singletonON612443900.029
NCAS0C002708.858ON570145900.030
TBLA0A03460singletonON568206900.033
Suva_15.2915.396ON592217890.035
Ecym_42988.272ON678122890.036
Kwal_26.77552.473ON559119870.073
SAKL0B12716gsingletonON632352870.073
Skud_13.188.858ON58597870.076
Suva_13.208.858ON58497870.077
KLTH0D05434g2.473ON576131860.078
KNAG0C051905.395ON564166860.082
Ecym_5319singletonON530281860.083
ZYRO0A00902g8.858ON604221860.086
TBLA0B10150singletonON571185860.098
NDAI0G015203.23ON530140850.10
AFR343C3.84ON571109860.10
Skud_8.1575.395ON592189850.10
TBLA0A03470singletonON57879850.10
TDEL0E02290singletonON571187850.11
Smik_13.118.858ON58697850.11
NDAI0D05010singletonON574192850.11
TPHA0G031502.473ON600292850.11
SAKL0C02178gsingletonON565231850.11
AFL205C5.395ON54675850.12
KNAG0C052505.394ON564166850.12
KLTH0H05456gna 8ON568153840.16
TPHA0L015708.521ON45564830.17
NCAS0F031005.395ON570154830.18
NDAI0D05020singletonON57376820.23
Suva_15.419singletonON588271820.25
Kwal_14.854na 9ON570202820.25
TBLA0A03500singletonON573103820.26
KNAG0B043705.394ON557162820.27
KLTH0B10142gsingletonON568360820.28
SAKL0E02992g2.473ON570102820.28
NDAI0K002808.858ON57197820.30
TDEL0A024902.473ON554102810.31
ZYRO0G21868gna 8ON620108810.36
Skud_18.5singletonOFF5351710.36
ZYRO0C00374gna 10ON56460810.37
YGR224W (AZR1)na 5ON613333810.37
Kwal_27.102458.843ON51577800.43
Kwal_26.6686singletonON569127800.44
KLLA0F13684g2.473ON571207800.44
NCAS0B002208.858ON625100800.44
KAFR0D00740singletonON56875800.47
KAFR0G00160singletonON636149800.49
TBLA0A01240singletonON56961800.50
YDR119W (VBA4)8.272ON768236800.52
KAFR0A029108.858ON586100790.55
CAGL0B02475g8.858ON580100790.56
YML123C (PHO84)8.858ON58795790.57
KAFR0D00750singletonON55791790.58
TBLA0A033905.394ON57461790.59
CAGL0A01826g5.396ON588189790.59
TPHA0I003808.858ON578102790.63
TBLA0A03430singletonON564114790.65
Kwal_55.19582singletonON567195790.67
Suva_12.263singletonON487201780.69
KAFR0D00800singletonON558186780.73
Kpol_541.208.858ON568100780.74
KLLA0F17776gna 11ON553232780.84
Suva_37.1singletonON265184760.87
NDAI0F01940singletonON551104770.91
TBLA0A01250singletonON50367770.93
TPHA0A017508.272ON636282780.94
TDEL0E00200singletonON568159770.95
TBLA0A03400singletonON57468771.0
Kpol_365.105.396ON63375771.1
Kwal_33.142688.858ON569173771.2
CAGL0D02640gsingletonON564101771.2
CAGL0D02662gsingletonON564101771.2
NDAI0B03060singletonON59871771.2
Suva_9.197singletonON289184751.3
KAFR0B039408.843ON54772761.3
AFR442C8.858ON563146761.3
Kwal_56.22285singletonON567194761.3
NDAI0D00820singletonON562168761.4
KNAG0E025602.473ON578101761.5
TBLA0F01600singletonON567195761.5
Kwal_26.6669singletonON590166751.6
TDEL0B002708.858ON58197751.8
KNAG0J002608.843ON550134751.8
KLTH0B00330gsingletonON566123751.9
Ecym_13175.394ON546153751.9
NDAI0F01930singletonON564168742.1
Ecym_13195.395ON535153742.2
KAFR0G037303.500ON14430712.2
TBLA0D05810singletonON574160742.3
NDAI0C017405.396ON60788742.3
ZYRO0G00286gsingletonON589166742.4
ZYRO0G21890gsingletonON576109742.5
TBLA0A035105.396ON57071742.5
TBLA0B04810singletonON575121742.5
TBLA0A08515singletonON63295742.5
Kwal_33.150205.180ON597165742.6
TBLA0A03440singletonON50392732.8
Smik_4.3638.272ON765187742.8
Skud_13.163na 12ON54768732.9
TBLA0A03700singletonON57234733.0
AFL204C5.396ON53575733.0
Kwal_56.227243.84ON57865733.0
Suva_13.4678.843ON543135733.0
SAKL0D01386g8.843ON52154733.1
YLR081W (GAL2)na 13ON574159733.2
KLTH0E02750g5.395ON567125733.2
Smik_12.140na 13ON57375733.3
TDEL0E023105.394ON567162733.4
Kpol_1053.243.84ON620165733.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.24
         (627 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)  1221   0.0  
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)  1135   0.0  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)     1108   0.0  
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...  1108   0.0  
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}              832   0.0  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}               829   0.0  
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}              830   0.0  
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...   811   0.0  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...   801   0.0  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...   768   0.0  
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...   763   0.0  
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...   730   0.0  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...   688   0.0  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...   685   0.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...   641   0.0  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...   609   0.0  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...   605   0.0  
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...   581   0.0  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...   579   0.0  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                568   0.0  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...   560   0.0  
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}      547   0.0  
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...   540   0.0  
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...   528   0.0  
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...   528   0.0  
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...   523   e-179
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}              518   e-178
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...   519   e-177
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...   515   e-176
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...   515   e-176
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}             514   e-175
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}      509   e-174
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}              505   e-171
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C     501   e-170
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...   486   e-165
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...   479   e-161
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}             473   e-159
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...   466   e-157
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...   465   e-156
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...   465   e-156
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...   456   e-153
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...   454   e-152
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...   447   e-149
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}      442   e-147
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...   434   e-144
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...   431   e-143
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...   424   e-141
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...   424   e-140
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...   420   e-139
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...   419   e-139
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...   419   e-139
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...   417   e-138
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...   416   e-137
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}              407   e-132
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}        393   e-131
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...   398   e-130
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...   377   e-122
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...   377   e-122
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...   376   e-122
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...   374   e-121
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...   360   e-116
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...   351   e-112
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...   306   3e-97
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...   288   2e-90
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...   261   4e-78
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)    226   6e-65
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)       218   1e-62
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...   216   1e-61
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...   186   3e-50
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...   184   9e-50
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...   184   2e-49
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}              139   3e-34
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}         109   3e-27
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...   109   5e-27
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    64   4e-10
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    62   3e-09
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    60   1e-08
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    60   2e-08
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    54   1e-06
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    54   1e-06
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    53   2e-06
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    51   6e-06
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    50   2e-05
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    49   2e-05
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    49   4e-05
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    49   4e-05
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    48   6e-05
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    48   7e-05
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    47   1e-04
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    47   2e-04
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    47   2e-04
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    47   2e-04
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    45   3e-04
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    45   4e-04
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    45   4e-04
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    45   5e-04
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    45   5e-04
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    45   6e-04
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    45   7e-04
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    45   7e-04
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    44   8e-04
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    44   0.001
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    44   0.001
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    44   0.001
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    44   0.001
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    44   0.001
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    44   0.001
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    44   0.002
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    44   0.002
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    43   0.002
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...    43   0.002
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)    43   0.002
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    43   0.002
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...    42   0.003
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...    42   0.003
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      42   0.004
SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON...    42   0.004
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)    42   0.005
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    42   0.005
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               42   0.005
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               42   0.005
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    41   0.008
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    41   0.009
TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.8...    41   0.010
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    41   0.010
Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}...    40   0.013
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    40   0.014
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    40   0.014
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    40   0.015
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    40   0.016
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       40   0.018
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               40   0.018
NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}...    40   0.018
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    40   0.018
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    40   0.022
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    40   0.023
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    40   0.023
SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON} ...    40   0.024
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    40   0.024
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    40   0.025
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    39   0.027
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               39   0.029
NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}...    39   0.030
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     39   0.033
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    39   0.035
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    39   0.036
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    38   0.073
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    38   0.073
Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}...    38   0.076
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    38   0.077
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    38   0.078
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             38   0.082
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    38   0.083
ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON...    38   0.086
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             38   0.098
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    37   0.10 
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    38   0.10 
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...    37   0.10 
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     37   0.10 
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    37   0.11 
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    37   0.11 
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    37   0.11 
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    37   0.11 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    37   0.11 
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    37   0.12 
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             37   0.12 
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    37   0.16 
TPHA0L01570 Chr12 complement(333218..334585) [1368 bp, 455 aa] {...    37   0.17 
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...    37   0.18 
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    36   0.23 
Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081...    36   0.25 
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    36   0.25 
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    36   0.26 
KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON}               36   0.27 
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    36   0.28 
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    36   0.28 
NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON...    36   0.30 
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    36   0.31 
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    36   0.36 
Skud_18.5 Chr18 (13411..13461,13465..13500,13504..13575) [159 bp...    32   0.36 
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    36   0.37 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    36   0.37 
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    35   0.43 
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    35   0.44 
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    35   0.44 
NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}...    35   0.44 
KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {O...    35   0.47 
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 35   0.49 
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    35   0.50 
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...    35   0.52 
KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.8...    35   0.55 
CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly...    35   0.56 
YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}  P...    35   0.57 
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    35   0.58 
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    35   0.59 
CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {...    35   0.59 
TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858...    35   0.63 
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    35   0.65 
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    35   0.67 
Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072...    35   0.69 
KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {O...    35   0.73 
Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON} (55476..5...    35   0.74 
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    35   0.84 
Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W...    34   0.87 
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               34   0.91 
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               34   0.93 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    35   0.94 
TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON}       34   0.95 
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    34   1.0  
Kpol_365.10 s365 complement(21800..23701) [1902 bp, 633 aa] {ON}...    34   1.1  
Kwal_33.14268 s33 complement(593529..595238) [1710 bp, 569 aa] {...    34   1.2  
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    34   1.2  
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    34   1.2  
NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {O...    34   1.2  
Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W (...    33   1.3  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    34   1.3  
AFR442C Chr6 complement(1234193..1235884) [1692 bp, 563 aa] {ON}...    34   1.3  
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    34   1.3  
NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...    34   1.4  
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    34   1.5  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    34   1.5  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    33   1.6  
TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858...    33   1.8  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    33   1.8  
KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly s...    33   1.9  
Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}...    33   1.9  
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               33   2.1  
Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}...    33   2.2  
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...    32   2.2  
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    33   2.3  
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}               33   2.3  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    33   2.4  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    33   2.5  
TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {O...    33   2.5  
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    33   2.5  
TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possi...    33   2.5  
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    33   2.6  
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    33   2.8  
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...    33   2.8  
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    33   2.9  
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               33   3.0  
AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON} Unc...    33   3.0  
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    33   3.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    33   3.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    33   3.1  
YLR081W Chr12 (290212..291936) [1725 bp, 574 aa] {ON}  GAL2Galac...    33   3.2  
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...    33   3.2  
Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081...    33   3.3  
TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.3...    33   3.4  
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    33   3.4  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    32   3.8  
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       32   3.9  
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    32   4.0  
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    32   4.2  
TDEL0E02300 Chr5 (447834..449537) [1704 bp, 567 aa] {ON}  YIL170W      32   4.3  
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    32   4.3  
KNAG0F02120 Chr6 complement(403190..405319) [2130 bp, 709 aa] {O...    32   4.6  
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    32   4.7  
KNAG0E04270 Chr5 (849856..851529) [1674 bp, 557 aa] {ON}               32   4.9  
KNAG0I00110 Chr9 complement(5329..7020) [1692 bp, 563 aa] {ON}         32   4.9  
KLLA0D18909g Chr4 complement(1592628..1593500) [873 bp, 290 aa] ...    32   5.5  
NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON}               32   5.8  
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    32   5.9  
KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON...    32   6.1  
CAGL0A02321g Chr1 complement(252192..253862) [1671 bp, 556 aa] {...    32   6.1  
YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putativ...    32   6.9  
SAKL0C07920g Chr3 complement(735512..737317) [1806 bp, 601 aa] {...    32   7.1  
YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putati...    32   7.1  
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    32   7.3  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    32   7.3  
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}        32   8.0  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    32   8.0  
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    32   8.3  
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...    31   8.9  
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...    31   8.9  
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    31   9.4  

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 1221 bits (3159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/627 (95%), Positives = 601/627 (95%)

Query: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60
           MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY
Sbjct: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300
           GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV
Sbjct: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300

Query: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRG      
Sbjct: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540
           RMAIVTSLYLATYNI            WTNILPREISKRISDPTLAAQAYGSPFTFIITY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600

Query: 601 AFEPKEKEETFLKSKFLSQFTGKNKEN 627
           AFEPKEKEETFLKSKFLSQFTGKNKEN
Sbjct: 601 AFEPKEKEETFLKSKFLSQFTGKNKEN 627

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/628 (87%), Positives = 583/628 (92%), Gaps = 1/628 (0%)

Query: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60
           MDP+TA+ ALPE+FTED+VP+I EKE G  VDVNPTLT SSPAPSYIELIDPGV+NIEIY
Sbjct: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE+Y+RPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSI+++SVIFY +GT+IESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISG+VTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300
           G+CMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT FFGCVLV
Sbjct: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300

Query: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGLKEEW++AHIIVPEVIGWVV LPLYMLWEMKYSRHPLTPWDLIKDRG      
Sbjct: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVL+VAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFI+FGISCWIVSFGLLVHYRGDSGAH+GIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540
           RMA+VTSLYLATYNI            WTNILP+EISKRISDPTLAAQAY +PFTFI TY
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNH+LTDSIALEG+D+L+SKD
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600

Query: 601 AFEPKEKEETFLKSKFLSQFT-GKNKEN 627
           +FE +EK+E+FLKS   ++FT  ++K N
Sbjct: 601 SFETEEKQESFLKSMIFTRFTRSEDKRN 628

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 1108 bits (2865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/627 (85%), Positives = 569/627 (90%)

Query: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60
           MDP+TA+RALPEEFTE +VPEI EKE GTT    P LT SSPAPSYIELIDPGV NIEIY
Sbjct: 1   MDPATANRALPEEFTEVVVPEILEKEVGTTTAAGPALTTSSPAPSYIELIDPGVRNIEIY 60

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE Y+RPLYR  LFFS+FLIAYAYGLDG IRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSILVISVIFY +GT+IESQAV ITRFAVGGCFYQLGLTG+ILIL
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALF+PALPFI+NTWISG+VTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300
           GLCMLHMRYLARKHAKD+L+PEFE LN L WKSF IDI FWKLD+IG+LL+TAFFGCVLV
Sbjct: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300

Query: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGLKEEW+ AHIIVPEVIGWVVALPLYM+WE+KYSRHPLTPWDLIKDRG      
Sbjct: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALF 360

Query: 361 XXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVL+VAVHESIKSATRIT+LYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASA THA
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540
           RMAIVTSLYLATYNI            WTNILP+EISKRISDPTLAA+AYGSPFTFI TY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNHKLTDSIALEG+D+LESK+
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600

Query: 601 AFEPKEKEETFLKSKFLSQFTGKNKEN 627
             E  EKEET L+++FL+QFT K K+N
Sbjct: 601 DNEIVEKEETSLRTRFLAQFTSKEKKN 627

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 1108 bits (2865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/628 (87%), Positives = 577/628 (91%), Gaps = 1/628 (0%)

Query: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60
           MDP  A+  LPEEF E +VPE+ EKE G  VDV PTLT SSPAPSYIELIDPGVHNIEIY
Sbjct: 1   MDPGIANHTLPEEFEEVVVPEMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY 60

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE+YNRP+YRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSI+++S+IFY MGT+IESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAI  NWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL 240

Query: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300
           G+CMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT FFGCVLV
Sbjct: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300

Query: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGLKEEW+TAHIIVPEVIGWVV LPLYMLWE+KYSRHPLTPWDLI+DRG      
Sbjct: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVL+VAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFI+FGISCWIVSFGLLVHYRGDSGAH+GIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540
           RMA+VTSLYLATYNI            WTNILP+EISKRISDPTLAAQAYGSPFTFI TY
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNHKLTDSIALEG+D+LESK+
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600

Query: 601 AFEPKEKEETFLKSKFLSQFT-GKNKEN 627
            FE +EKEE+FLK+KF + FT  K++++
Sbjct: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/577 (70%), Positives = 461/577 (79%), Gaps = 5/577 (0%)

Query: 51  DPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV+NIEIYAE Y  P  R  LFFSLFL+AYAYGLDGNIRYTFQA ATSSYS+HSLLST
Sbjct: 47  DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLST 106

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQ 170
           VNCIKTVIAA GQI+FAR SDIFGR +IL +S+IFYI+GTVIESQA N+ RF  GGCFYQ
Sbjct: 107 VNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQ 166

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWA 230
           LG TG +LI+E+IA+DFSNLNWRLLALFIPALPFIINTWISG+VT+A+  NWKWGIGMWA
Sbjct: 167 LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWA 226

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI PLACIPL  CMLHMRYLA K+AKDRL P F     +  K + ID+ FW+LD+IG+LL
Sbjct: 227 FIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLL 286

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           I  FFGCVL+PFTLAGG+KE+WRTAHIIVPEVIGW VALPLY+LWE+K+SRHPLTPW+L+
Sbjct: 287 IVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELL 346

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              WYMQGDYMYTVLIVAVHES+K+ATRITSLYSFVSVI GTILG
Sbjct: 347 KDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILG 406

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
             L+K+RRTKPFILFGI  W +SFGLL+HYRGDSGAHAGIIGSLCLLGF AG FTY TQ 
Sbjct: 407 LFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQT 466

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           SIQA+ ++HA+MA++T+LYLA YNI            WTN+LP  IS+ IS+ TLAA+AY
Sbjct: 467 SIQATTRSHAKMAVITALYLACYNIGSSFGAAVSGGVWTNVLPDRISRGISNQTLAAEAY 526

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIAL 590
           GSPFTFIITYTW T ER A+V +YR  QKILCIIGLVFC PLL  ALMLR+HKL D +AL
Sbjct: 527 GSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVAL 586

Query: 591 EGSDYLESKDAFEPKEKEETFLKSKFLSQFTGKNKEN 627
           +      S+   E  +    FLK K +  +  KN E 
Sbjct: 587 DQM----SEKVVEDDDPIFAFLK-KCIPFYNKKNGET 618

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/586 (66%), Positives = 469/586 (80%), Gaps = 2/586 (0%)

Query: 24  EKEAGTTVDVNPTLT-ISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAY 82
           + E    +D+ P LT +SS +      +D GVHNIE+YAE Y+ P++R ALFFS+FL+AY
Sbjct: 23  DAEMQKDLDIEPKLTAVSSSSDDAESHVDAGVHNIEVYAEQYSSPIHRFALFFSIFLVAY 82

Query: 83  AYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVIS 142
           AYGLDG +RYT+Q+YATSSY+QHSLLSTVNCI TVIAA GQI +AR SDIFGR +ILVI 
Sbjct: 83  AYGLDGQVRYTYQSYATSSYAQHSLLSTVNCITTVIAAAGQICYARASDIFGRMTILVIG 142

Query: 143 VIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPAL 202
           VIFY MGT+IESQA N++RFA G CFYQLG TGI+L LEVIA+DFSNLNWRLLA F+PAL
Sbjct: 143 VIFYSMGTIIESQATNVSRFAAGSCFYQLGYTGIVLTLEVIAADFSNLNWRLLASFVPAL 202

Query: 203 PFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDRLKPE 262
           PFIINTWISGNVTSA+  NWKWGIGMWAFILPL+ IPLG C+LHMRYLA+K+A DRL  E
Sbjct: 203 PFIINTWISGNVTSAVNGNWKWGIGMWAFILPLSAIPLGCCLLHMRYLAKKNAGDRLLKE 262

Query: 263 FEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEV 322
              +  L WK F ++I FW+LD IG+L++   FGC+L+PFTLAGGL+ EW+TAHIIVPEV
Sbjct: 263 ASLIGTLGWKKFIVEILFWRLDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEV 322

Query: 323 IGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIV 382
           IGW +ALPL++LWE+K+SRHPLTPW LIKDRG              WYMQGDYMYTVLIV
Sbjct: 323 IGWCLALPLFLLWEIKFSRHPLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIV 382

Query: 383 AVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRG 442
           +VHES+KSATRITSLYSFVSVI GTILG  + K+RRTKPFI+FG+ CW ++FGLLVHYRG
Sbjct: 383 SVHESVKSATRITSLYSFVSVITGTILGMFITKIRRTKPFIVFGVVCWFIAFGLLVHYRG 442

Query: 443 DSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXX 502
           D+ +H+GIIGSLCLLGFGAG FTY TQASIQASAK+H++MA++T+LYLATYNI       
Sbjct: 443 DNNSHSGIIGSLCLLGFGAGFFTYTTQASIQASAKSHSKMAVITALYLATYNIGSSVGAA 502

Query: 503 XXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILC 562
                WTNILP+EISKR+++ TLAA AY SP++FII YTWGTPER A+V++YRY Q+ILC
Sbjct: 503 VSGAIWTNILPKEISKRLNNETLAALAYSSPYSFIIDYTWGTPERDAVVLAYRYTQRILC 562

Query: 563 IIGLVFCFPLLGCALMLRNHKLTDSIALEGSD-YLESKDAFEPKEK 607
           I+GL FC  LL  AL LRNHKL  S++++     +E       KEK
Sbjct: 563 IVGLCFCTTLLISALFLRNHKLVSSVSIDKEQTKVEEVSDITSKEK 608

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/610 (66%), Positives = 481/610 (78%), Gaps = 18/610 (2%)

Query: 21  EIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLI 80
           EI +KE   T  V+ T  ISS   S I + D GV NIE+YAE Y +P YRV LFFSLFL+
Sbjct: 14  EIAQKE---TYSVHST-DISSG--SEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLV 67

Query: 81  AYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILV 140
           AYAYGLDGNIRYT+QAYATSSYSQHSLLSTVNCIKTVIAA GQI+FAR SDIFGR ++L+
Sbjct: 68  AYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLI 127

Query: 141 ISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP 200
           I+++FY++GT+IESQA N+ RF  GGCFYQ+G TG +LI+EVIA+DFSNLNWRLLALF+P
Sbjct: 128 IAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVP 187

Query: 201 ALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDRLK 260
           ALPFIINTWISG+VTSA+G +WKWGIGMWAFI PLACIPLG CMLHMRYLA K++KD+L 
Sbjct: 188 ALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLA 247

Query: 261 PEFEALNKLKWKS-FCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIV 319
                    +WK  F ID+ FWKLD+IG+LL+  FFGCVLVPFTLAGG+  EW+TAHIIV
Sbjct: 248 KHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIV 307

Query: 320 PEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTV 379
           PEVIGWVV LPLY+LWEMK+S+HPLTPW L+KDRG              WYMQGDYMYTV
Sbjct: 308 PEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTV 367

Query: 380 LIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVH 439
           L+VAVHES+KSATRITSLYSFVSV+ GT LG +LIKVRRTKPFI+FGIS W V+FGLL+ 
Sbjct: 368 LVVAVHESVKSATRITSLYSFVSVLTGTGLGLVLIKVRRTKPFIIFGISMWFVAFGLLIR 427

Query: 440 YRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXX 499
           YRGDS +HAGIIGSLCLLGFGAG FTY TQASIQA+ ++H ++A++T+LYLA YNI    
Sbjct: 428 YRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIGSGL 487

Query: 500 XXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQK 559
                   WTN+LP  ISK I++ TLAA+AYGSPFTFIIT TWGTP+R+A+V +YR VQK
Sbjct: 488 GSAVSGAVWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQK 547

Query: 560 ILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFEPKEKEETFLKSKFLSQ 619
           ILCIIGL FC PLL  AL LRNH+L D +AL         +  + K  +E      FL++
Sbjct: 548 ILCIIGLCFCIPLLCAALFLRNHRLEDVVAL---------NELDEKNVKEDDPVVDFLAK 598

Query: 620 F--TGKNKEN 627
           F  + +NK+N
Sbjct: 599 FIPSLRNKKN 608

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/611 (63%), Positives = 474/611 (77%), Gaps = 9/611 (1%)

Query: 2   DPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSY-IELIDPGVHNIEIY 60
           D       L E+ TED       +   + +D N   +      +Y +   D GV+NIE+Y
Sbjct: 10  DGKINETVLQEQTTED-----SNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVY 64

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE Y+ P+YRV LFFSLFL+AYAYGLDG++RYT+QA ATSSYSQHSLLSTVN I TVIAA
Sbjct: 65  AEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSTVNAITTVIAA 124

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
            GQI +AR SDIFGR +IL+I ++FY +GT+IESQA N+TRFAVG CFYQLG TG+IL L
Sbjct: 125 AGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSL 184

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240
           E+IA DFSNLNWRL A F+PALPFIINTWISGNV+ A+G +WKWGIGMWAFI+PL+ IPL
Sbjct: 185 ELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPL 244

Query: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300
           G C+LHMR+LA K+AKDRLK EF     + W ++ +D+  WKLD IG+LL+ A FGC+LV
Sbjct: 245 GCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILV 304

Query: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGL+++W+TAHIIVPEVIGW VALP+++LWE+K+S+ PLTPW LIKDRG      
Sbjct: 305 PFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALV 364

Query: 361 XXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLIV+V+ESIKSATRITSLYSFVSVI GT+LG ++IKVRRTK
Sbjct: 365 IAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTK 424

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFI+FG+SCW ++FGLLVHYRG S +H+GI+GSLCLLGFGAG FTY TQASIQAS K H+
Sbjct: 425 PFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTTQASIQASVKYHS 484

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540
           +MA++T+LYLA YNI            WTN+LP++ISKRI++ TLAA+AYGSPFTFI+TY
Sbjct: 485 KMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAEAYGSPFTFILTY 544

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA---LEGSDYLE 597
           TW TPER A+V+SYRY QKILCI+GL FC  LLG AL LRNHKL   +A   LE +   +
Sbjct: 545 TWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSD 604

Query: 598 SKDAFEPKEKE 608
            + +F   +K 
Sbjct: 605 EQGSFADNDKN 615

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/604 (66%), Positives = 474/604 (78%), Gaps = 17/604 (2%)

Query: 32  DVNPTLTISSPAPSYIELI--------DPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYA 83
           D+  T+T  S AP     I        D GVHNIEIYA+ Y  P YRVALFFS+FL+AYA
Sbjct: 5   DIKKTVTEGSVAPKDTWSIKTSDSKGKDAGVHNIEIYADQYKSPYYRVALFFSIFLVAYA 64

Query: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISV 143
           YGLDGNIRYTFQAYATSSYSQHSL+STVNCIKTVIAA GQI FAR SD+FGR SIL+I+V
Sbjct: 65  YGLDGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARASDVFGRLSILIIAV 124

Query: 144 IFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
           +FY++GTVIESQA N++RFA G CFYQLGLTGIILILEVI  DFSNLNWRL+A F+PALP
Sbjct: 125 LFYVVGTVIESQATNVSRFAAGACFYQLGLTGIILILEVIVMDFSNLNWRLVASFVPALP 184

Query: 204 FIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDRLKPEF 263
           FIINTWISG+VTSAIGTNW+WGI MWAFILPL+CIPL  CMLHMRYLA K+A + L  EF
Sbjct: 185 FIINTWISGDVTSAIGTNWEWGIAMWAFILPLSCIPLVCCMLHMRYLAHKNAPENLMSEF 244

Query: 264 EALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVI 323
           +   ++ W  + ++I FWKLD +G+LL+   FG VL+PFTLAGGL+ +W++A IIVPEV+
Sbjct: 245 KLYKQMPWSEYLVEIFFWKLDFLGLLLLCVSFGLVLIPFTLAGGLQTKWKSASIIVPEVL 304

Query: 324 GWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVA 383
           GW +ALPL++LWE KY+R+PLTPWDLIKDRG              WYMQGDYMYTVLIVA
Sbjct: 305 GWCLALPLFLLWEGKYARNPLTPWDLIKDRGIFSALIIAFLINFIWYMQGDYMYTVLIVA 364

Query: 384 VHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGD 443
           VHESIKSATRI SLYSFVSVI GT+LGF+++KVRRTKPFILFG+ CW +SFGLLVHYRGD
Sbjct: 365 VHESIKSATRIVSLYSFVSVITGTLLGFVIVKVRRTKPFILFGVCCWFLSFGLLVHYRGD 424

Query: 444 SGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXX 503
           SGAHAGI+GSLCLLGFGAG FTY TQASIQAS  +H  MA++T+LYLATYNI        
Sbjct: 425 SGAHAGIVGSLCLLGFGAGFFTYTTQASIQASTGSHQNMAVITALYLATYNIGSAVGNAV 484

Query: 504 XXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCI 563
               WTN+LP+++SKR+SDP +A+ AYGSPFTFIITYTW T ER A+V +YR+VQKILC 
Sbjct: 485 SGAIWTNVLPQQLSKRLSDPEMASAAYGSPFTFIITYTWETLERQAVVHAYRHVQKILCT 544

Query: 564 IGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFEPKEKEETFLKSKFLSQFTGK 623
           +G+ FC PL+  AL+LRNHKL   +AL   D L+ K+  +  E         FL++F   
Sbjct: 545 VGVCFCVPLVLAALLLRNHKLESVVAL---DDLDEKNRVDDNE------NGNFLTKFFPS 595

Query: 624 NKEN 627
           ++ N
Sbjct: 596 SRSN 599

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/559 (66%), Positives = 445/559 (79%), Gaps = 3/559 (0%)

Query: 48  ELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           E  D GVHNIE++   Y+   YR+ LFFS+FLI+YAYGLD NIRYT Q YAT+SYSQHSL
Sbjct: 29  EEKDAGVHNIEVFTAQYDHIGYRLMLFFSIFLISYAYGLDQNIRYTLQTYATNSYSQHSL 88

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGC 167
           L+TVNCI  VIAA GQ+ FAR +DIFGRF++L+++VIFY+MGT+IESQA N++RFA G C
Sbjct: 89  LATVNCIIAVIAAPGQVCFARAADIFGRFTVLIVAVIFYVMGTIIESQATNVSRFAAGAC 148

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIG 227
           FY+LG+TG++L++EVIA DFSNLNWRLLA F+PALPFIINTWISGNV +AIGTNWKWGIG
Sbjct: 149 FYRLGITGLMLMMEVIAMDFSNLNWRLLASFVPALPFIINTWISGNVLTAIGTNWKWGIG 208

Query: 228 MWAFILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           MWAFILPL+CIPLG CMLHMRYLA K+AKD+L+ EF+    + W  + +++ FW+LD  G
Sbjct: 209 MWAFILPLSCIPLGFCMLHMRYLAHKNAKDQLRSEFKLFKTMSWYEYIVEVFFWRLDFPG 268

Query: 288 MLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPW 347
           ++LI   FGC+L+PFTL GGL E+W+TA IIVPEVIGWVVALPLYM+WE KY+RHPLTPW
Sbjct: 269 LILICVTFGCILIPFTLGGGLNEKWKTAGIIVPEVIGWVVALPLYMIWESKYARHPLTPW 328

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGT 407
            LIKDRG              WYMQGDYM+TVL VAV+ES  SA RITSLYSFVSVI GT
Sbjct: 329 KLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQRITSLYSFVSVITGT 388

Query: 408 ILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYV 467
           +LG +++KVRRTK FILFGI CW +SFGLLVH+RGDS +H+GIIGSLCL+GFGAG FTY 
Sbjct: 389 LLGLVIVKVRRTKKFILFGIVCWFISFGLLVHFRGDSSSHSGIIGSLCLMGFGAGFFTYT 448

Query: 468 TQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAA 527
           TQASIQAS K H  +A++TSLYLATYNI            WTN+LP+EI KR++D TL  
Sbjct: 449 TQASIQASTKHHENLAVITSLYLATYNIGSAVGAAVSGAIWTNVLPKEIGKRLNDATLTQ 508

Query: 528 QAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDS 587
           QAY  P TFI+TYTW T ER A+V++YRY QK+LCI+GL FC PLL  A +LR+H+L D 
Sbjct: 509 QAYLEPLTFILTYTWETIERQAVVLAYRYTQKVLCIVGLCFCAPLLFSAFLLRDHRLGDV 568

Query: 588 IALEGSDYLESKDAFEPKE 606
           IALE    L+ K+  E +E
Sbjct: 569 IALED---LDEKNLAEDEE 584

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/560 (62%), Positives = 440/560 (78%)

Query: 51  DPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV+NIE+YA+ Y+   YR+ LFFSLFL+AYAYGLDG +RY FQAYAT+SY  HSLLST
Sbjct: 24  DAGVNNIEVYADQYSHIGYRILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLLST 83

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQ 170
           VNCIK VIAA GQ+ FAR +DIFGR SI+++S++FY++GT+I+SQA  ++++A G C YQ
Sbjct: 84  VNCIKAVIAAAGQLCFARAADIFGRISIIIVSILFYVVGTIIDSQATTVSKYAAGACIYQ 143

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWA 230
           LG TGIILILE+IA DFSNLNWRLLA F+PA+PFIINTWISG+V SA+G NWKWGIGMWA
Sbjct: 144 LGYTGIILILEIIAMDFSNLNWRLLASFVPAIPFIINTWISGDVVSAVGANWKWGIGMWA 203

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI PL+ +PL  CM HMRYLAR+ A DRL  E      + W ++  ++ FW+LD +G+++
Sbjct: 204 FIFPLSALPLLGCMFHMRYLARRRASDRLVTEVSLYKHMSWSTYLTEVFFWRLDAVGLIM 263

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           +   FGC+L+PFTLAG LK++W+TA IIVPEVIGW VALPL++LWEMK+++HPL PW++I
Sbjct: 264 VCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWNVI 323

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              WYMQG +MYTVLI+AV+ES+KSATRITSLYSFVSV+ G  LG
Sbjct: 324 KDRGIWSALIIAIHINFIWYMQGSFMYTVLIIAVNESVKSATRITSLYSFVSVLTGLGLG 383

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
           F++  +R+TK FI+FGI CW+VSFGLL+HYRGDS +H+GIIG+ CLLGFGAG FTY TQ 
Sbjct: 384 FVIAYIRKTKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQCLLGFGAGFFTYTTQT 443

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           SIQASAKTH  MA++T+LYL+ YNI            WTNILPRE+ KRI+DPT  A AY
Sbjct: 444 SIQASAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRITDPTTYALAY 503

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIAL 590
           GSPFTFIITY WGTPER A+V SY+YVQK+LC++G+ FC  L+  AL LR+H+L DS+AL
Sbjct: 504 GSPFTFIITYVWGTPEREAVVKSYQYVQKLLCVVGICFCATLIASALFLRDHRLGDSVAL 563

Query: 591 EGSDYLESKDAFEPKEKEET 610
           E  D   S ++    E +++
Sbjct: 564 EDEDEKFSINSDAEGELQDS 583

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/570 (61%), Positives = 432/570 (75%)

Query: 51  DPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV+NIE+YA  Y+   YRVALFFSLFL+AYAYGLDG +R + QAYATSSY  HSLL+T
Sbjct: 44  DAGVNNIEVYAAQYSHFAYRVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLAT 103

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQ 170
           +NC+K VIAA GQI FAR SDIFGR +IL ++V+ Y +GT+I+SQA NITR+A G C YQ
Sbjct: 104 INCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIYQ 163

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWA 230
           LG TGIILILE+IA DFSNLNWRL+A F+PALPFIINTWISGN   A+G NWKWGIGMWA
Sbjct: 164 LGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWGIGMWA 223

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI+PL+C+PL  C+LHMR+LA K+AKD+L+ E      + W  + +++ FW+LD++G+LL
Sbjct: 224 FIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGLLL 283

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           +   FGC+LVPFTLAG L+ +W+ A IIVPEVIGW VALPL++LWE KYSRHPL PW L+
Sbjct: 284 VCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLV 343

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              WYMQGDYMYTVL+VAV+E+ KSA RITSLYSFVSVI G +LG
Sbjct: 344 KDRGIWSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYSFVSVITGFLLG 403

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
            +++  RRTK FILFGI+CW V+FGLLVHYRGDS +H+GI+GSLCLLGFGAG FTY TQ 
Sbjct: 404 GVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCLLGFGAGFFTYTTQT 463

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           SIQAS K+H  MA++T+LYL+ YNI            WTNILPRE+ KRI+D      AY
Sbjct: 464 SIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRELRKRITDVATYTLAY 523

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIAL 590
           GSPF FI  Y WGTPER+ +V +YR VQ+IL I+GL FC  LL  A  LR+H+L +++AL
Sbjct: 524 GSPFVFIEEYLWGTPERMEVVAAYRVVQRILSIVGLCFCVTLLLSAFFLRDHRLENAVAL 583

Query: 591 EGSDYLESKDAFEPKEKEETFLKSKFLSQF 620
           E  D   S+ + E + + E   ++K   ++
Sbjct: 584 EDVDEKSSRKSDELEARIEDNTETKGFERY 613

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/547 (58%), Positives = 412/547 (75%)

Query: 51  DPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NI++YA+ YN   YRVALFFSLFL+AY+Y LDG +R   + YAT SY  HSLLST
Sbjct: 27  DAGVKNIKVYADQYNNVFYRVALFFSLFLVAYSYRLDGLVRGKLETYATDSYGHHSLLST 86

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQ 170
           VNCIKTVI A G I +AR SDIFGR ++L I+V+ Y++GT++E Q+  +++FA G   +Q
Sbjct: 87  VNCIKTVIGAAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVECQSNTVSKFATGASIFQ 146

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWA 230
           LG  GI+L+L+VIA DFS LNWR++AL++PALP IINTW+SG++  AI  NWKWGIGMWA
Sbjct: 147 LGKAGIVLLLQVIAMDFSTLNWRMVALYVPALPIIINTWVSGDIIKAINGNWKWGIGMWA 206

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FILPLAC+PL  C++HMRYLA K+ KD+L  E+E      W ++  ++ FW+LDI+G++L
Sbjct: 207 FILPLACLPLFGCLIHMRYLAHKNCKDQLVNEWELYKNTSWPAYLKEVFFWRLDILGLIL 266

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           ITA  GCVL+PFTLAGGL ++W++AHIIVPEVIGW VA PL++LWE KY+RHPLTPW L+
Sbjct: 267 ITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWRLL 326

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG               YMQ DYMYTVL+VAV+ES+KSA RIT+L++FV++I GT+LG
Sbjct: 327 KDRGVISAIIIGFHIHFVVYMQADYMYTVLVVAVNESVKSAQRITTLFNFVTIITGTLLG 386

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
           F++  V+RTK FILFGI  W V+FGLL+ YRGDS +H+GI+G+LCLLGFG G F Y TQ 
Sbjct: 387 FVIAYVKRTKKFILFGICIWFVAFGLLIRYRGDSSSHSGIVGALCLLGFGGGFFNYATQV 446

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           S+ AS  +H  MA++TSLYLA+YN+            WTN+LP+++ KRISD ++A  AY
Sbjct: 447 SLHASTSSHQDMAVITSLYLASYNVGSAVASAVAGAIWTNVLPKQLHKRISDASIANIAY 506

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIAL 590
            SPF FI  Y WG+PERIA++ +Y+ VQKILC +GL FC  LL  AL LR+ KL   +AL
Sbjct: 507 SSPFKFIKKYKWGSPERIAVMQAYQVVQKILCTVGLCFCVTLLVAALFLRDKKLESVVAL 566

Query: 591 EGSDYLE 597
           E ++  E
Sbjct: 567 EDAEEKE 573

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/582 (55%), Positives = 424/582 (72%), Gaps = 7/582 (1%)

Query: 20  PEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFL 79
           PE  EKEAG  ++ +          +     D GV NIE+YA  Y+   YRVALFFSLFL
Sbjct: 12  PE--EKEAGDAMERS-----RRADEALRRQKDVGVKNIEVYAAQYDHVAYRVALFFSLFL 64

Query: 80  IAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIL 139
           IAYAY LDG +R   +AYAT SY  HSLLSTVNCIKTV+AA G + +AR SD+FGR  +L
Sbjct: 65  IAYAYRLDGLVRSKLEAYATDSYGNHSLLSTVNCIKTVMAAGGMVAYARASDMFGRMEML 124

Query: 140 VISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFI 199
            IS++  ++GT++E Q+  +++FA G C YQLG  G+ LIL+VIA DFSNLNWR++AL++
Sbjct: 125 AISIVLVVVGTIVECQSDTVSKFATGACLYQLGKAGLALILQVIAVDFSNLNWRMVALYV 184

Query: 200 PALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDRL 259
           PALP IINTW+SG+V SAIG++W+WGIGMWAFI+PL+CIPL  C++HMRYLA KHA ++L
Sbjct: 185 PALPTIINTWVSGDVISAIGSDWEWGIGMWAFIIPLSCIPLFCCLVHMRYLAHKHAPEQL 244

Query: 260 KPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIV 319
             + +  +   W  + I++ FW+LD +G++L+    GCVLVPFTLAGGL ++WRTA IIV
Sbjct: 245 GKQRQLYSMASWSEYLIEVFFWRLDSVGLILVVGALGCVLVPFTLAGGLSDKWRTAQIIV 304

Query: 320 PEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTV 379
           PEVIGW VALPL++LWE K++R PLTP  ++KDRG               YMQ DYMYTV
Sbjct: 305 PEVIGWCVALPLFVLWEAKFARFPLTPRSVLKDRGVIAALVIAFHIHFCVYMQADYMYTV 364

Query: 380 LIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVH 439
           L++AVHES+K+A RIT+L++FVS+I GT+LGF+++ V+RTK FILFG+  W V+FGLLVH
Sbjct: 365 LVIAVHESVKAAQRITTLFNFVSIITGTLLGFVIVYVKRTKKFILFGVCVWFVAFGLLVH 424

Query: 440 YRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXX 499
           +RGD  +H+GIIG+LCLLGFG G F Y  Q S+QAS   H  +A+VTSLYLA YNI    
Sbjct: 425 FRGDESSHSGIIGALCLLGFGGGFFNYSAQVSMQASTAAHQDLAVVTSLYLACYNIGSAF 484

Query: 500 XXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQK 559
                   WTN+LP+E++KRI++  +A  AY SPF FII Y WGTP+R+A+V +Y+ VQ+
Sbjct: 485 ASAISGAIWTNVLPKELNKRITEKQVATLAYSSPFKFIIKYKWGTPQRVAVVHAYQKVQR 544

Query: 560 ILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDA 601
           ILCI+ L FC  LL  A +LR+ KL++ +AL   ++  S+ A
Sbjct: 545 ILCIVPLCFCVTLLIAAFLLRDKKLSEVVALGELEHGHSESA 586

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/597 (51%), Positives = 420/597 (70%), Gaps = 18/597 (3%)

Query: 12  EEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRV 71
           EEF+ +I           TV    T +++     ++E    GV+N E+YA+ Y+ P  R 
Sbjct: 18  EEFSSNI-----------TVSSITTNSLNGEKEPHLEE-SAGVYNSEVYAKYYSSPTRRS 65

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
            +F  LF I YAYGLD  +R  +Q  ATSSY QHSLLSTVN IK+VI+A GQI+FAR SD
Sbjct: 66  IVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVNAIKSVISAAGQIWFARASD 125

Query: 132 IFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
           +FGR +IL+++V+FY++GT++ESQAV++++FA G C +QLG  G++++++++ SDFSNLN
Sbjct: 126 LFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLGYDGVVMMVQILVSDFSNLN 185

Query: 192 WRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLA 251
           WR+ A+  P LP +INTW+SG++ SA+  NWKWGIGMWAFI PL+CIP G+ +LHM+YLA
Sbjct: 186 WRVTAVAFPVLPNVINTWVSGDIASAVDENWKWGIGMWAFIFPLSCIPFGILLLHMKYLA 245

Query: 252 RKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEE 311
           RK+  D LK  F+    + WK +  +I  WKLD IG+LL  AFFG VLVPFTLAGGL ++
Sbjct: 246 RKN-NDTLKSSFDKPEDITWKQYLTEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKK 304

Query: 312 WRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYM 371
           W+TA IIVPEV+GWVVA P ++ WE+K++++PLTPW  +KDRG              +YM
Sbjct: 305 WKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTAFYM 364

Query: 372 QGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWI 431
           Q  YMYT+L+VAV+++ KSATRI SL++FV+ + GT+LG +++KVRRTK FI FGI+ W 
Sbjct: 365 QKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLVIVKVRRTKEFIFFGIAVWF 424

Query: 432 VSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLA 491
           +SFGLL  Y G + A+AGII +LCLLGFG G   Y T+AS+QASA TH  MAI+TSL++A
Sbjct: 425 LSFGLLERYTGGTNAYAGIIAALCLLGFGNGFIKYPTKASMQASALTHEMMAIITSLFMA 484

Query: 492 TYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALV 551
              I            WTN+LP +I K +++ TLA  AY SP  FI+ Y W +PER  +V
Sbjct: 485 ISTIGTSVGSSVAGAIWTNVLPDKIEKGLNNSTLANFAYNSPTKFILQYNWESPERQIVV 544

Query: 552 MSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFEPKEKE 608
            +Y++V+KIL I+GL F  PLLG A +LRN +L D++AL   D +E K+  E KE E
Sbjct: 545 NAYKHVEKILIIVGLCFLVPLLGGAFLLRNQRLEDAVAL---DKVEPKN--EKKEME 596

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/610 (50%), Positives = 414/610 (67%), Gaps = 16/610 (2%)

Query: 13  EFTEDIVP-------EIPEKEAGTTV-DVNPTLTISSPAPSYIELIDPGVHNIEIYAEIY 64
           E + D VP       E+  K +   + +++ +   S+    YIE  + GVHN EIY + Y
Sbjct: 11  EVSSDHVPANDSGKVELTGKASAIKINELSSSAASSTIGSEYIE--NSGVHNAEIYCKYY 68

Query: 65  NRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQI 124
           + P+ R+ +F SLFLIA+AYGLD ++R T+Q  ATSSYSQHSLLSTV CIK VI+A  Q+
Sbjct: 69  SHPIKRIMVFSSLFLIAFAYGLDNSVRTTYQTMATSSYSQHSLLSTVTCIKKVISAAAQL 128

Query: 125 FFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIA 184
           +FAR +D+FGR +IL IS+IFY++GT+IE +A +++R+A G C + LG  GI+L+ E+  
Sbjct: 129 WFARSADMFGRPTILTISIIFYVIGTIIECRAFDVSRYAAGACIFSLGHAGIVLVSELYV 188

Query: 185 SDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCM 244
           +DFSNLNWR+ A     LP +I TWISGN+T AI  NW+WGIGMWAFI PL+C+PL +C+
Sbjct: 189 ADFSNLNWRVTAAAAQVLPNVITTWISGNITGAIDKNWEWGIGMWAFIFPLSCVPLIICI 248

Query: 245 LHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTL 304
           +HMRYLARK+  + LK  F+  N + WK +CIDI FWKLDIIG++L+ AFF  +LVPFTL
Sbjct: 249 IHMRYLARKN-NENLKVVFQKPNYMTWKEYCIDIFFWKLDIIGLILLVAFFSLILVPFTL 307

Query: 305 AGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXX 364
           AG L   W++  IIVPEV+GWV+A+PLY++WE+KY+R+PLTPW+ IKDRG          
Sbjct: 308 AGSLT--WKSPKIIVPEVLGWVLAIPLYLIWELKYARYPLTPWNSIKDRGIWAPLIINLF 365

Query: 365 XXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIL 424
               +YMQ  YM TVL+VAV +S KSATRI   YSFV V+    LGF++ KVRRTK FI 
Sbjct: 366 QEFAYYMQNTYMLTVLLVAVGQSKKSATRIIKFYSFVGVLTAFFLGFVVAKVRRTKEFIA 425

Query: 425 FGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAI 484
            GI  W V+FGLL HY G  GA AGII ++C+LGFG G   +  +ASIQA+A +HA M I
Sbjct: 426 LGIGIWFVAFGLLEHYEGGLGARAGIIAAICILGFGNGFLKFPCRASIQAAANSHAMMGI 485

Query: 485 VTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRIS-DPTLAAQAYGSPFTFIITYTWG 543
            TSL+ A  +I            W+N+LP EI+KRI+ + TLA  AYGSP  FI  Y W 
Sbjct: 486 ATSLFQAVGSIGTAFGSAVAGGIWSNVLPGEINKRITNNSTLATYAYGSPTKFIKQYGWE 545

Query: 544 TPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFE 603
           T ER A+V +Y+ V++++ I+GL    P+L  ++ LRN +L D ++ +  D  E+ D   
Sbjct: 546 TTERQAVVSAYKVVERLMAIVGLCLLVPMLVASIFLRNRRLEDVVSFDKLD--ETFDEKS 603

Query: 604 PKEKEETFLK 613
             ++E   +K
Sbjct: 604 TDDEEVVRIK 613

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/549 (53%), Positives = 397/549 (72%), Gaps = 1/549 (0%)

Query: 53  GVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GVHN+EIYA+ Y+ P+ R  +FFSLF IAYAYGLD ++R T+Q  ATSSY+QHSLLSTV+
Sbjct: 43  GVHNVEIYAKYYSTPVKRFLIFFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVS 102

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLG 172
           CIK VI+A  QI+FAR +D+FGR +IL+IS++FY++GTV+ESQAV++++FA G C Y +G
Sbjct: 103 CIKAVISAAAQIWFARSADMFGRTTILMISIVFYVVGTVVESQAVDVSKFAAGACLYAVG 162

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFI 232
            + I+L  EV  +DFSNLNWR+ A   P LP +INTWISG++T+AI  NWKWGIGMWAFI
Sbjct: 163 HSAIVLFSEVYVADFSNLNWRVTAAAAPLLPNVINTWISGDITAAIDENWKWGIGMWAFI 222

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
            PL+CIP+G C+LHM+YLA+K+ KD LK  F+      W  + +D+ FWKLD++G+LL+ 
Sbjct: 223 FPLSCIPMGACILHMKYLAKKN-KDDLKVAFKKPEHYTWSQYLVDVFFWKLDLVGLLLLV 281

Query: 293 AFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKD 352
           A FG +L+PFTLAGG ++ W TA IIVPEV+GW  ALPL+++WE+K++R+PLTP D +K+
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              + MQ  Y+YTVL+VAV ES KSATRI  L+SFVSVI G + GF+
Sbjct: 342 RGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFV 401

Query: 413 LIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASI 472
           + KVRRTK FI FGI  W +SFGL++ Y G   +H GII + C+LGFG G   +  +ASI
Sbjct: 402 VAKVRRTKEFIFFGIGVWFISFGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASI 461

Query: 473 QASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGS 532
           QASA +H  MA++TSL+LA  +I            WTN+LP +IS+ I++ TLA  AYGS
Sbjct: 462 QASAYSHEMMAVMTSLFLAVSSIGSAFGDAVAGSIWTNVLPGKISEGITNETLADYAYGS 521

Query: 533 PFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEG 592
           P  FI+ Y W TPER A+V +Y+ + ++L I+G+    PLL  A  L+N +L D ++ + 
Sbjct: 522 PTKFILKYKWDTPERQAVVEAYKVIGRLLNIVGICLLVPLLISAFFLKNRRLEDVVSFDK 581

Query: 593 SDYLESKDA 601
            D + S++A
Sbjct: 582 FDKMNSENA 590

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/611 (48%), Positives = 393/611 (64%), Gaps = 9/611 (1%)

Query: 12  EEFTEDIVPEIPE-KEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYR 70
           E+  ED +  I + +    T D   T T  S      E++ PGVHN +IY + Y  P  R
Sbjct: 10  EKADEDKISVISDVRSLKNTNDSEYTFTSDSEN----EVLSPGVHNAKIYGKYYTEPYQR 65

Query: 71  VALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLS 130
           + +FFSLFLI YAYGLD   R T+   ATSSY +HSL+STV CI  VI+A GQI+FAR S
Sbjct: 66  IMIFFSLFLICYAYGLDKKTRTTYVTLATSSYKEHSLMSTVTCITKVISAAGQIWFARAS 125

Query: 131 DIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNL 190
           DIFGR  I  +SVIFY++GTVIESQA  I+R+A G C Y LG  GI+L  E+ A+DFSNL
Sbjct: 126 DIFGRKLIFGLSVIFYVIGTVIESQATEISRYAGGECLYGLGHAGIVLTTELYAADFSNL 185

Query: 191 NWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYL 250
           NWR++A   P LP IINTW+SGN+T+ +  NWKWGIGMWAFI P++C+PL  C+LHMRY 
Sbjct: 186 NWRVVAAAAPMLPNIINTWVSGNITADVDENWKWGIGMWAFIFPISCLPLIGCLLHMRYK 245

Query: 251 ARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKE 310
           A+K+  + LKP F   + + +K + +D+ FWK DIIG++L+   FG VLVP TLAGGL +
Sbjct: 246 AQKN-NEELKPVFVKPSNMSYKEYLVDVFFWKSDIIGLILLVGVFGLVLVPITLAGGLNK 304

Query: 311 EWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWY 370
           +W  A IIVPEV+GW +ALPLY+ WE K++++P+   + ++D G              +Y
Sbjct: 305 KWNEAQIIVPEVLGWTLALPLYVFWENKFAKYPIIKLETVRDSGIWSALSISLFIDFCFY 364

Query: 371 MQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCW 430
           M   Y+ T L+VAV+ES KSATRI SL +FV+VI G  LG  ++++RRTK  I+FG   W
Sbjct: 365 MHETYLVTFLLVAVNESKKSATRINSLSTFVTVITGFFLGLAIVRIRRTKISIVFGTLVW 424

Query: 431 IVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYL 490
            V+ GL + Y G   +H+G+IG++CLLGFG G   +  +ASIQ S  TH ++AIVTSL+L
Sbjct: 425 FVAHGLFIEYNGGLRSHSGLIGAICLLGFGNGFIRFPVRASIQVSVGTHEKLAIVTSLFL 484

Query: 491 ATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIAL 550
           A  +I            W+N+LP +I  RIS+ T+AA AY SP TFI  Y WGT  R A+
Sbjct: 485 AVGSIGTAIGSAVAGAIWSNVLPGQIESRISNATIAASAYSSPTTFIKKYKWGTEYRTAV 544

Query: 551 VMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFEPKEKEET 610
           V +Y YV KIL I GLV   PLL  AL LR+ KL   +A    D +   + +   EK + 
Sbjct: 545 VSAYGYVWKILNITGLVLVLPLLISALFLRDRKLESVLAF---DEVTDTEGYSENEKVQQ 601

Query: 611 FLKSKFLSQFT 621
                F+  F 
Sbjct: 602 KKHKSFMDYFN 612

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/575 (49%), Positives = 385/575 (66%), Gaps = 9/575 (1%)

Query: 53  GVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
             HN  IY + Y+ PL    L+FSLFL+AYAY L  ++R T+Q  ATSSYS+HSLL+TV 
Sbjct: 38  AAHNARIYVKYYSTPLRVTILYFSLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQ 97

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLG 172
           CI  VI+A GQI++AR SDIFGR  IL++S++FY +GT+IESQA +I+++A G C Y LG
Sbjct: 98  CINQVISAAGQIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALG 157

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFI 232
             G +L+ +V+ SD+S L WRL++  +  LP IINTW+ GN+T  +G  W+WG GMWAFI
Sbjct: 158 YAGSVLVTQVLVSDYSTLKWRLVSSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFI 217

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
            PLA IPL  C+ HM+YLA K+ +D +K        + W     DI FWKLD++G++L+ 
Sbjct: 218 FPLASIPLLCCLAHMKYLAIKNKED-VKLTISKPRSISWARHLYDIFFWKLDMLGLILLV 276

Query: 293 AFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKD 352
           AFF  +LVP TLA GL E W +A  IVPEV+GW +ALPL++ WE+K++ +P+TP DLIKD
Sbjct: 277 AFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKD 336

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              + +   Y+YTVL+VAV+ES KSATRITSL++FVSV+    LGF+
Sbjct: 337 RGIYGGIGVSLFLEFVYDIGSTYLYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLGFV 396

Query: 413 LIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASI 472
           ++KVRRTK FI+FGI+ W +++GL  HYRG + +HAGII ++C+ GFG G   +  + S 
Sbjct: 397 VVKVRRTKEFIIFGIAMWYIAYGLFEHYRGGAESHAGIIAAVCVHGFGNGFIKFPVRVST 456

Query: 473 QASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGS 532
           QASAKTH R+AI TSLYLA  +I            WTNILP +I   I + TLA  AY S
Sbjct: 457 QASAKTHDRLAIATSLYLAAGDIGMAFGSATAGAMWTNILPAQIDMVIQNSTLAKIAYES 516

Query: 533 PFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEG 592
           P  FI T+ W +PER ALV++YRY+Q++L I+ L    PLL  +  LRN  LTD++A E 
Sbjct: 517 PIKFIRTHKWDSPERQALVVAYRYIQRLLMIVALCLIIPLLLSSFFLRNRALTDTVAFEQ 576

Query: 593 SDYLESKDAFEPKEKEETFLKSKFLSQFTGKNKEN 627
           +D         PKE + + L++  +      ++E+
Sbjct: 577 TDI--------PKESDSSDLENSKIDNLEEDSEED 603

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/607 (47%), Positives = 405/607 (66%), Gaps = 10/607 (1%)

Query: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPS-------YIELIDPG 53
           +D ++ +  +     E+ +  +   + G T D N  +  +    S       YI+    G
Sbjct: 4   LDETSTATPVDISDLEEGLKALDSGKDGHTSDSNSNVPDAYEHESDCVGDKKYIK--GSG 61

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           V NIE+Y + Y++P+Y+V L+FS+FL+AY Y LD  +R+T+Q   TS +   + L TVNC
Sbjct: 62  VINIELYKQQYHKPIYKVMLYFSIFLVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVNC 121

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           IKTV+   GQ  FAR SDIFGR ++L  S+I YI+GT+I+ +A +I++F+ G   YQLGL
Sbjct: 122 IKTVMGTAGQFGFARCSDIFGRTTVLNFSIILYIIGTIIQCKATDISKFSAGTILYQLGL 181

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFIL 233
            GI ++L VIASDFS+LNWRL A F+PALPF+IN WI G +T  IG  W+WGIGM+AFI+
Sbjct: 182 IGIQIMLGVIASDFSDLNWRLFASFVPALPFVINIWICGFITQLIGDRWQWGIGMFAFIM 241

Query: 234 PLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITA 293
           P ACIPL  C+LHMRYLA K+ + +++ EF     L ++ + +DI FW+LD++G  L+ A
Sbjct: 242 PCACIPLAFCLLHMRYLAYKNCRGKVQNEFRMYRVLTFRDYIVDIFFWRLDLVGFGLLCA 301

Query: 294 FFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDR 353
            FGC+L+P  LAGG    WR   IIVPEV+GWVV LP+++ WE K ++HPL  WD I+DR
Sbjct: 302 LFGCILIPLVLAGGSSNHWRNFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIEDR 361

Query: 354 GXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFIL 413
           G              +++ GDY++TVL++ + +S+ ++TRITS YSFV +I GT++G ++
Sbjct: 362 GILAALIIAFYINFVYHLLGDYLFTVLMITLDQSVLASTRITSSYSFVCIICGTLIGLVI 421

Query: 414 IKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQ 473
           I+ RRTKPFI+FGI CW ++ GLLVH+ G+     G+ GSLCLLG GAG FTY TQASIQ
Sbjct: 422 IRARRTKPFIIFGIGCWFLALGLLVHFFGNRPFMPGVTGSLCLLGLGAGFFTYTTQASIQ 481

Query: 474 ASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSP 533
           A+ KTHA+MA+VT+LYL+ Y+I            WTN+LPR+I  R  + + A  AY SP
Sbjct: 482 AAIKTHAKMAVVTALYLSIYSIGSAVGSAISGAIWTNLLPRKIF-RTMNHSDATAAYDSP 540

Query: 534 FTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGS 593
             FI+   WG+P R  L  +Y YVQK+LC++ L FC PLL  AL LRNHKL  ++ALE  
Sbjct: 541 QLFILNNPWGSPARNGLNEAYSYVQKMLCVVALCFCVPLLAAALFLRNHKLQSTVALENV 600

Query: 594 DYLESKD 600
           D  + K+
Sbjct: 601 DEKQVKE 607

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/611 (48%), Positives = 393/611 (64%), Gaps = 26/611 (4%)

Query: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60
           +DP T         T+D   EI E+E    +D     ++SS   S I   D GV NIE+Y
Sbjct: 11  LDPKT---------TKD---EIHEQE----ID-----SVSSTEESQINY-DTGVINIEVY 48

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           +E Y+    R+  FFS+FL  Y Y LD  +R TFQ  ATSSY  HSL+STV CI TVI+A
Sbjct: 49  SEYYSTTQRRLLFFFSIFLTTYCYTLDKRVRSTFQTEATSSYKNHSLMSTVTCITTVISA 108

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
            GQI +AR +DIFGR S++  ++ FY++GTV+ESQA NITR+AVG CFY LG   I+L L
Sbjct: 109 AGQIAYARAADIFGRTSLVFTAIFFYVIGTVVESQATNITRYAVGACFYSLGHAAIVLAL 168

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EV+A+DFSNLN+R+LA   P LP +INTWISGN+TS IG +W+WGIGMWA I P+ CIPL
Sbjct: 169 EVLAADFSNLNYRILASAAPMLPNVINTWISGNITSDIGDHWQWGIGMWAIIFPVCCIPL 228

Query: 241 GLCMLHMRYLAR-KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVL 299
             C+ HMRYLA+ KH +  L+        +    + ID+ FW+LDI+G+LL   FF CVL
Sbjct: 229 LFCLFHMRYLAQYKHNRRELRSFSTIPPNMTRMEYFIDVFFWRLDILGLLLGVIFFACVL 288

Query: 300 VPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXX 359
           +PFTLA    ++W++A IIVPEVIGW+VALPLY+ WE K+++ PLTPW+L+KDRG     
Sbjct: 289 IPFTLAAKATDKWKSASIIVPEVIGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGL 348

Query: 360 XXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG-FILIKVRR 418
                    +Y+Q  Y YTVL+V+   ++ +ATR  ++++FV VI   +LG F+  K+RR
Sbjct: 349 LIALFLDFAYYVQSTYKYTVLLVSFDTTVLAATRTNNMFTFVGVITANLLGIFVAKKLRR 408

Query: 419 TKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKT 478
           TK FI FGIS +IVS GLL  YR  + A  G I + CLLGFG G   +  +ASIQA+A T
Sbjct: 409 TKGFIFFGISMYIVSTGLLYRYRIGAHAKVGTIVACCLLGFGNGFLKFPARASIQAAAYT 468

Query: 479 HARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFII 538
           H  +AI+TSL+LA  +I            W+N +  E+SK IS+ T  + AY SP  FI 
Sbjct: 469 HKNLAIITSLFLALGSIGEGFGSSVAGAIWSNRMEVELSKYISNQTAVSLAYESPTKFIK 528

Query: 539 TYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLES 598
           +Y W +PERI LV +Y +V  IL I+ +  C PL   AL+LR+ +L D +A E  D    
Sbjct: 529 SYKWESPERIGLVQAYSHVTNILYIVTICLCIPLYVFALLLRDRELADVVAFEQLD--GQ 586

Query: 599 KDAFEPKEKEE 609
            +  + K+ EE
Sbjct: 587 DEIIQEKKTEE 597

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/593 (45%), Positives = 384/593 (64%), Gaps = 11/593 (1%)

Query: 17  DIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFS 76
            I  +I   +  T  + +  +T +   P+   +   GV+N+EIYA+ Y  P  +  ++FS
Sbjct: 25  QIRNKILSDKDATESNASEEITTNKLKPA---VSSTGVYNMEIYAKYYANPFQKFLIYFS 81

Query: 77  LFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRF 136
           LF+I YAYGLDGN+R T+Q  ATSS+++HSL STV CI  V ++ GQI+FAR SDIF R 
Sbjct: 82  LFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASDIFSRE 141

Query: 137 SILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLA 196
             +VIS++FY++GT+I SQA ++ ++AVG C Y +G  GI+L+ E+  +DFSNLNWR++A
Sbjct: 142 FSMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLNWRVVA 201

Query: 197 LFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAK 256
              P LP IINTW+SGN+TS +G+ W+WG+GMWA I P +CIPL +C+ HMRY+A+K+  
Sbjct: 202 ENAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPASCIPLFVCIYHMRYMAKKN-N 260

Query: 257 DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAH 316
           ++++  FE  +++ WK + IDI  WKLD IG++L+ A F  +LVPFT +GGL  EW +A+
Sbjct: 261 EKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALILVPFTTSGGLHREWNSAN 320

Query: 317 IIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYM 376
            IVPEV+GWVVALP++ +WE K+SR+P+   DLI DRG               Y+   Y+
Sbjct: 321 FIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISFFIQFCLYVNDTYL 380

Query: 377 YTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGL 436
           YT L+VAV ++ KS TRI SL SFV+VI    LG  ++K+RRT+ FI+ G   W V +GL
Sbjct: 381 YTFLLVAVDQTTKSGTRINSLMSFVNVITACCLGLFIVKIRRTQIFIVIGCVSWFVVYGL 440

Query: 437 LVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIX 496
            VHY G  G+ +GII + CL GFG G      +AS+QAS+ +H  +AIVT+L+LA  NI 
Sbjct: 441 YVHYNGGLGSRSGIITASCLSGFGYGFIKSPLKASLQASSNSHQNLAIVTALFLAIGNIG 500

Query: 497 XXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRY 556
                      W+N+LP  + K I + TLA  A+ SP  FI  Y W T  R  LV SY  
Sbjct: 501 TAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDSPIKFIKQYKWHTAVRQHLVSSYGS 560

Query: 557 VQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFEPKEKEE 609
           V +IL I+ LV   P+L  + +LR+ KL++S+A +  D       F P + EE
Sbjct: 561 VWRILNIVCLVLVIPMLVSSFLLRDRKLSNSVAYDQRD-------FSPTDCEE 606

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/573 (46%), Positives = 376/573 (65%), Gaps = 13/573 (2%)

Query: 53  GVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV  +EI  + YN    + A+FFSLFL+ + + LD  +R +  AYAT+SY QHSLLSTVN
Sbjct: 57  GVQKVEILNKQYNHLWGKSAIFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVN 116

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLG 172
            +++V AA G   ++RLSD+FGR  ++V+SV+ Y+ GT+I +QA ++TR+A G   YQ G
Sbjct: 117 VVRSVAAACGLPLYSRLSDVFGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFG 176

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKW-GIGMWAF 231
           L G+ ++ +VIA+DFSNLNWR+    I A PFIINTW+SG++  AIG NW W GIG+WA 
Sbjct: 177 LCGLAILFKVIAADFSNLNWRVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAI 236

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
            LP+A IPL LC +HM+YLA+K    ++L+       +L +K F +++ FWKLDI G+L 
Sbjct: 237 CLPVATIPLVLCFIHMQYLAKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLS 296

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           +    G +L P TLAGG   EWRTA +IVP ++G+   +P++  WE + + HP+ P D+ 
Sbjct: 297 LMIILGLILTPLTLAGGETAEWRTAKVIVPLILGF-CWIPVFAFWENRIATHPIAPTDMF 355

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              WYMQGDY+YT+L+VA+HES+KSATRI SLYSF ++I G  +G
Sbjct: 356 RDRGVYCALGIGILIDFCWYMQGDYLYTILVVAIHESVKSATRINSLYSFSTIITGLCVG 415

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
             + KVR+ K FI+FG+  W+V+FG+++ YRG S +H G+I S  LLGFG   FT+  QA
Sbjct: 416 LAISKVRKMKCFIVFGVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQA 475

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           S+QA    H RMA +T+LY  +Y I            WT +LP EI KR ++ TLA  AY
Sbjct: 476 SLQAYVN-HERMATITTLYAISYYIGSAVGSSVSGAIWTQVLPNEIGKRFTNKTLARLAY 534

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIAL 590
            +P +FI  YTWGTP R+ LV +YR+VQK+L I+G+ FC P+LG AL LR     D + +
Sbjct: 535 SAPLSFIKKYTWGTPLRMELVEAYRHVQKLLIIVGICFCVPILGFALFLR-----DPVLI 589

Query: 591 EGSDYLESKDAFEPKEKEETFLKSKFLSQFTGK 623
              + ++++D    KE +E +  +    +F GK
Sbjct: 590 SAQNIVDAED----KEVKEYYGYNPLKWEFNGK 618

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/568 (47%), Positives = 371/568 (65%), Gaps = 4/568 (0%)

Query: 51  DPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIEIYAE Y     R   FF LFL+AYAYGLD  +R TF   ATSSY +H+L+ST
Sbjct: 47  DAGVRNIEIYAEYYTSKFSRFMYFFFLFLVAYAYGLDTRVRTTFATDATSSYKKHTLMST 106

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQ 170
           V CIKT+I+A GQI FAR  DIFGR SI V S+I Y +GT++ESQA  I+++A G   Y 
Sbjct: 107 VTCIKTIISAAGQIGFARSCDIFGRTSIFVFSIILYAVGTIVESQATTISKYAGGVVLYS 166

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWA 230
           LG +GI+L+ EV+ +DFSNLNWR++A   P LP +INTWISGN+ + +G +WKWGIG+WA
Sbjct: 167 LGHSGIVLVSEVLIADFSNLNWRVVAAAAPMLPNVINTWISGNIVADLGDHWKWGIGLWA 226

Query: 231 FILPLACIPLGLCMLHMRYLAR-KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGML 289
            + P+ CIPL   +LHM+YLA+ K  +  LK  +     +    + I+  FW++D++G++
Sbjct: 227 IVFPVCCIPLLFILLHMKYLAQYKDKRPELKRIWTLPKGMTKVQYLIETLFWRVDVVGLI 286

Query: 290 LITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDL 349
           L+ A FG +L+PFTLA     +W+ A  IVPEV+GW V+LPLY +WE  ++R PLTP   
Sbjct: 287 LLAATFGLILIPFTLAEKKNYQWKKASYIVPEVLGWAVSLPLYCIWEKFFARFPLTPLAT 346

Query: 350 IKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTIL 409
           +KDRG              +YMQ  Y+YTVL VA + +  +ATRI +LYSFV VI    L
Sbjct: 347 VKDRGIYGALLVSLFIDFVYYMQHTYLYTVLYVAFNNTTSAATRINNLYSFVGVITSFFL 406

Query: 410 GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQ 469
           GF+++++++ K FILFGI+ WI+++GL + YR    ++ G I ++C+LGFG G      +
Sbjct: 407 GFVVVRLKKVKKFILFGIAVWIIAYGLFIRYRTGQASYVGSIAAICVLGFGNGFLKIPAR 466

Query: 470 ASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQA 529
           ASIQAS  +H +MA++TSL+LA  +I            W N +  EI KR+S+ T AA A
Sbjct: 467 ASIQASVGSHQKMAVITSLFLALADIGEAFGSAVAGAIWGNRMEAEIYKRVSNTTAAALA 526

Query: 530 YGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA 589
           Y SP  F+  Y WGT  R+ +V +YR V  IL ++G+  C PLL C+ +LR+ KL + I+
Sbjct: 527 YDSPTKFVKKYKWGTATRMEVVAAYREVTLILYVVGICLCVPLLLCSFLLRDRKLEEVIS 586

Query: 590 LE--GSDYLESKDAFEPKEKEETFLKSK 615
            +  GS+  ESKD    KE E +  +S+
Sbjct: 587 YDMMGSNS-ESKDEIIEKEIELSSEESR 613

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/579 (47%), Positives = 373/579 (64%), Gaps = 14/579 (2%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI  E Y +  ++  L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 63  IKQTEIIGEAYKKWYFQAILLISAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 122

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + + +VI Y++GT+I+SQA ++ R+A G  FY  G 
Sbjct: 123 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGY 182

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F P  PFIINTWI+GN+TS      NW W IGMWAF
Sbjct: 183 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAF 242

Query: 232 ILPLACIPLGLCMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I PL+CIP+ LCMLHM+++ARK    HA    K  ++    +K     ++  FWKLD+IG
Sbjct: 243 IFPLSCIPIVLCMLHMQWIARKTPEWHALKDEKSYYQEHGFVK----VLEQLFWKLDVIG 298

Query: 288 MLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V+ +P+  +WE + +R P+ P+
Sbjct: 299 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPILWVWEYRVARDPIIPY 357

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGT 407
            L+KDRG              +YM  DY+YTV++VAV+ESIKSATRI++L SFVSV+   
Sbjct: 358 KLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMLVAVNESIKSATRISTLSSFVSVVASP 417

Query: 408 ILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYV 467
             G I+ +  R KPFI+FG   W+++ GLL  YRG   +H+GIIG+LC+ G G   FTY 
Sbjct: 418 FFGLIMTRCTRLKPFIMFGCCLWMLAMGLLYRYRGGRESHSGIIGALCVWGLGTTLFTYP 477

Query: 468 TQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAA 527
              S+Q SA +H  +A VT+L    Y I            WT  L ++I KR+ D TLA 
Sbjct: 478 VTVSVQ-SAVSHENLATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQILKRMGDVTLAT 536

Query: 528 QAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDS 587
            AY SP+TFI TYTWGTP+R+ALV +Y+YVQ++  I+ LVFC PL+  +L LR+ KLTD+
Sbjct: 537 AAYTSPYTFIETYTWGTPQRVALVNAYKYVQRLETIVALVFCAPLIAFSLCLRDPKLTDT 596

Query: 588 IALEGSDYLESKDAFEPKEKEETFLKSKFLSQFTGKNKE 626
           +A+E  +  E  D  +     + F   KF S+F+   KE
Sbjct: 597 VAVENIEEGEYVDTKDNDPILDWF--KKFTSKFSSSKKE 633

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score =  523 bits (1347), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 266/559 (47%), Positives = 366/559 (65%), Gaps = 14/559 (2%)

Query: 53  GVHNI-----EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           GV NI     EI AE+Y++  Y   L F+ F+  Y YGLDGN RY +  YATSSY+QHSL
Sbjct: 69  GVKNIIIRKTEIMAEVYDKWYYHAILLFTAFVCGYGYGLDGNTRYIYTGYATSSYAQHSL 128

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGC 167
           LST+N I  VI+A  QI +ARLSD++GRF++  +S++ Y +GT+I+SQA ++ R+A G  
Sbjct: 129 LSTINVINAVISAASQIVYARLSDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSI 188

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWG 225
           FY  G  G+IL+L +I SDFS+L WRL+  F+P  PFIINTWISGNVTS      NW W 
Sbjct: 189 FYNTGYVGVILVLLLILSDFSSLRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSWD 248

Query: 226 IGMWAFILPLACIPLGLCMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLD 284
           IGMWAFI PL+C+PL   M+HM +LARK  +   L  E     K   K   +++ FWK+D
Sbjct: 249 IGMWAFIFPLSCVPLLCVMIHMWWLARKTEEWQELSKEKTFYQKHGLKDTIVEL-FWKID 307

Query: 285 IIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPL 344
            +G+ ++T   GC+LVP TLAGG K +W  +H+I P V+G+V+ +P+ +LWE K++R P+
Sbjct: 308 AMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVL-IPILVLWEYKFARDPI 366

Query: 345 TPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVI 404
            P+ L+KDRG              +YM  DY+YTVLIV V+ES+KSATRI+SL +FVS +
Sbjct: 367 IPYKLVKDRGVWASFAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTV 426

Query: 405 VGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSF 464
              I   ++ +  R KPFI+ G   W+++ GLL HYRG + +H+GIIG+LC+ G G   F
Sbjct: 427 GSPIFSLLITRFSRLKPFIICGCGLWMLAMGLLYHYRGGAESHSGIIGALCVWGVGTTLF 486

Query: 465 TYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPT 524
           TY    S+QA A +H  MA VT+L    Y I            WT  L +++ KR+ D  
Sbjct: 487 TYPVNVSVQA-ATSHEHMATVTALNYTFYRIGSAVGAAVSGAIWTQTLYKQLLKRVGDAA 545

Query: 525 LAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKL 584
           LA +AY SP+ FI+TYTW TPER A+V +YRYVQ++  I+ LVFC PLL  +L LR+ +L
Sbjct: 546 LATEAYASPYKFIVTYTWDTPERQAVVQAYRYVQRLETIVALVFCAPLLIFSLCLRDARL 605

Query: 585 TDSIALEG---SDYLESKD 600
           TD +A +     +Y+++KD
Sbjct: 606 TDKVAHDNIAEGEYVDAKD 624

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  518 bits (1335), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 247/559 (44%), Positives = 368/559 (65%), Gaps = 7/559 (1%)

Query: 51  DPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           + GV NIEIY+E YN P+ R+ LF S+FL+ Y+Y LD  +R TF+  AT+S+S+HSL+S 
Sbjct: 36  NVGVTNIEIYSEFYNTPMKRIILFSSIFLVCYSYSLDSTLRKTFKTDATNSFSEHSLVSF 95

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQ 170
           VNC   +++A+G++FFAR +DIFGR SI  I ++FY++GT+I + +  I++FA G C Y 
Sbjct: 96  VNCFSAIVSAIGELFFARSADIFGRTSIFYICLVFYVVGTIIVATSKGISQFAAGYCIYS 155

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWA 230
            G +GI ++++++ SDFS+LNWRL+A  IP LP +IN W SG + S    NW+WGIGM+A
Sbjct: 156 FGESGIDMVMQLLVSDFSHLNWRLVAGVIPMLPNVINAWASGTIVSDFSDNWQWGIGMFA 215

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
            I+P+ACIPL +C+ HMRY+A+K+ K+ LK  + + N+L W  F  +  FW+LD++G++ 
Sbjct: 216 IIVPVACIPLAVCLFHMRYMAKKNKKNELKRPWHSNNELSWAQFIRETLFWRLDLVGLIT 275

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           + A  GC+LVPFTL     ++W  A  IVPEVIGW V LPLY++WE  Y+++PLTP  LI
Sbjct: 276 LGASLGCILVPFTLTKKAGKKWAKASTIVPEVIGWAVGLPLYIVWEKFYAKYPLTPLRLI 335

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              + M+ +YM TVL VA + +  +ATRI + Y FVSV+   ILG
Sbjct: 336 RDRGVYAALVAVFLYEFIYVMEANYMVTVLQVAFNNTSAAATRINNSYEFVSVLTAFILG 395

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
           F ++ +R+TK  ILFG + + VS+GL + YRG  G +AG I +LC+ GF  G   Y T+ 
Sbjct: 396 FFVVFIRKTKRLILFGGTLFFVSYGLFIRYRGGHGCYAGSIAALCVFGFANGFIKYPTRT 455

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           S+QASA +H RMA++T+L+ A  ++            W+ ++P  +S RIS+  +AA+AY
Sbjct: 456 SLQASAGSHKRMAMITALFTAIGSVGKAMAAAIAGAIWSGLMPGALSSRISNSKVAAKAY 515

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIAL 590
            SP T I TY W +  R  ++ +YRYV K+L I+ +  C PLL  + +LR+ +L + +A 
Sbjct: 516 SSPLTVIKTYGWNSTIRNEMIEAYRYVTKVLYIVAICLCVPLLIASFLLRDRRLENKVAY 575

Query: 591 EGSDYLESKDAFEPKEKEE 609
           +        D+ +P   +E
Sbjct: 576 D-------SDSDDPSVLDE 587

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score =  519 bits (1336), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 277/629 (44%), Positives = 394/629 (62%), Gaps = 25/629 (3%)

Query: 5   TASRALPEEFTEDIVPEIPEKEAGTTVDVNPTL-TISSPAPSYIELIDPGVHNIEIYAEI 63
           +  + +P +  +++ PE       ++   + TL  +S    +  +     +   EI    
Sbjct: 12  SEKKHVPLDIEQELNPEAHTDSHSSSYARDDTLPQMSGKYDALRQNRSLIIKQTEIIGTA 71

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           YN+   +  L FS F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N I  V++A  Q
Sbjct: 72  YNKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSKHSLLSTINVINAVVSAASQ 131

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           I +ARLSD+FGR  + + +VI Y++GT+I+SQA ++ R+A G  FY  G  G+ILIL +I
Sbjct: 132 IIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLII 191

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACIPLG 241
            SDFS+L WRLL  F P  PFIINTWI+GN+TS      NW W +GMWAFI PL+CIP+ 
Sbjct: 192 LSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCIPIV 251

Query: 242 LCMLHMRYLARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKLDIIGMLLITA 293
           LCMLHM++ A K       PE++ L     KS+         ++  FWKLD+IG+LL+  
Sbjct: 252 LCMLHMQWRAGK------TPEWQELKGQ--KSYYQEHGLMKILEQLFWKLDVIGVLLMGC 303

Query: 294 FFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDR 353
             GC+LVP TLAGG+K  W  + +I P V+G+V+ +P+  +WE  Y+R P+ P+ L+KDR
Sbjct: 304 SLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPILWVWEYSYARDPILPYKLVKDR 362

Query: 354 GXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFIL 413
           G              +YM  DY+YTV+IVAV+ESIKSATRI++L SFVSV+     G ++
Sbjct: 363 GVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESIKSATRISTLSSFVSVVASPFFGLLM 422

Query: 414 IKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQ 473
            +  R KPFI+ G S W+++ GLL  +RG S +H+GIIG+LC+ G G   FTY    S+Q
Sbjct: 423 TRCTRLKPFIMSGCSLWMLAMGLLYRFRGGSESHSGIIGALCVWGVGTTLFTYPVTVSVQ 482

Query: 474 ASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSP 533
            SA +H  +A VT+L    Y I            WT  L ++I KR+ D  LAA AY SP
Sbjct: 483 -SAVSHENLATVTALNYTMYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAASAYDSP 541

Query: 534 FTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEG- 592
           + FI TYTWGTP+R+AL+ +Y+YVQ++  I+ LVFC PL+  +L LR+ +LTD++A+E  
Sbjct: 542 YVFIETYTWGTPQRVALMGAYKYVQRLETIVALVFCVPLIALSLCLRDPRLTDTVAVENI 601

Query: 593 --SDYLESKDAFEPKEKEETFLKSKFLSQ 619
              +Y+++KD+ +P  +    + SKF S+
Sbjct: 602 KDGEYVDTKDS-DPILEWFEKIPSKFTSK 629

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score =  515 bits (1327), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 270/581 (46%), Positives = 371/581 (63%), Gaps = 20/581 (3%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI+   YN+   +V L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 58  IQQTEIFGAAYNKWYLQVFLLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + + +VI Y++GT+I+SQA ++ R+A G  FY  G 
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F P  PFIINTWI+GN+TS      NW W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 232 ILPLACIPLGLCMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I PL+CIP+ LCMLHM++ A+K    H     K  ++    +K     I   FW LDIIG
Sbjct: 238 IFPLSCIPIVLCMLHMQWRAKKTPEWHTLKGQKSYYQEHGFIK----IIKQLFWMLDIIG 293

Query: 288 MLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V+ +P+  +WE +++R P+ P+
Sbjct: 294 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPVLWIWEYRFARDPILPY 352

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGT 407
            L+KDR               +YM  DY+YTV+IVAV+ES+KSATRI++L SFVS +   
Sbjct: 353 KLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRISTLSSFVSTVASP 412

Query: 408 ILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYV 467
               ++ +  R KPFI+FG S W+V+ GLL H+RG S +H+GIIG+L + G G   FTY 
Sbjct: 413 FFALLVTRCTRLKPFIMFGCSLWMVAMGLLYHFRGGSQSHSGIIGALGVWGVGTTLFTYP 472

Query: 468 TQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAA 527
              S+Q SA +H  MA VT+L    Y I            WT  L ++I KR+ D  LA 
Sbjct: 473 VTVSVQ-SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAT 531

Query: 528 QAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDS 587
            AY SP+TFI TYTWGTP+R+AL+ +Y+YVQ++  I+ LVFC PL+  +L LR+ KLT++
Sbjct: 532 AAYDSPYTFIETYTWGTPQRVALMNAYKYVQRLETIVALVFCVPLIALSLCLRDPKLTNA 591

Query: 588 IALEGSDYLESKDAFEPKEKE---ETFLKSKFLSQFTGKNK 625
           +A+E   Y+E  +  + K+ +   E F   K  S+FT K  
Sbjct: 592 VAVE---YIEDGEYVDTKDNDPILEWF--EKIPSKFTSKRD 627

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score =  515 bits (1326), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 266/579 (45%), Positives = 369/579 (63%), Gaps = 16/579 (2%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI    YN+   +  L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 58  IQQTEIIGSAYNKWYLQAILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + + +VI Y++GT+I+SQA ++ R+A G  FY  G 
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F+P  PFIINTWI+GN+TS      NW W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFVPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 232 ILPLACIPLGLCMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I PL+C+P+ LCMLHM++ ARK    HA    K  ++    +K     +   FW LD++G
Sbjct: 238 IFPLSCVPIVLCMLHMQWRARKTPEWHALKGQKSYYQEHGFIK----ILKQLFWMLDVVG 293

Query: 288 MLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V+ +P+  +WE +++R P+ P+
Sbjct: 294 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPILWIWEYRFARDPILPY 352

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGT 407
            L+KDR               +YM  DY+YTV+IVAV+ES+KSATRI +L SFVS +   
Sbjct: 353 RLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRIATLSSFVSTVASP 412

Query: 408 ILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYV 467
               ++ +  R KPFI+FG + W+V+ GLL H+RG S +H+GIIG+LC+ G G   FTY 
Sbjct: 413 FFALLVTRCTRLKPFIMFGCALWMVAMGLLYHFRGGSQSHSGIIGALCVWGVGTTLFTYP 472

Query: 468 TQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAA 527
              S+Q SA +H  MA VT+L    Y I            WT  L ++I KR+ D  LA 
Sbjct: 473 VTVSVQ-SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAT 531

Query: 528 QAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDS 587
            AY SP+TFI TYTWGTP+R AL+ +Y+YVQ++  I+ LVFC PL+  +L LR+ KLTD+
Sbjct: 532 TAYESPYTFIETYTWGTPQRNALMNAYKYVQRLETIVALVFCVPLIAFSLCLRDPKLTDT 591

Query: 588 IALEGSDYLESKDAFEPKEKEETF-LKSKFLSQFTGKNK 625
           +A+E   Y+E  +  + K+ +       K  S+FT K +
Sbjct: 592 VAVE---YIEDGEYVDTKDNDPILDWFEKLPSKFTFKRE 627

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score =  514 bits (1324), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 270/584 (46%), Positives = 370/584 (63%), Gaps = 32/584 (5%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ ++ Y++   +  L FS F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 63  IRKTELLSKSYDKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 122

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSDI+GR S+LV++++ Y +GT+I+ QA ++ R+A G  FY  G 
Sbjct: 123 INAVVSAASQIVYARLSDIYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGY 182

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRL   F+P  PFIINTWISGN+T       +W W IGMWAF
Sbjct: 183 VGVILILLLILSDFSSLRWRLFYQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAF 242

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLK-------WKSFCIDIAFWKLD 284
           I PL+C+P+  CM+HM      H + R  PE++ L   K       WK   +   FWKLD
Sbjct: 243 IFPLSCVPILCCMIHM------HWRVRNDPEWKELQGEKTYFQIHGWK-VTLKTLFWKLD 295

Query: 285 IIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPL 344
           ++G+LL+ A  GC+LVP TLAGG+  +W  ++II P V+G+V+ +P++  WE +++ +PL
Sbjct: 296 VVGVLLMVACLGCILVPLTLAGGVSSKWNHSNIIGPFVLGFVL-IPIFSYWEARWATNPL 354

Query: 345 TPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVI 404
            P+ L+KDRG              +YM  DY+YTVLIVAVHES+KSATRI+SL SFVS +
Sbjct: 355 VPYKLVKDRGVWAALGISFLIDFIFYMAVDYLYTVLIVAVHESVKSATRISSLSSFVSTV 414

Query: 405 VGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSF 464
              I+   L +V R KP I+ G S W+++ GLL H+RG   +H+GIIG+LC+ G G   F
Sbjct: 415 ASPIVALALTRVTRMKPVIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVWGLGTTLF 474

Query: 465 TYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPT 524
           TY    S+QA A  H  MA VT+L    Y I            WT  L +++ KRI +  
Sbjct: 475 TYPVTVSVQA-ATNHDNMATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQLLKRIGNSE 533

Query: 525 LAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKL 584
           LA +AY SP+TFI TYTWGTPER A+V +YRYVQ++  I+ +VFC PL+  +L LR+ KL
Sbjct: 534 LATKAYASPYTFITTYTWGTPEREAMVQAYRYVQRLETIVAVVFCAPLIMFSLCLRDAKL 593

Query: 585 TDSIALEG---SDYLESKDAFEP----------KEKEETFLKSK 615
           TD +A E     +Y+E K + +P          K K +T   SK
Sbjct: 594 TDEVAHEDISEGEYIE-KASGDPIGEFFAKLFKKTKNKTLKSSK 636

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  509 bits (1312), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 275/613 (44%), Positives = 381/613 (62%), Gaps = 22/613 (3%)

Query: 24  EKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYA 83
           EK+  T  + +  +TI SP P    +I       E+ A +Y++  Y V L  S F+  Y 
Sbjct: 29  EKDIETN-ETDDDITIRSPPPKKSLVI----KQTEVMASVYDKWYYHVVLLVSAFICGYG 83

Query: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISV 143
           YGLDGNIRY +  YATSSY++HSLLSTV  I  V++A  QI ++RLSD FGRF + VI++
Sbjct: 84  YGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVIAI 143

Query: 144 IFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
           + Y++GT+I+SQA ++ R+A G  FY  G  G++LIL +I SDFS+L WRL   F P  P
Sbjct: 144 VLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRLFYQFAPTWP 203

Query: 204 FIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDRLKP 261
           FIINTWISGN+T A     +W W +GMWAFI PL+CIP+ LCM+HM++ A K  + +   
Sbjct: 204 FIINTWISGNITLAANPLVHWSWDVGMWAFIFPLSCIPMLLCMIHMQWKASKTEEWKELK 263

Query: 262 EFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPE 321
           + ++  +       +   FW+LDIIG+LL+ A+ GC+LVP TLAGG+K +W    II P 
Sbjct: 264 KEKSYYEKHGLLLTLKELFWRLDIIGVLLMVAWLGCILVPLTLAGGVKSKWNDGRIIGPF 323

Query: 322 VIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLI 381
           V+G+V+ +P++  WE  ++R PL P+ LIKDRG              +YM  DY+YTVLI
Sbjct: 324 VLGFVL-VPIFAAWEYFFARDPLIPYALIKDRGVWASMGISFLIDFIFYMASDYLYTVLI 382

Query: 382 VAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYR 441
           VAVHES+KSATRI+SL SFVS +       +L +  R KPFI+ G S W++S GLL H+R
Sbjct: 383 VAVHESVKSATRISSLSSFVSTVASPFFALLLTRCSRLKPFIMVGCSLWMLSMGLLYHFR 442

Query: 442 GDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXX 501
           G   +H+GIIG+LC+ G G   FTY    S+Q SA +H  MA VT++    Y +      
Sbjct: 443 GGEQSHSGIIGALCVWGIGTTLFTYPVNVSVQ-SATSHENMATVTAINYTCYRLGSAIGA 501

Query: 502 XXXXXXWTNILPREISKRISD-------PTLAAQAYGSPFTFIITYTWGTPERIALVMSY 554
                 WT  L  +I KR+++        T+A +AY SP+TFI  YTWGTP R A+V SY
Sbjct: 502 AVSGAIWTQKLYPDILKRVTEVVGATEAVTIATEAYSSPYTFITKYTWGTPVRDAVVESY 561

Query: 555 RYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFEPKEKEETFLKS 614
           RY+Q++  I+ LVFC PL+  +L LR+ KLTD IA E     E    +  KE  + F   
Sbjct: 562 RYIQRLETIVALVFCVPLIIFSLCLRDAKLTDEIAHENIKEGE----YVSKEDSDVFF-- 615

Query: 615 KFLSQFTGKNKEN 627
            +L +  G++K++
Sbjct: 616 DWLKKVFGRSKKS 628

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score =  505 bits (1300), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 266/578 (46%), Positives = 366/578 (63%), Gaps = 13/578 (2%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI   +Y++  Y V L FS F+  Y YGLDGNIRY +  YATSSY++HSLLST+N 
Sbjct: 96  IRETEIMKSVYDKWYYHVILLFSAFVCGYGYGLDGNIRYIYTGYATSSYAEHSLLSTINV 155

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  V +A  QI +AR SD+FGR S+ ++SV+FY +GT+I+ QA ++ R+  G  FY +G 
Sbjct: 156 INAVASAASQIVYARASDVFGRLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGY 215

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G+IL+L +I SDFS+L WRL   F P  P+IINTWISGN+TSA     +W W IGMWAF
Sbjct: 216 VGVILVLLLILSDFSSLKWRLFYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAF 275

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDR-LKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I PL+ IP+ LC++HMR++A K  + + LK E   + +  + S   D+ FW+LD+IG+LL
Sbjct: 276 IFPLSSIPIILCLIHMRWMASKTKEWKLLKQEKSYIQQHTFVSAITDL-FWRLDVIGVLL 334

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           + A  GC+LVP TLAGG   +W   +II P  +G+V+ +P++  WE K+S+ PL P  L+
Sbjct: 335 MGASLGCILVPLTLAGGTSSKWNHGNIIAPFALGFVL-IPIFTFWEWKFSKSPLIPSKLV 393

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDR               +YM  DY+YTVLIV V+ES+KSATRI+SL SFVS +   I  
Sbjct: 394 KDRAVWSSMAISFLIDFIFYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTVGSPIFA 453

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
            ++ +  R KPFI+ G + W++S GLL HYRG + +H GII SLC+ G G   FTY    
Sbjct: 454 LLITRFTRLKPFIVAGCALWMLSMGLLYHYRGGASSHNGIIASLCVWGVGTTLFTYPINV 513

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           S+QA A +HA MA VT+L    Y I            WT  L +++ KR+ D TLA  AY
Sbjct: 514 SVQA-AVSHADMATVTALNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRMGDATLATAAY 572

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIAL 590
            SP++FI+ YTWGT  R  +V +YRYVQ++  I+ LVF  PLL  +L LR+ +LTD++A 
Sbjct: 573 SSPYSFIVNYTWGTTVRDQMVEAYRYVQRLETIVALVFTVPLLLFSLTLRDARLTDNVA- 631

Query: 591 EGSDYLESKDAFEPKEKEETFLKSKFLSQ-FTGKNKEN 627
             SD +E        + +     + FLS+ F G  K+N
Sbjct: 632 --SDDIEEGQHINKTDSDPI---ADFLSKPFKGLFKKN 664

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 260/577 (45%), Positives = 361/577 (62%), Gaps = 9/577 (1%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI +  Y +   ++   F  FL  Y YGLD NIRY +  YATSSYS+HSLLSTV  
Sbjct: 51  IKKAEIISASYAKWYEKLIFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTV 110

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD FGRF + V++++ Y MGT+I+ QA ++ R+A G  FY  G 
Sbjct: 111 INAVVSAASQIVYARLSDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGY 170

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G+IL+L +I SD S L WRL   F+P  P+IINTWISGN+TSA     NW W +GMWAF
Sbjct: 171 VGVILVLLLILSDMSTLRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAF 230

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I PL+C+P+  CM+HM++ ARK  +   LK +     +       + + FWK+DIIG+LL
Sbjct: 231 IFPLSCLPILACMIHMQWRARKTQEWKDLKTQKTYYQQHGLMKSLVSL-FWKIDIIGVLL 289

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           + A  GC+LVP TLAGG   +WR + II   V+G+V+ +P++ +WE K++  P+ P+ L+
Sbjct: 290 MAASLGCILVPLTLAGGTSSKWRDSRIIGVFVLGFVL-IPIFFIWEKKFATDPIVPYKLV 348

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              +YM  DY+YTVLIVAV+ES+ +ATRI+SLYSFVS +    + 
Sbjct: 349 KDRGVWASLGISFLIDFIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVS 408

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
             L +  R KPFI+FG   W ++ GLL H+RG + +H+GIIG LC+ G G+  FTY    
Sbjct: 409 LALTRFTRLKPFIIFGCCLWFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTV 468

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           S+QA A +H +MA V++L    Y I            WT  L +++   + D TLA  AY
Sbjct: 469 SVQA-AVSHEQMATVSALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLMGDATLATAAY 527

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIAL 590
           GSP+TFI+TYTWGTPER A+V +YRY+Q++  ++ LVFC PL+  +L LR+ +LTD++A 
Sbjct: 528 GSPYTFIVTYTWGTPEREAMVEAYRYIQRLETVVALVFCVPLVAFSLCLRDSRLTDNVAH 587

Query: 591 EGSDYLESKDAFEPKEKEETFLKSKFLSQFTGKNKEN 627
           +     E  D        E F+      + TGK KEN
Sbjct: 588 DDMSSGEFIDTKSDDPLAEFFV--GLWRRVTGK-KEN 621

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  486 bits (1252), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 273/606 (45%), Positives = 378/606 (62%), Gaps = 36/606 (5%)

Query: 24  EKEAGTTVDVNPTLTISSPAPSYIELIDPG------------VHNIEIYAEIYNRPLYRV 71
           EKE  T V  +     +    S+ EL + G            +   EI A  Y+   YRV
Sbjct: 4   EKETATGVQSSAYPIEADDKDSHRELNEYGLPDKLRVTRHIVIKKTEILAAQYDSWYYRV 63

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
            L F+ F+  Y YGLDGNIRY +  YAT++YS+HSLLST+  +  VI A  Q+ +ARL+D
Sbjct: 64  ILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIGVVNNVIGAASQLVYARLAD 123

Query: 132 IFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
            FGR S+ + +++FY +GT+I+SQA ++ R+A G  FY +G  G+IL+L ++ SDFS+L 
Sbjct: 124 TFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVILVLLLMLSDFSSLR 183

Query: 192 WRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRY 249
           WRLL   +P  PFIINTWISGN+TSA    TNW W IGMWAFI PL+C+PL  CM+HMR 
Sbjct: 184 WRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAFIFPLSCVPLIACMIHMRI 243

Query: 250 LARKHAKDRLKPEFEALNKLK--------WKSFCIDIAFWKLDIIGMLLITAFFGCVLVP 301
            ARK       PE+ AL + K        W +  +++ FWKLD++G+LL+ A  GC+LVP
Sbjct: 244 KARK------TPEWIALKQEKSYFQTNGLWDTL-VEL-FWKLDVVGVLLLIATLGCILVP 295

Query: 302 FTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXX 361
            TLAGG   +W   HII P V+G+V+ +P+ M WEM+++R PL P+ LIKDRG       
Sbjct: 296 LTLAGGYNSKWNNPHIIGPFVLGFVL-VPILMFWEMRWARDPLVPYGLIKDRGVWSALAI 354

Query: 362 XXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKP 421
                  + +   Y+Y +L+VAV ES+KSATRI+SL SFVSV+   I    + + ++ KP
Sbjct: 355 SFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWSPIFSLFITRQKKLKP 414

Query: 422 FILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHAR 481
           +I+ G + W+V  GLL HYRG S AH+GIIG+LC+ G G+  +TY    S+Q SA +H  
Sbjct: 415 YIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTMWTYPVNISVQ-SATSHEN 473

Query: 482 MAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYT 541
           +A VT+L    Y I            WT  L +++ KR+ D  LAA AY SP+TFI++Y 
Sbjct: 474 LATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADLAAAAYASPYTFIVSYA 533

Query: 542 WGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA---LEGSDYLES 598
           WGTP+R A+V +YR+VQ+   I+ LVFC PL+  A+ LR+  LTD +A   LE  +Y+  
Sbjct: 534 WGTPQREAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPDLTDEVAHSGLEKGEYI-V 592

Query: 599 KDAFEP 604
           KD  +P
Sbjct: 593 KDQTDP 598

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score =  479 bits (1233), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 254/538 (47%), Positives = 338/538 (62%), Gaps = 4/538 (0%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+   +R+ L F  F+  Y YGLD NIR+ + +Y T+S+S+HSLLSTVN 
Sbjct: 79  IRQSELLAAEYDWWPFRILLLFCAFICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNV 138

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  VI+A  QI +ARL+D+FGR ++ + +V+FY MGTVI+SQ+ NI  +A G  FY LG 
Sbjct: 139 INAVISAASQIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGY 198

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G++L+L +I SDFS+L WRL   F P  PFIINTWISGN+TS      NW W IGMWAF
Sbjct: 199 VGVVLVLLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAF 258

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I PL+C+PL  CMLHM + AR+  + ++  E +   K       I   FWKLD IG  ++
Sbjct: 259 IFPLSCVPLICCMLHMWWKARRTEEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIM 318

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIK 351
           T   GC+LVP TLAGG   +W  + II P V+G VV LP+ +++E+K++R P+ PW LIK
Sbjct: 319 TVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLG-VVLLPMLIVYELKWAREPILPWKLIK 377

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DR               +YM  DY+YTV+IVAV ES+KSATRI+SL +FVS +       
Sbjct: 378 DRAVWASMSISFLYDFIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFAL 437

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +V R KP+I+ G   W+V+ GLL H+RG   +H+GIIG LC+ G G   FTY    S
Sbjct: 438 YITRVTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVS 497

Query: 472 IQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYG 531
           +Q SA +H  MA VTSL    Y I            WT  L  EI KR+ D  +A+ AY 
Sbjct: 498 VQ-SATSHENMATVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYE 556

Query: 532 SPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA 589
            P+ FI  YTWGTP R  +V +Y +VQK+  ++GLVFC PLL  +L LR+ +LTD IA
Sbjct: 557 QPYNFIAEYTWGTPIRQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIA 614

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  473 bits (1217), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 245/544 (45%), Positives = 343/544 (63%), Gaps = 13/544 (2%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A  YN+  + + L F+ F+  Y YGLDGNIRY +  YATSSY++HSLLSTV  
Sbjct: 57  IRKTEIMAAQYNKWYHHLFLLFTAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTV 116

Query: 114 IKTVIAAVGQIFFARLSDIFGR-FSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLG 172
           I  V++AV QI+      +FGR + I +++++ Y +GT+I+SQA ++ R+A G  FY  G
Sbjct: 117 INAVVSAVSQIYTPDFQIVFGRLYIIFLVAIVLYSVGTIIQSQAYDVQRYAAGAIFYNAG 176

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWA 230
            +G++ IL +I SDFS+L WRL   F P  PFIINTWISGN+TSA     NW W IGM A
Sbjct: 177 YSGVLFILLIILSDFSSLKWRLAYQFAPTWPFIINTWISGNITSAANPIENWSWDIGMRA 236

Query: 231 FILPLACIPLGLCMLHMRYLARK--HAKDRLKPE--FEALNKLKWKSFCIDIAFWKLDII 286
           FI+PL+C+P   CM+HM + ARK    K+ LK +  +E  N L W +  +++ FW+LD+ 
Sbjct: 237 FIIPLSCLPFIACMIHMEWKARKTPEWKELLKEKTFYEEHNGL-WGTL-VEL-FWRLDVA 293

Query: 287 GMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTP 346
           G++L+ +  GC+LVP TLAGG   +W   ++I P ++G+V+ +P + LWE  ++R PL P
Sbjct: 294 GLILMGSSLGCILVPLTLAGGTSSKWNHGNVIGPFILGFVL-IPFFALWEKFFARDPLLP 352

Query: 347 WDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVG 406
             L+KDRG              +YM  DY+YTVLIVAV ES+KSATRI+SL SFVS +  
Sbjct: 353 AKLVKDRGVWSAMGISFLIDFIYYMAADYLYTVLIVAVDESVKSATRISSLSSFVSTVAS 412

Query: 407 TILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTY 466
                 L +  R KP+I+ G S W+++ GLL ++RG   +H+GIIG+LC+ G G   FTY
Sbjct: 413 PFFALYLTRCSRLKPWIMLGCSLWMLAMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTY 472

Query: 467 VTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLA 526
               S+QA A +H  MA VT+     Y I            WT  L +++ K + D  LA
Sbjct: 473 PVTVSVQA-AVSHENMATVTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIALA 531

Query: 527 AQAYGSPFTFIITYTWGT-PERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLT 585
             AY SP+TF   Y WGT PER A+V +YRYVQ++  ++ LVFC PL+  +L LR+ +LT
Sbjct: 532 TAAYSSPYTFTTNYAWGTPPEREAVVQAYRYVQRLETVVALVFCVPLIAFSLCLRDARLT 591

Query: 586 DSIA 589
           D +A
Sbjct: 592 DEVA 595

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  466 bits (1199), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 255/586 (43%), Positives = 362/586 (61%), Gaps = 27/586 (4%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A  Y+   YR  L FS FL  Y YGLDG++RY +  YAT+SY++HSLLST+  
Sbjct: 46  IRKTEILAAQYDTWFYRSILLFSAFLCGYGYGLDGSVRYIYTGYATNSYAEHSLLSTIAV 105

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  VI+A  QI +ARL+D+FGR  + + +VIFY++GT+I+SQA ++ R+A G  FY  G 
Sbjct: 106 INAVISAAAQIVYARLADVFGRLYLFITAVIFYVVGTIIQSQAYDVQRYAAGAVFYNTGY 165

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G++L+L +I SDFS+L WRL   F+P  PFIINTWI+G++TS      NW W I MWAF
Sbjct: 166 VGVVLVLLLILSDFSSLKWRLFYQFVPTWPFIINTWIAGDITSRANPQENWSWDISMWAF 225

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKL 283
           I PL+ +P+  CMLHMR  ARK       PE++ L++   KSF         +   FWKL
Sbjct: 226 IFPLSALPIICCMLHMRIKARK------TPEWQVLSEE--KSFYQTHGFIQTLVQLFWKL 277

Query: 284 DIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHP 343
           D+IG+L++T   GC+LVP TLAGG   +W+ + II P V+G+V+ +P+Y+ WE K+++ P
Sbjct: 278 DVIGVLIMTVSLGCILVPLTLAGGYSSKWQNSQIIGPIVLGFVL-IPMYIYWESKWAKEP 336

Query: 344 LTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSV 403
           + P+ L+KDRG              +YM  DY+Y VL++ V++S+KSA+RI+SL SFVS 
Sbjct: 337 MAPFKLLKDRGVWAALGISFLIDFIFYMAADYLYAVLLIGVNQSVKSASRISSLSSFVST 396

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGS 463
           +       I+ +  R KP+I+ G S W+++ GLL H+RG S +++GI+G+LC+ G G   
Sbjct: 397 VASPFFALIITRSTRLKPYIITGCSLWMLAMGLLYHFRGGSESYSGIVGALCVWGIGTTM 456

Query: 464 FTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDP 523
           FTY    S+Q S  +H  MA VT+L    Y I            WT  L +++  R+ D 
Sbjct: 457 FTYPVNVSVQ-SVTSHENMATVTALNYTLYRIGAAVGAAVSGAIWTQTLYKDLLNRLDDA 515

Query: 524 TLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHK 583
            LA  AY  P++FIIT+TW TPER A+V SYRYVQ++  I+ LVF  PLL  +  LR+  
Sbjct: 516 ALAMSAYSEPYSFIITHTWNTPERDAMVQSYRYVQRLETIVALVFTVPLLVFSFFLRDPP 575

Query: 584 LTDSIALEGSDYLESKDAFEPKEKE--ETFLKSKFLSQFTGKNKEN 627
           LTD +A    D +E  +       +    +  S+F  +  GK KEN
Sbjct: 576 LTDKVA---QDNIEEGEYINVNHNDPITDWFSSRF-ERLRGK-KEN 616

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score =  465 bits (1197), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 241/543 (44%), Positives = 342/543 (62%), Gaps = 7/543 (1%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A+ Y+   ++  L FS+FL +Y YGLDG++R  +  YAT+SYS HSLLST++ 
Sbjct: 51  LRKTEILAQQYDTWYWKAVLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISI 110

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  VI A  Q+FFARLSD+FGR ++L+++ +FY +GT+I+SQA ++ R+A G  FY +GL
Sbjct: 111 INLVIGASAQVFFARLSDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGL 170

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G++L + +I SDFS+L WRL   F+P+ PFIIN W+SGNV +A     NW W IGMWAF
Sbjct: 171 VGVVLQVILILSDFSSLRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAF 230

Query: 232 ILPLACIPLGLCMLHMRYLARK-HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I PL C+PL  C+LHMRY A K  A   L+ E             I + FWKLD++G+LL
Sbjct: 231 IFPLTCLPLVCCILHMRYRASKTEAWRHLQLEKTYYQSHGLLQTLIQL-FWKLDVVGVLL 289

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           +T   GC+LVP TLAGG+ ++W   H+I P V+G+V+ LP++++WE K++  P+ P++L+
Sbjct: 290 LTVTLGCILVPLTLAGGVSQKWNNPHVIAPFVLGFVL-LPIFVVWESKWALDPIAPFELL 348

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              + M   Y+YT+L++AV ES  SATRITS+YSF + +      
Sbjct: 349 KDRGVWSALTIQFLIYFVYQMAVGYLYTILVIAVDESTTSATRITSVYSFTAAVASPFFA 408

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
            ++ + +R KP+I+ G S W+V+ G+L H+R    +  GIIG L L G  +  FTY    
Sbjct: 409 LVVTRSKRLKPYIITGCSLWMVAMGILYHFRSGKDSDKGIIGGLVLWGLTSTLFTYPVTV 468

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRIS-DPTLAAQA 529
           S+Q S  +H  MA VT+L    Y I            WT +L +++ K ++ D TLA  A
Sbjct: 469 SLQ-SITSHENMASVTALNYTIYRIGGAVASAASGAIWTQLLYKKLLKEMNGDATLATAA 527

Query: 530 YGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA 589
           YGSPF FI+ Y WGTP R A+V SYRYVQK   ++ L+F  P+   ++ LR+  LTD  A
Sbjct: 528 YGSPFDFILDYPWGTPMRDAMVESYRYVQKYEVLVALIFTVPMFILSMFLRDPPLTDDQA 587

Query: 590 LEG 592
            E 
Sbjct: 588 QEN 590

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score =  465 bits (1197), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 245/587 (41%), Positives = 350/587 (59%), Gaps = 17/587 (2%)

Query: 22  IPEKEAGTTVDVNPTLTISSPAPSYIELIDP-GVHNIEIYAEIYNRPLYRVALFFSLFLI 80
           + EK+AG T D+N         P Y++      +   EI AE Y+   +RV L FS FL 
Sbjct: 37  VDEKQAGPT-DLN-----EYGIPDYLKSSKSLTIRKTEILAEQYSSWQWRVVLLFSAFLC 90

Query: 81  AYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILV 140
            Y YGLDGN+R  +  +AT+SYS HSLLST+  +  V+ A  QI +ARLSD++GRF++ V
Sbjct: 91  GYGYGLDGNLRSFYTTWATNSYSTHSLLSTIGVVNAVMGAASQIVYARLSDVYGRFTLFV 150

Query: 141 ISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP 200
            +++FY++GT+IESQA ++ R+A G  FY +G  G+ILI+ +I SDFS+L WRL   F+P
Sbjct: 151 TAIVFYVVGTIIESQAHDVQRYAAGAVFYNIGYVGVILIVLLILSDFSSLKWRLFYSFVP 210

Query: 201 ALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARK-HAKD 257
             PFIINTWISGN+        NW W I MWAFI PL+C+PL  CMLHM++ AR+  A  
Sbjct: 211 TWPFIINTWISGNIVDVAKPEQNWSWDIAMWAFIFPLSCLPLLGCMLHMKWRARQTEAWK 270

Query: 258 RLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHI 317
            L  +             + + FWKLD+IG+  +    GC+LVP TLAGG+  +W   HI
Sbjct: 271 ELSSQKTYYQTHGLVQSLVQL-FWKLDVIGVFFMIIILGCILVPLTLAGGISNKWNNPHI 329

Query: 318 IVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMY 377
           I P ++G+V+ +P ++ WE K++R P+ P+ L++DRG              + M   Y+Y
Sbjct: 330 IAPFILGFVL-IPFFIAWESKWAREPIAPFKLLRDRGIWAALCIAFLINFIFTMAAGYLY 388

Query: 378 TVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLL 437
           T+L+VAV+ES+ SATRI+S+ +F S +        + +  R KPFI+ G S W+V+ G+L
Sbjct: 389 TILMVAVNESVTSATRISSVSTFTSTVFSPFFALFITRFTRLKPFIIAGCSLWMVAMGIL 448

Query: 438 VHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXX 497
            H+R    +  GIIG+L + G G   FTY    S+Q S  +H  MA VT+L    Y I  
Sbjct: 449 FHFRSGQNSDKGIIGALVVWGLGTTMFTYPVTVSLQ-SVTSHENMATVTALSYTMYRIGS 507

Query: 498 XXXXXXXXXXWTNILPREISKRIS-DPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRY 556
                     WT +L +++ + +  D TLAA  YGSP T+I  Y WGTP R  +V +YRY
Sbjct: 508 AVGSAVSGAIWTQLLYKQLLQHLDGDATLAASFYGSPLTYIAQYPWGTPVRDGVVQAYRY 567

Query: 557 VQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEG---SDYLESKD 600
           VQK   ++ LVF  PL   +L LR+  LT+ +A E     +Y++ +D
Sbjct: 568 VQKYEVLVALVFTAPLFVFSLCLRDPPLTNEVAHENIKQGEYVDVED 614

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score =  456 bits (1174), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 252/599 (42%), Positives = 357/599 (59%), Gaps = 17/599 (2%)

Query: 12  EEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRV 71
           E F  + + +  +   G +   +P   + S            +   E+ A  Y+R  + V
Sbjct: 6   EGFNVETLADEEKNNLGVSQHNDPIKKLQSTK-------SLNIRKTELMASCYDRWYHHV 58

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
            L F+ FL  Y YGLDGNIR  + +YA +SY+ H L+ST++ +  V++A  QIFFARLSD
Sbjct: 59  FLLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPLISTLSVVTGVMSAASQIFFARLSD 118

Query: 132 IFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
           +FGR S+ V ++ FY++GT+I+SQA +I R+AVG  F+ +G  GI+L+L +I SDFS+L 
Sbjct: 119 VFGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIGYVGILLMLILIVSDFSSLR 178

Query: 192 WRLLALFIPALPFIINTWISGNVT--SAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRY 249
           WRLL  F P+ P IINTWI+G +T  S     W W IGMWAFI+PL C+P+ LCMLHMR+
Sbjct: 179 WRLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWNIGMWAFIIPLTCLPMILCMLHMRF 238

Query: 250 LARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGL 308
            AR+  +   L+ E             I++ FWK+D++G+LL+TA  GCVL P TLAGG 
Sbjct: 239 KARRTEQWAELRNERSYYQTHGLIKTLIEL-FWKVDVVGILLMTASIGCVLAPLTLAGGT 297

Query: 309 KEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXX 368
             +W+   +I P V+G+V+ LP++++WE K++R P+ P+DLIKDR               
Sbjct: 298 GSKWQNPRVISPFVLGFVL-LPIFLIWEKKWARDPIIPYDLIKDRAVWASLNSQFLIGFI 356

Query: 369 WYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGIS 428
           + M   Y+Y +LIV V+ESIKSAT IT L SFV+          + +  R K +I+ G  
Sbjct: 357 YMMAAGYIYNILIVGVNESIKSATTITILSSFVATAASPPFCLWITRCTRMKGYIVAGCG 416

Query: 429 CWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSL 488
            W+++ GL  HYRG   AH GI+ ++ + G G     Y    S+Q SA +H  MA+VT+L
Sbjct: 417 LWMLAMGLFYHYRGGEFAHGGIVAAMVVWGLGDVLLIYPITVSVQ-SATSHDNMAMVTAL 475

Query: 489 YLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERI 548
              TY I            WT  L +E+ KR+ D TLA  AY  PF FI TYTWGTPER 
Sbjct: 476 NYTTYRIGLSTGSAISGAIWTQTLYKELFKRLGDATLAVSAYSDPFKFITTYTWGTPERE 535

Query: 549 ALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA---LEGSDYLESKDAFEP 604
           A+V +YR+VQ+   I+ LVF  PLL   L LR+  LTD +A   ++  +Y+ +KD  +P
Sbjct: 536 AVVQAYRHVQRYETIVALVFTVPLLIFVLFLRDPPLTDEVAHGSIKDGEYV-AKDHEDP 593

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score =  454 bits (1168), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 253/579 (43%), Positives = 352/579 (60%), Gaps = 31/579 (5%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A  Y+   YRV L FS F+  + YGLD NIRY +  YATSSY+QHSLLSTV  
Sbjct: 47  IRKTEILAAQYDSWYYRVILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAI 106

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  +++A  QIF+ARLSD+FGR S+ V+S++FY++GT+I+SQA ++ ++A G  FY +G 
Sbjct: 107 INNLLSAASQIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGY 166

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G+ LIL +I SD S+L WRL   + P  PFII TWISGN+ S      NW WGIGMWAF
Sbjct: 167 VGLFLILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIGMWAF 226

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLK--WKSFCIDIA----FWKLDI 285
           I PL C+P+  CMLHMR+ ARK       PE++ L+  K  +++  I  A    FWKLD+
Sbjct: 227 IFPLTCLPILFCMLHMRFKARK------TPEWQDLSSQKSFFQTHGIVQALVQLFWKLDV 280

Query: 286 IGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLT 345
           +G+ ++T   GC+LVP TLAGG   +W+ + II P V+G+V+ +P+++ WE K+++ PL 
Sbjct: 281 VGIFIMTISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVL-VPVFIYWESKWAKDPLA 339

Query: 346 PWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIV 405
           P++L+KDRG              + M   Y+Y VLIVAV ES KSATRITSL SFVS + 
Sbjct: 340 PFELLKDRGIWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSATRITSLASFVSTVA 399

Query: 406 GTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFT 465
              +G+ + +  R KP+I+ G   W ++ GLL HYR    +H+GIIG L LLG G     
Sbjct: 400 SPFMGYAVSRSTRLKPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLGLGCTLSI 459

Query: 466 YVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTL 525
           Y    S Q S  +H  MA VT+L    Y I            WT  L  ++ KR+ D TL
Sbjct: 460 YPINVSAQ-SLTSHENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLKRLGDATL 518

Query: 526 AAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLT 585
           A  AY +P++F++TY W TP R A+V +YR VQ++  +I L+F  PLL  +L LR+  LT
Sbjct: 519 AMSAYSAPYSFVLTYGWDTPVRQAVVEAYREVQRLEVLIALIFTAPLLLSSLFLRDPPLT 578

Query: 586 DSIALEG---------------SDYLESKDAFEPKEKEE 609
           D +  E                +D+L  K  F  +++++
Sbjct: 579 DQVGQENIKDGEYVATGYNDPITDWLTGKFKFLKRKRQD 617

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score =  447 bits (1149), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 238/567 (41%), Positives = 342/567 (60%), Gaps = 16/567 (2%)

Query: 47  IELIDPG----------VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQA 96
           +E + PG          +   EI A  Y+R  +   + FS F+  Y YGLDG++RY + +
Sbjct: 21  VEKVTPGCTLKTTKSLVIRKTEIMAAQYDRWYHHAIILFSAFICGYGYGLDGSVRYVYTS 80

Query: 97  YATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQA 156
           YA SSYS H L+ST+  +  +I+A  QI FARLSD+FGR S+ + +++FY +GT+I+SQA
Sbjct: 81  YAVSSYSDHPLISTITVVTAIISAASQIVFARLSDVFGRLSLFITALLFYAVGTIIQSQA 140

Query: 157 VNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTS 216
            ++ ++A G  F+  G  G++LIL +I SDFS+L WRL+  F P+ P+IINTW +G VT+
Sbjct: 141 TDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLRWRLVYQFAPSWPYIINTWFAGTVTA 200

Query: 217 AIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAK-DRLKPEFEALNKLKWKS 273
                 +W W I MWAFI+PL+ +P+  CMLHMR+ ARK  +   +K E           
Sbjct: 201 RANPQEHWSWDIAMWAFIVPLSALPMIFCMLHMRFKARKTEQWAAIKDEKSFFQSHGLIR 260

Query: 274 FCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYM 333
             +++ FWKLDI+G+LL+T   GC+L P TLAGG+K +W   H+I P V+G+V+ LPL+M
Sbjct: 261 TLVEL-FWKLDIVGVLLMTISVGCILAPLTLAGGVKSKWSNPHLIGPLVLGFVL-LPLFM 318

Query: 334 LWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATR 393
           +WE K +++P+ P+ LIKDR               +     Y+YT+LIVAV+ES+KSAT 
Sbjct: 319 IWESKAAKYPVVPYGLIKDRAVWGALGCQFLIGFIYNAVAGYIYTILIVAVNESVKSATV 378

Query: 394 ITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGS 453
           I+SL SFVS +  T     + +  + K +I+ G   W+++ GL  HYRG   AH+GI+G+
Sbjct: 379 ISSLSSFVSTVASTFFSLYITRCTKLKGYIIGGCGIWMLAMGLFYHYRGGEFAHSGIVGA 438

Query: 454 LCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILP 513
           + + G G     Y T  S+Q SA +H  MA VT+L    Y I            W+  L 
Sbjct: 439 MVIWGLGDTLLIYPTTISVQ-SATSHDNMATVTALNYTLYRIGLATGAAVSGAIWSQTLY 497

Query: 514 REISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLL 573
           + +  R+     A+ AY +PF FI+TYTWGTPER A+V +YR+VQ+   I+ LVF  PLL
Sbjct: 498 KALLSRLQSVEQASAAYSTPFEFILTYTWGTPERNAMVDAYRHVQRYESIVALVFTVPLL 557

Query: 574 GCALMLRNHKLTDSIALEGSDYLESKD 600
              L LR+  LTD +A E  D  E  D
Sbjct: 558 FFGLCLRDPPLTDKVAQEDIDDGEFLD 584

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score =  442 bits (1138), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 235/556 (42%), Positives = 340/556 (61%), Gaps = 18/556 (3%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A+ Y+    +    FS FL ++ YGLDGNIR  +  YA +SYS HSL+STV  
Sbjct: 54  IRKAELMAKQYDTWFLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGV 113

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  VI+AV Q+ +A LSD+FGR S+ ++S++FY++GT+I+SQA ++ R+A G  FY +GL
Sbjct: 114 ISMVISAVAQVIYAGLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGL 173

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNV--TSAIGTNWKWGIGMWAF 231
            G++L + ++ SD S+L WRL   F+PA P II TW+SGNV  T+    NW W I MWAF
Sbjct: 174 VGVMLQVILVLSDNSSLKWRLFYTFVPAWPSIITTWVSGNVIETANPEDNWSWNIAMWAF 233

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALN--KLKWKSF----CIDIAFWKLDI 285
           I PL+CIPL  CMLHMR+      K R +PE++ L   K  ++S      +   FWKLD+
Sbjct: 234 IFPLSCIPLIACMLHMRW------KVRNEPEWKELQTEKTYYQSHGLIQTVVQLFWKLDV 287

Query: 286 IGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLT 345
           +G++L+T   GC+LVP TLAGG+  +W++A +I P V+G+V+ + +++ WE K +  P+ 
Sbjct: 288 VGIILLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLGFVL-IAIFIYWESKLALAPIA 346

Query: 346 PWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIV 405
           P+ ++KDRG              + M   Y+YT+L+VAV E+  SATRITSLYSFVS I 
Sbjct: 347 PFKMLKDRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSFVSAIF 406

Query: 406 GTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFT 465
             +LGFI+ +  R KP+++ G S + V+ GL   YR    AH G+IG++ + G  +  F 
Sbjct: 407 APVLGFIVARSSRLKPYMVLGCSLYFVTMGLFYRYRVGKDAHQGVIGAMVVWGICSCLFD 466

Query: 466 YVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTL 525
           Y    SIQ S  +H  MA VT+L    ++I            WT +L  ++ + I D  L
Sbjct: 467 YPVTVSIQ-SVTSHENMATVTALSYTIFSIGGAVAASVSGAIWTQLLYPKLLEYIGDADL 525

Query: 526 AAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLT 585
           A  AY SP TF + Y WGTP R A+V +Y++VQK   +I LVF  P+      LR+  LT
Sbjct: 526 AEAAYSSPLTFYLDYPWGTPIRDAMVEAYKHVQKYEVLIALVFTAPMFILTFCLRDPSLT 585

Query: 586 DSIA--LEGSDYLESK 599
           D +A  L   +Y+E+ 
Sbjct: 586 DDVAQKLNDGEYVETS 601

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score =  434 bits (1115), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 226/551 (41%), Positives = 327/551 (59%), Gaps = 6/551 (1%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A+ Y+    +     + F+ ++AYGLD  IR  +  YA   Y++HSLLSTVN 
Sbjct: 53  IRKSELMAKQYDSWFSKSVFLLAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           +  +I+AVGQIFFA LSD+FGR S+ V+++IFY++GT+I+SQA ++ R+  G  FY +GL
Sbjct: 113 VSLMISAVGQIFFAGLSDVFGRLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGL 172

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNV--TSAIGTNWKWGIGMWAF 231
            G I  + +I SD S+L WRL   F+PA P  +  WISGNV   +    NW WGIGMW F
Sbjct: 173 VGAIFQVTIILSDCSSLKWRLFYNFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGF 232

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I P +C+PL  CMLHMR+  +   + +   E ++  +       +   FWKLD+ G+LL+
Sbjct: 233 IFPASCLPLIACMLHMRWKVKNDREWKELQEEKSYFQTHGVVQSLVQLFWKLDVAGVLLL 292

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIK 351
           TA  GC+LVP T+AGG+  +WR+A +I P V+G+ + +P+++ WE + +  PL P+ ++K
Sbjct: 293 TACTGCILVPLTIAGGVSAQWRSAKVIAPFVLGFAL-VPVFLYWESRIALVPLAPFKMLK 351

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M   Y+YTVL+VA +ES  SATRITSLYSFV+ I   ILG 
Sbjct: 352 DRGIWAPLAIMFLICFIYQMAAGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPILGV 411

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KP+ L G S + V+ GL  HYRG   A  GIIG++ + G  +  + Y    S
Sbjct: 412 LVARSTRLKPYTLVGCSLYFVTMGLFYHYRGGEDAGKGIIGAMVVWGISSCLYDYPISIS 471

Query: 472 IQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYG 531
           +Q +  +H  MA VT+L L  + I            WT  L  ++ K + DP +AA+AY 
Sbjct: 472 MQ-TVTSHEMMATVTALNLTIFRIGGAVGAAVSGAIWTQALYPKLLKLLGDPEMAAKAYD 530

Query: 532 SPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA-- 589
            P TFI  Y WGT  R A V +YRYVQK   ++GL+F  P+      LR+  LT+     
Sbjct: 531 EPLTFIPDYEWGTSVRDATVEAYRYVQKYEVLVGLIFVAPMFVLTFFLRDPSLTEEYGQN 590

Query: 590 LEGSDYLESKD 600
           LE  +Y++  D
Sbjct: 591 LEDDEYVKEND 601

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score =  431 bits (1108), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 221/537 (41%), Positives = 330/537 (61%), Gaps = 6/537 (1%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A  YN    +V      FL AY Y LD +IRY +  YAT+SY+ HSLLST++ 
Sbjct: 57  IRKTEIMASQYNTWYSQVLFLSCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTISI 116

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  +I+AV Q+FFA LSD+FGR  +++++++FY++GTVI+SQA +I R+A G  FY +G+
Sbjct: 117 INMMISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAYDIQRYAAGSVFYNIGV 176

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G++L + +  +D S+L WRLL  F+PA P IIN W+SGN+  A     NW W I MWAF
Sbjct: 177 VGVMLQVSLFLADNSSLKWRLLYSFVPAWPAIINMWVSGNIVKAANPLVNWSWNIAMWAF 236

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           ILPL+C+PL  C++HMR+ A K  +   L+ E     K  +    +++ FWK+DI+G+LL
Sbjct: 237 ILPLSCVPLLCCVVHMRWKASKTPEWQELESELTFYQKHGFVHTIVEV-FWKVDIVGLLL 295

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           +TA  GC+LVP T+AGG+ E+W    II P V+G V  +PL + WE  +++ P  P+ L+
Sbjct: 296 LTASMGCILVPLTIAGGISEQWNNGKIIGPLVLG-VFLVPLTIYWESNWAKVPFAPFLLL 354

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              + M   Y+YT+L+V+++++  SATRI +LYSFV+ I   I G
Sbjct: 355 KDRGIWAPMSIMFLVCFIYQMAAGYLYTILLVSMNQTELSATRIMNLYSFVAGIYSPIFG 414

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
           F++ +  R K F+L G   + +  GL   YRG  GA +GIIG++ + G  +  +TY    
Sbjct: 415 FVVARTGRLKSFMLVGCCLYFLVMGLFYRYRGGLGAESGIIGAMVVWGIASCMYTYPVTT 474

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           S Q S  +H  MA VT++ L  + I            WTN+L  ++ + + D  LA+ AY
Sbjct: 475 SAQ-SVTSHENMATVTAMLLTIFRIGGAVGASVSGAIWTNLLYPKLLQNLGDVELASAAY 533

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDS 587
            +P TFI+++ W T  R A++ +YR+VQK   ++GL+F  P+L     LR+ +LTD 
Sbjct: 534 TAPLTFIVSHPWNTEVRTAMIDAYRHVQKYEVLVGLIFVAPMLVLTFCLRDPELTDD 590

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score =  424 bits (1091), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 217/551 (39%), Positives = 324/551 (58%), Gaps = 6/551 (1%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A+ Y+    +    F++F+ ++AYGLD  IR  +  YA ++Y  HSLLSTVN 
Sbjct: 53  IRKAELMAKQYDSWFLKSLFLFTVFICSFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  VI+AVGQIFFARLSD+FGR S+ ++S++ Y++GTVI+SQA ++ R+A G  FY +GL
Sbjct: 113 ISMVISAVGQIFFARLSDVFGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAAGSVFYNVGL 172

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G +  + +I SD S L WRL   F+PA P II  WISGNV        NW WGI MWAF
Sbjct: 173 VGAMFQVTLILSDCSTLKWRLFYNFVPAWPAIITVWISGNVVHVANPLENWSWGIAMWAF 232

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I P++CIP   C+LHMR+  R   + R   E ++  +           FW+LD++G++L+
Sbjct: 233 IFPVSCIPFIACILHMRWKVRNSHEWRELQEEKSFYQTHGLVQTFVQLFWRLDVVGVILL 292

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIK 351
           + F GC+ VP T+AGG+  EWR+  +I P V+G+ + +P ++ WE + +R PL P+ ++K
Sbjct: 293 SVFTGCICVPLTVAGGVSTEWRSGKVIAPFVLGFSL-IPAFVYWESRLARFPLAPFLMLK 351

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M  +Y+YT+L+VA +ES  SA RITSLYSFV+ I   I+G 
Sbjct: 352 DRGIWAPLWIYFLIAFIYEMAAEYLYTILLVAANESDLSAIRITSLYSFVAAIFSPIVGL 411

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KP+ + G S + V+ GL  HYRG + A  G+IG++ + G  +  + Y    S
Sbjct: 412 LVARSSRLKPYTVVGCSLYFVTMGLFYHYRGGNDAGKGVIGAMVVWGITSCLYDYPISVS 471

Query: 472 IQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYG 531
           IQ +  +H  +A V++L    + I            WT  L  ++ K + D  +A  A+ 
Sbjct: 472 IQ-TVTSHENLANVSALSSTIFRIGGAVGAAVSGAIWTQTLYPKLLKALGDAGMAEAAFN 530

Query: 532 SPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA-- 589
           SP  FI  Y WGTP R A V +++YVQK   ++GL+F  P+      LR+  L +     
Sbjct: 531 SPLDFITDYDWGTPVREATVEAFQYVQKYEVLVGLIFVVPMFVMTFFLRDPPLNEEFGQN 590

Query: 590 LEGSDYLESKD 600
           L G +Y++  D
Sbjct: 591 LNGEEYVKEND 601

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  424 bits (1089), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 228/552 (41%), Positives = 325/552 (58%), Gaps = 8/552 (1%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A+ Y+    +    FS F+  +AYGLD +IR T+  YA +SYS HSL+STV+ 
Sbjct: 53  IRKSELMAKKYDTWQLKAIFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  +I+AV Q+ F  LSDIFGR ++ ++S++ YI+GT+I+SQA ++ R+A G  FY +GL
Sbjct: 113 IVLMISAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGL 172

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G++L + ++ SD S+L WRL    IP+ P II TW+SG+V  A     NW W I MWAF
Sbjct: 173 VGVMLQVVLMLSDNSSLKWRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAF 232

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I PL CIPL LCMLHMR+  R   +   L+ E             + + FWKLD++G+LL
Sbjct: 233 IFPLCCIPLILCMLHMRWKVRNDVEWKELQDEKSYYQTHGLVQMLVQL-FWKLDVVGVLL 291

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
            TA  GC+LVP TLAGG+   WR + II P V+G+V+ +P ++ WE + +  P  P+ L+
Sbjct: 292 FTAGVGCILVPLTLAGGVSTNWRNSKIIGPFVLGFVL-VPGFIYWESRLALVPFAPFKLL 350

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              + M   Y+YT+L+VAV ES  SATRI +LYSFV+ +V   LG
Sbjct: 351 KDRGVWAPLGIMFFICFVYQMAAGYLYTILVVAVDESASSATRIINLYSFVTAVVAPFLG 410

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
            I+ +  R K +I+FG S + ++ GL   YR    A  GII  + + G  +  F Y T  
Sbjct: 411 LIVTRSSRLKSYIIFGGSLYFITMGLFYRYRSGQDADGGIIAGMVIWGLSSCLFDYPTIV 470

Query: 471 SIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAY 530
           SIQ S  +H  MA VT+L    + I            WT  L  ++   + D  LA  AY
Sbjct: 471 SIQ-SVTSHENMATVTALNYTVFRIGGAVAAAISGAIWTQSLYPKLLHYMGDADLATAAY 529

Query: 531 GSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA- 589
           GSP TFI++  WGTP R A+V +YR+VQK   I+ LVF  P+      +R+ +LT+  A 
Sbjct: 530 GSPLTFILSNPWGTPVRSAMVEAYRHVQKYEVIVALVFSAPMFLLTFCVRDPRLTEDFAQ 589

Query: 590 -LEGSDYLESKD 600
            L   +Y+++K+
Sbjct: 590 KLPDREYVQTKE 601

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  420 bits (1080), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 231/611 (37%), Positives = 344/611 (56%), Gaps = 28/611 (4%)

Query: 10  LPEEFTEDIVPEIPEKEA---GTTVDVNPTLTISSPAPSYIELIDP-------GVHNIEI 59
           +PE   E+  P +    +   G TV V      +  A S  +L D         +   E+
Sbjct: 1   MPEYQQENPSPNLGSTSSETNGKTVIVETEKQFTKEAESEHKLADKLQITKRIVIRKSEL 60

Query: 60  YAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIA 119
            A  Y+    +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ I   I+
Sbjct: 61  MANQYDNWFLKSLFLFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLLSTVSVISLTIS 120

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV QIFFA LSD+FGR SI ++++ FY++GT+I+SQA ++ R+A G  FY +GL G +  
Sbjct: 121 AVAQIFFAGLSDVFGRLSIFIVAIAFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAMFQ 180

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLAC 237
           + ++ SD S+L WRL   F+PA P ++  WISGNV        NW WGI MWAFI P AC
Sbjct: 181 VTLMLSDSSSLKWRLFYNFVPAWPALVTVWISGNVIHLANPKQNWSWGIAMWAFIFPAAC 240

Query: 238 IPLGLCMLHMRYLARKHAKDRLKPEFEALNKLK--WKSF----CIDIAFWKLDIIGMLLI 291
           +P+  C+LHMR+      K R  PE++ L + K  +++      +   FWKLD++G+LL 
Sbjct: 241 LPIIGCLLHMRW------KLRNDPEWKDLQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIK 351
           +   GC+L+P T+AGG    WR+A +I P V+G V+ +P ++ WE K +  PL P+ ++K
Sbjct: 295 SVSTGCILIPLTVAGGASTHWRSAKVIAPIVLGSVL-VPAFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   ++G 
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG      G+IG++ + G  +  F Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGVDTGKGVIGAMVIWGITSCFFNYPINIS 473

Query: 472 IQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYG 531
           +Q +  +H  MA VT+L L  + I            WT  L   + K + DPT+A +AY 
Sbjct: 474 MQ-TVTSHENMATVTALGLTIFRIGGAVGAAVSGAIWTQTLYPRLLKALGDPTMATEAYN 532

Query: 532 SPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA-- 589
            P +F++ + WGT  R A+V SYRYVQ+   ++GL+F  P+     +LR+  LT+     
Sbjct: 533 MPLSFMLKHEWGTAARDAMVDSYRYVQRYEVLVGLIFVAPMFVLTFLLRDPPLTEDYGQR 592

Query: 590 LEGSDYLESKD 600
           LE ++Y++  D
Sbjct: 593 LEDNEYVKHDD 603

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  419 bits (1078), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 215/551 (39%), Positives = 323/551 (58%), Gaps = 6/551 (1%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+  L +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ 
Sbjct: 55  IRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ +++++FY++GTVI+SQA ++ R+A G  FY +GL
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGL 174

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G +  + ++ SD S+L WRLL  F+PA P ++  WISGNV        NW WGI MWAF
Sbjct: 175 VGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAF 234

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I P  C+P+  C+LHMR+  R +++ +   E +   +       +   FWKLD++G+LL 
Sbjct: 235 IFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIK 351
           +   GC+L+P T+AGG    WR+A +I P V+G ++ +P ++ WE K +  PL P+ ++K
Sbjct: 295 SVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLL-VPFFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   ++G 
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINIS 473

Query: 472 IQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYG 531
           +Q +  +H  MA VT+  L  + I            WT  L   + K + DPTLA +AY 
Sbjct: 474 MQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYN 532

Query: 532 SPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA-- 589
            P +F++ + WGTP R A++ +YRYVQK   ++GL+F  P+      LR+  LT+     
Sbjct: 533 MPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQK 592

Query: 590 LEGSDYLESKD 600
           LE  +Y++  D
Sbjct: 593 LEDDEYVKHDD 603

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  419 bits (1078), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 215/551 (39%), Positives = 323/551 (58%), Gaps = 6/551 (1%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+  L +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ 
Sbjct: 55  IRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ +++++FY++GTVI+SQA ++ R+A G  FY +GL
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGL 174

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G +  + ++ SD S+L WRLL  F+PA P ++  WISGNV        NW WGI MWAF
Sbjct: 175 VGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAF 234

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I P  C+P+  C+LHMR+  R +++ +   E +   +       +   FWKLD++G+LL 
Sbjct: 235 IFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIK 351
           +   GC+L+P T+AGG    WR+A +I P V+G ++ +P ++ WE K +  PL P+ ++K
Sbjct: 295 SVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLL-VPFFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   ++G 
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINIS 473

Query: 472 IQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYG 531
           +Q +  +H  MA VT+  L  + I            WT  L   + K + DPTLA +AY 
Sbjct: 474 MQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYN 532

Query: 532 SPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA-- 589
            P +F++ + WGTP R A++ +YRYVQK   ++GL+F  P+      LR+  LT+     
Sbjct: 533 MPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQK 592

Query: 590 LEGSDYLESKD 600
           LE  +Y++  D
Sbjct: 593 LEDDEYVKHDD 603

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score =  417 bits (1073), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/555 (38%), Positives = 326/555 (58%), Gaps = 14/555 (2%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+    +    FS F+ A++YGLD  IR  +  YA +SYS HSLLSTV+ 
Sbjct: 53  IRKTELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHSLLSTVSV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ +++++FY++GT+I+SQA ++ R+A G  FY +GL
Sbjct: 113 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGSIFYYIGL 172

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G +  + +I SD S+L WRL   F+PA P ++  WISGNV S      NW WGI MWAF
Sbjct: 173 VGSMFEITLILSDCSSLKWRLFYSFVPAWPALVTVWISGNVVSVANPLENWSWGIAMWAF 232

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK----DRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I P +C+P+  C+LHMR+  R + +       K  F+    ++     +   FWKLD++G
Sbjct: 233 IFPASCLPIIGCLLHMRWKLRNNPEWIELQEEKTYFQTHGLVQ----TLKQLFWKLDVVG 288

Query: 288 MLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPW 347
           +LL +   GC+LVP TLAGG   +WR+A +I P V+G+++ +P+++ WE K +  PL P+
Sbjct: 289 VLLFSISTGCILVPLTLAGGASTQWRSAKVIAPFVLGFLL-VPVFIYWESKLALVPLAPF 347

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGT 407
            ++KDRG              + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   
Sbjct: 348 KMLKDRGIWAPLVITFLICYIYMMAAGYLYTILVVAGNESPLSATRITSLYSFVAAVFSP 407

Query: 408 ILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYV 467
           ++G  + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y 
Sbjct: 408 VVGIFVARFTRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVIWGITSCFFNYP 467

Query: 468 TQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAA 527
              S+Q +  +H  MA VT+  L  + I            WT  L   + K + DP +A 
Sbjct: 468 INISMQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKTLGDPNMAI 526

Query: 528 QAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDS 587
           +AY  P +F++ + WGT  R  +V +YRYVQ+   ++GL+F  P+      LR+  LT+ 
Sbjct: 527 EAYSMPLSFVLKHEWGTSAREGMVEAYRYVQRYEVLVGLIFVAPMFLLTFFLRDPPLTED 586

Query: 588 IA--LEGSDYLESKD 600
               L+ ++YL+  D
Sbjct: 587 YGQKLDDNEYLKQDD 601

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  416 bits (1069), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 220/557 (39%), Positives = 329/557 (59%), Gaps = 18/557 (3%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+  + +    FS F+ +++YGLD  IR  +  YA ++Y  HSLLSTVN 
Sbjct: 55  IRKSELMANQYDNWVLKSLFLFSAFICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR SI +++++FY++GT+I+SQA ++ R+A G  FY +GL
Sbjct: 115 ISMTISAVAQIFFAGLSDVFGRLSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIGL 174

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            G +  + ++ SD S+L WRL   F+PA P ++  WISG+V +      NW WGI MWAF
Sbjct: 175 VGAMFQVTLMLSDSSSLKWRLFYNFVPAWPAVVTVWISGDVINVANPKQNWSWGIAMWAF 234

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLK--WKSF----CIDIAFWKLDI 285
           I P  C+P+  C+LHMR+      K +  PE++ L + K  +++      +   FWKLD 
Sbjct: 235 IFPATCLPIIGCLLHMRW------KLKNDPEWKDLQEKKTYFQTHGLVQTLKQLFWKLDA 288

Query: 286 IGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLT 345
           +G+LL +   GC+LVP T+AGG+  +WR+A II P V+G V+ L +++ WE K +  PL 
Sbjct: 289 VGVLLFSVSTGCILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVL-VFIYWESKLALVPLA 347

Query: 346 PWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIV 405
           P+ ++KDRG              + M  DY+YT+L+VA +ES  SATRITSLYSFV+ ++
Sbjct: 348 PFKMLKDRGIWAPLLLMFLVCFVYVMPADYLYTILLVAGNESSLSATRITSLYSFVTAVL 407

Query: 406 GTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFT 465
               G ++ +  R KPF  FG + + V+  L   +RG      G+IG++ + G  +  F 
Sbjct: 408 SAAAGILVTRFPRLKPFAFFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVWGVASCFFD 467

Query: 466 YVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTL 525
           Y    S+Q +  +H  MA VT+L LA + I            WT  L   + K + DP +
Sbjct: 468 YPINISMQ-TVTSHENMATVTALGLAIFRIGGAVGAAVSGAIWTQTLYPRLLKTLGDPDM 526

Query: 526 AAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLT 585
           A +AY  P +F++ + WGTP R A+V SYRYVQK   ++GLVF  P+      LR+  LT
Sbjct: 527 AIEAYDMPLSFMLEHEWGTPVREAMVDSYRYVQKYEVLVGLVFVAPMFLLTFCLRDPPLT 586

Query: 586 DSIA--LEGSDYLESKD 600
           +     LE ++Y++  D
Sbjct: 587 EDYGQRLEDNEYVKHDD 603

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score =  407 bits (1046), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 237/619 (38%), Positives = 344/619 (55%), Gaps = 19/619 (3%)

Query: 21  EIPEKEAGTTVDVNPTLTISSPAPSYIELIDPG--VHNIEIYAEIYNRPLYRVALFFSLF 78
           E    E   T++   T   +    +  E  D    +  IEI   +Y+   +   L F  F
Sbjct: 62  EQKNNEKFNTIEHTSTEGTNPKYDTTYEEFDSKRIIKEIEIMKSVYDTWYFHALLLFGAF 121

Query: 79  LIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSI 138
           + +Y Y LD  +R  ++ YA SSY +HSL+ST+N I +V +A  Q+ ++R SDIFGR S+
Sbjct: 122 ICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASDIFGRLSL 181

Query: 139 LVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALF 198
           L++++I Y++GT+I+SQA +I R+  G  FY LG  G+ L++ +I SD+S+L WR     
Sbjct: 182 LLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLKWRFFYQA 241

Query: 199 IPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAK 256
           I A P IIN WISG +        +W W IGMWAFI PL+CIP+  C++HM++LA +  +
Sbjct: 242 ILAWPNIINDWISGIIVDRANPIKHWSWDIGMWAFIFPLSCIPILCCLIHMQWLASQTDE 301

Query: 257 -DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTA 315
             +LK          +K   ID+ FW+ D++G++L+ AF G +L+P TLAGG K  W   
Sbjct: 302 WKQLKKGKSYFKYYGYKDSLIDM-FWRFDVVGVILLAAFIGLILIPLTLAGGTKSRWSEG 360

Query: 316 HIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDY 375
            +I P VIG  V +P + +WE  +++HP+ PW LIKDR               + +  DY
Sbjct: 361 KLIAPFVIG-CVMVPCFAIWEKWFAKHPIMPWRLIKDRSIWAALTLSLVYKFVFAVAQDY 419

Query: 376 MYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFG 435
           MY++L+VAV ESIKSAT I  ++SFVS +      +    V R KPFI  G   +++S G
Sbjct: 420 MYSLLLVAVDESIKSATTIGLIHSFVSSVGSPFFSYGTTFVGRLKPFIFLGTLLYMLSLG 479

Query: 436 LLVHYRGDSGAHAGIIGSLCLLG-----FGAGSFTYVTQASIQASAKTHARMAIVTSLYL 490
           LL +YRG   AH+GIIG+LC++G     F     T +TQAS+ +     A MA VT+L L
Sbjct: 480 LLYYYRGGKWAHSGIIGALCVVGGLQLLFFITPLTVITQASVSS-----ADMANVTALIL 534

Query: 491 ATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIAL 550
              NI            WT  L +E+ KR+ + TLA +AY SP +FI  Y+WGTP R  +
Sbjct: 535 TFDNIGTGIGAAVSGAIWTQTLYKELFKRMKNKTLAKKAYSSPLSFIANYSWGTPVRNIM 594

Query: 551 VMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSI--ALEGSDYLESKDAFEPKEKE 608
           V SYR VQ+   I+ + FC PL+     LR+  L  S    LE   +++  D+    +  
Sbjct: 595 VESYRSVQRYEIIVAISFCAPLVLLTFALRDINLNRSTDADLEDGKHVKMTDSDPIFDFF 654

Query: 609 ETFLKSKFLSQFTGKNKEN 627
                  F S   GK  +N
Sbjct: 655 ANIFNKIFHSSPRGKKSDN 673

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  393 bits (1010), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 201/413 (48%), Positives = 275/413 (66%), Gaps = 19/413 (4%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI + +Y++  + V L FS F+  YAYGL+ NIRY +  YATSSY++HSLLSTVN 
Sbjct: 49  IKKTEIMSAVYDKWYHHVILLFSAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLSTVNV 108

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI ++RLSD FGR ++ +I+++ Y++GT+I+SQA ++ R+A G  FY  G 
Sbjct: 109 INAVVSAASQIIYSRLSDFFGRLTLFIIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGY 168

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAF 231
            GIILIL +I SDFS+L WRL   F P  PFIINTWISGNVTS+     +W W +GMWAF
Sbjct: 169 VGIILILLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNVTSSANPLVHWSWDVGMWAF 228

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKL 283
           I PLACIP+  CM+HM++ A K       PE+ AL     KSF         +   FWKL
Sbjct: 229 IFPLACIPMIGCMIHMQWKASK------TPEWHALRSE--KSFYQANGFYKTMTELFWKL 280

Query: 284 DIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHP 343
           DIIG LL TA  GC+LVP TLAGG   +W  + +I P V+G+V+ +P+  +WE K++R P
Sbjct: 281 DIIGTLLFTACLGCILVPLTLAGGTNSKWNNSRVIGPFVLGFVL-IPILGVWEYKWARDP 339

Query: 344 LTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSV 403
           L P+ L++DRG              +YM  DY+YTV++VAVHES+KSATRI++L SFVS 
Sbjct: 340 LIPYKLVRDRGVWAALGISFLIDFIFYMAADYLYTVMVVAVHESVKSATRISTLSSFVST 399

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCL 456
           +       ++ +  R KPFI+FG S W++S GLL ++RG   +H+GIIG+LC+
Sbjct: 400 VASPFFALLMTRCTRLKPFIIFGCSLWMLSMGLLYNFRGGEQSHSGIIGALCV 452

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score =  398 bits (1023), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/594 (36%), Positives = 333/594 (56%), Gaps = 20/594 (3%)

Query: 21  EIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLI 80
            +   E   T + + +       P+ +E    G    EI A  ++ P YR  +  + FL 
Sbjct: 7   SVSNSEKCVTNESSRSFEDEDANPANVEFSKLG--ESEIIAVQFDTPKYRALMIATAFLC 64

Query: 81  AYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILV 140
            + Y LD  +R T+  YAT+SY++HSLLST+  I  V++   Q+ F+RLSD FGR  + V
Sbjct: 65  GFGYSLDHTLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRVELFV 124

Query: 141 ISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP 200
            + I Y++GT+++SQA +++ +A G  FY  G  G+ L+L +I SDFS+L WR+L  ++P
Sbjct: 125 AATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVLLLILSDFSSLKWRILYQYVP 184

Query: 201 ALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDR 258
             PFII  WISGN+ +A     +W W I MWAFI PL+ +P+   +++M Y + K     
Sbjct: 185 YWPFIIIPWISGNIVTAANPEKDWSWDIAMWAFIFPLSALPMICLLVYMMYKSSK----- 239

Query: 259 LKPEFEALNKL----KWKSFCIDIA--FWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEW 312
             PE++AL +     K + F  +    FW+LD IG++LIT   GCVLVP TLA G+ ++W
Sbjct: 240 -TPEWKALKERTHIKKNQGFLKNTVFLFWELDSIGIILITVSLGCVLVPLTLANGVSQKW 298

Query: 313 RTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQ 372
            ++ II   V G V+   +++ WE  Y+++PL P+ L+ DRG              +++ 
Sbjct: 299 HSSKIIGTLVFGGVL-FCIFVFWETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFTFFIA 357

Query: 373 GDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIV 432
            D++Y VL+V+++ES  +ATRI +L  FV   +    G ++ K RR K  ++ G + W++
Sbjct: 358 CDFLYPVLLVSMNESSTTATRILNLPDFVGATLSPFYGILVAKARRLKFSVVGGCAAWMI 417

Query: 433 SFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLAT 492
           S GL   YRG S +H G I +  ++G      +     S+QA   TH RMA++TS+Y   
Sbjct: 418 SMGLFYQYRGGSESHGGAIAASVIMGMSGLLCSNSVIVSLQA-MTTHGRMAVITSIYFTF 476

Query: 493 YNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVM 552
             +            WT I+P ++ K  S+ TLA  AY SP+TFI  Y WG+PERIA+V 
Sbjct: 477 SKVGAAVGASVSGAVWTQIMPNQLRKAFSNDTLADAAYESPYTFIYEYPWGSPERIAVVE 536

Query: 553 SYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFEPKE 606
           +YRYVQ+I+  IGLV   P     L +R+ +L D    E  ++ E   A    E
Sbjct: 537 AYRYVQRIMMTIGLVCTIPFFAFTLFMRDPELIDKSTHE--EFTEDGLALSKDE 588

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score =  377 bits (969), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/572 (36%), Positives = 315/572 (55%), Gaps = 7/572 (1%)

Query: 58  EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI +  ++   Y++ L  + F+  +   LD  +R T+  YAT+SYS+HSLLSTV  I  V
Sbjct: 47  EIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAV 106

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ ++RLSD FGR  + +++ IFYIMGT+I+SQA  +T +A G  FY  G  G  
Sbjct: 107 VSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTN 166

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPL 235
           L+L +I SDFS+L WR+   +    P+II  WISGN+ +A     NW W I MWAFI PL
Sbjct: 167 LLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPL 226

Query: 236 ACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFF 295
           + +P+   +L+M+Y + K A+ R   E     +       +   FWKLDI+G+LLIT   
Sbjct: 227 STLPIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSL 286

Query: 296 GCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+LVP TLA    ++W  + II   V G  +   +++ WE K+++ PL P+ L+ DRG 
Sbjct: 287 GCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGI 345

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        +++  DY+Y VL+V++ ES  SA RI +L  FV+         ++ K
Sbjct: 346 WAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAK 405

Query: 416 VRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQAS 475
            R+ K  ++ G + W+V  GL   YRG SG+H G+I +  ++G  +G     +   I  +
Sbjct: 406 TRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSVIVILQA 464

Query: 476 AKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFT 535
             TH+RMA++T +      +            WT  +P ++ K + + TLA  AY SP+T
Sbjct: 465 MTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIAYASPYT 524

Query: 536 FIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDY 595
           FI  Y WG+PER A+V SYRYVQ+I+  +GL    P     + +RN +L D    E  ++
Sbjct: 525 FISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFTFTMFMRNPELIDKATHE--EF 582

Query: 596 LESKDAFEPKEKEETFLKSKFLSQFTGKNKEN 627
            E      P E E  F + K L +    NK++
Sbjct: 583 TEDGLVVLPDE-ENIFSQIKALFRHNRSNKKS 613

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score =  377 bits (967), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/571 (36%), Positives = 314/571 (54%), Gaps = 7/571 (1%)

Query: 58  EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI +  ++   Y++ L  + F+  +   LD  +R T+  YAT+SYS+HSLLSTV  I  V
Sbjct: 47  EIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAV 106

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ ++RLSD FGR  + +++ IFYIMGT+I+SQA  +T +A G  FY  G  G  
Sbjct: 107 VSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTN 166

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPL 235
           L+L +I SDFS+L WR+   +    P+II  WISGN+ +A     NW W I MWAFI PL
Sbjct: 167 LLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPL 226

Query: 236 ACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFF 295
           + +P+   +L+M+Y + K A+ R   E     +       +   FWKLDI+G+LLIT   
Sbjct: 227 SALPIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSL 286

Query: 296 GCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+LVP TLA    ++W  + II   V G  +   +++ WE K+++ PL P+ L+ DRG 
Sbjct: 287 GCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGI 345

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        +++  DY+Y VL+V++ ES  SA RI +L  FV+         ++ K
Sbjct: 346 WAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAK 405

Query: 416 VRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQAS 475
            R+ K  ++ G + W+V  GL   YRG SG+H G+I +  ++G  +G     +   I  +
Sbjct: 406 TRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSVIVILQA 464

Query: 476 AKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFT 535
             TH+RMA++T +      +            WT  +P ++ K + + TLA  AY SP+T
Sbjct: 465 MTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIAYASPYT 524

Query: 536 FIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDY 595
           FI  Y WG+PER A+V SYRYVQ+I+  +GL    P     + +R+ +L D    E  ++
Sbjct: 525 FISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFAFTMFMRDPELIDKATHE--EF 582

Query: 596 LESKDAFEPKEKEETFLKSKFLSQFTGKNKE 626
            E      P E E  F + K L +    NK+
Sbjct: 583 TEDGLVVLPDE-ENIFSQIKALFRHNRSNKK 612

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score =  376 bits (966), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 211/583 (36%), Positives = 325/583 (55%), Gaps = 14/583 (2%)

Query: 16  EDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFF 75
           E I  E  + + G++ +  P+LT         + +   V  +EI  ++ +  L RV L  
Sbjct: 12  EAIGLECSDLDGGSSSE-KPSLTKGDKGRQQYDYMK--VKEMEIIKDVCSGNLARVFLLA 68

Query: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S FL  +AY LD   R  +  YA +SY +HSLLST+  I +V+    QI FARLSD+FGR
Sbjct: 69  SAFLCGFAYYLDMVTRSVYTTYAANSYEKHSLLSTIQVINSVVGVGAQISFARLSDVFGR 128

Query: 136 FSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLL 195
             + V+  I Y++GT+I+SQA ++  +AVG  FY  G  G+ L+L ++ SD S L WRL 
Sbjct: 129 LQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRWRLF 188

Query: 196 ALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARK 253
             F  + P II +WISG++  A     NW W IGMWAFI PL+ +P    + +  +++ K
Sbjct: 189 YQFTASFPCIIISWISGDIVEAANPMKNWSWDIGMWAFIFPLSSLPFITYLFYATHISSK 248

Query: 254 HAK---DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKE 310
             K    R K E    N +      +   F ++DI+G +L+TA  G +LVP TLAGG+ E
Sbjct: 249 TKKWKDLRNKVETHKRNII----LVVKDIFNQIDIVGTVLVTAALGLILVPLTLAGGVSE 304

Query: 311 EWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWY 370
            W    II   VIG +  L +++ WE K++++   P++L+KDRG              + 
Sbjct: 305 RWHEPGIIATLVIG-IALLLVFLFWEAKFAKNAALPFNLLKDRGVWASIVAAFLEKMIYA 363

Query: 371 MQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCW 430
           M  DY+Y VL+V+V+E+ KSATRI  L +F++ +     G +++ V+R K F + G   W
Sbjct: 364 MISDYLYPVLLVSVNETNKSATRIVWLPTFMACLCSVFFGLLVVSVQRLKVFTICGTFLW 423

Query: 431 IVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYL 490
           I+S GL   +RG   +H+GIIG+  +LGFG+  FT     ++QA A +H  MA +T LY 
Sbjct: 424 IISIGLFYQFRGGESSHSGIIGASIVLGFGSAIFTQSIIVTLQAMA-SHDNMASITGLYF 482

Query: 491 ATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIAL 550
               +            WT  + +++ K++ D  L    + SP+ FI +Y WGT ER  +
Sbjct: 483 MFAQVGAATGASISGAIWTQTMYKQLLKQLKDSDLTMAVFASPYEFIASYAWGTKERDLV 542

Query: 551 VMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGS 593
           + +YR+VQK+  ++ L+   PLL   L  ++ KL+DS++ + S
Sbjct: 543 IQAYRHVQKVTMLVSLILTVPLLVSVLFTKDRKLSDSVSSDAS 585

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score =  374 bits (959), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/594 (34%), Positives = 320/594 (53%), Gaps = 8/594 (1%)

Query: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVN--PTLTISSPAPSYIELIDPGV-HNI 57
           MD    SR+   +  ED  P    KE  T  + N    L      P  +      V   +
Sbjct: 10  MDRKIQSRSSSFDNNEDSFPN-ANKENLTFAEENHKQELLDEYGVPDKLRANRSLVIRKM 68

Query: 58  EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI  + Y          F+ FL      L+  +R  +  YAT+SY  HSLLST+  + ++
Sbjct: 69  EIMRKQYTSVFAICVFLFTAFLAGVGTDLNSQLRNNYTTYATNSYRSHSLLSTIGVVSSI 128

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGII 177
           I+A     +ARLSD+FGR  + + +++F+++GT+I+SQA N+ ++A G  FY LG  GI 
Sbjct: 129 ISAGALTVYARLSDVFGRIRLYLSAMLFFVVGTIIQSQANNVQKYAAGTVFYSLGTAGIQ 188

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPL 235
           +++ +I SDFS+L WRL   F P  P +   WI+G++   +     W WGIGMWAFI PL
Sbjct: 189 VMMFIIMSDFSSLKWRLFFTFAPTWPNLFIPWITGSIVDRLDPVERWSWGIGMWAFIYPL 248

Query: 236 ACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFF 295
           + +P    +L +RY A K  + ++    +   +       +   FWK+D++G+LL  AF 
Sbjct: 249 SSVPFVAYLLLVRYKASKTEEWKMLSSEKTYYETHGIIQTLVQLFWKVDVVGLLLFVAFL 308

Query: 296 GCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+LVP TLAGG+  +W    I+ P ++G+ + +P ++LWE KY+R P+ P+ ++KDRG 
Sbjct: 309 GCILVPLTLAGGVSSQWSNGKILGPFILGFCL-VPAFILWETKYARLPIAPFKMLKDRGI 367

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        +Y+   Y+ T+L+VAV++S   A  I +++S V         + +++
Sbjct: 368 WSALIISMLAKTVYYLAAGYLLTILMVAVNQSRGMAAVIMNVWSVVGCGFSPFFSYFVVR 427

Query: 416 VRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQAS 475
           VRR KPFI+ G   W+VS GLL +YR    +  GIIG++ L G G+   T  T  S Q S
Sbjct: 428 VRRLKPFIIIGCGIWMVSMGLLYYYRSGEHSKGGIIGAMVLWGLGSTMITRTTVISSQ-S 486

Query: 476 AKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFT 535
              H  MA +T++ LA   I            WT  L  ++ + I DP +A + Y SP +
Sbjct: 487 ITAHENMATITAIMLAISRIGGGIGSAVSGAIWTQTLYAKLVETIGDPEIAKKVYQSPLS 546

Query: 536 FIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA 589
            I  Y WGTP R A+V +YR+VQ+   ++ ++   PL   +L LR+ +LTD +A
Sbjct: 547 AIRVYAWGTPTRDAIVEAYRHVQRFEVLVAMILVIPLFIASLCLRDPELTDEVA 600

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score =  360 bits (924), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/552 (35%), Positives = 310/552 (56%), Gaps = 17/552 (3%)

Query: 54  VHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           V  +EI +   +    R AL  S FL  + Y LD   R  +  YATSSY++H+LLST+  
Sbjct: 61  VKEMEIMSSTCSGKSARAALLASAFLCGFGYYLDYITRSVYTGYATSSYNEHALLSTIQV 120

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
           I +VI+   QI FA+LSDIFGR  + ++  + YI+GT+I+ +A +I  +AVG  FY  G 
Sbjct: 121 INSVISIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGY 180

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAI--GTNWKWGIGMWAF 231
            G+ ++L ++ SD S   WRLL  F  + P II  WISG++  +     NW++ IGMWAF
Sbjct: 181 VGVSILLIIVLSDLSPSKWRLLFQFATSWPCIIICWISGDIVQSANPAKNWRFDIGMWAF 240

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFW------KLDI 285
           + P++ +P    ++ + Y  R+ +K     E +  NK       + I +W       +D+
Sbjct: 241 LFPISALPF---IIFLLYFTRQASKTAEWKEIQGDNKEP----SVRIVYWIKSIYSNIDV 293

Query: 286 IGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLT 345
           +G  L+T   GC+LVP TLAGG+ ++W    II   V+G+ V+   ++ W++K++++ + 
Sbjct: 294 VGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIATIVVGF-VSFMFFLAWDIKFAKNAVL 352

Query: 346 PWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIV 405
           P+ L+KDRG              +    DY+Y VL+V+V+ES KSATRI  L +FV+   
Sbjct: 353 PFKLLKDRGVWASLAAALLEKLIYATISDYLYPVLLVSVNESSKSATRILWLPTFVACTG 412

Query: 406 GTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFT 465
               G ++++ +R K + + G+  WI+S GL  HYRG + +H+GIIG+  +LG G+  FT
Sbjct: 413 SIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYHYRGGASSHSGIIGASVVLGTGSAIFT 472

Query: 466 YVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTL 525
                ++Q +  +H  MA +T LY     I            WT  + +++ KR+ D +L
Sbjct: 473 QSLIVNLQ-TMTSHKNMASITGLYFMFAQIGSASGASISGAIWTQTMYKQLYKRLEDSSL 531

Query: 526 AAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLT 585
           AA A+ SP+ FI  Y WGTPER  ++ +YR VQK   ++ LV   PL    L  ++ KL 
Sbjct: 532 AATAFSSPYEFIELYPWGTPERTQMIYAYREVQKKTMLVSLVLTGPLFLLILFTKDRKLG 591

Query: 586 DSIALEGSDYLE 597
           D++  E +   E
Sbjct: 592 DNVTAETTQSDE 603

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score =  351 bits (901), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/598 (35%), Positives = 328/598 (54%), Gaps = 17/598 (2%)

Query: 2   DPSTASRALPEEFTEDIVPEIPEKEA-GTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60
           D  T  R+  +E  + I+ +I +      T  V P L I++   +  ++       +EI 
Sbjct: 18  DSETDKRSCKKE--QGIIHDIEKMTVVEETQPVGPNLEITARFSTKRKM-----KELEIV 70

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           +       ++  L  +  +  ++Y LD  +R T+  YAT+S+SQHSLL+T+N I +V++ 
Sbjct: 71  SSFCKEWHFQSILLVTAIVCGFSYNLDAVLRSTYTGYATNSFSQHSLLATINVINSVVSI 130

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
             Q+FFARLSD FGR  +     + YI+GT+++SQ+ N++ +A G  FY  G TG+ L++
Sbjct: 131 ASQLFFARLSDHFGRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGAVFYNAGYTGVRLLM 190

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACI 238
            ++ SDFS L WR   +  P   +II TW+SGN+        NW W I MWAFI PL  I
Sbjct: 191 TIMMSDFSTLGWRYFMIASPDWCYIIITWVSGNIIEISNPLENWSWDIAMWAFIFPLTTI 250

Query: 239 PLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCV 298
           PL   +++M Y A +   D  K E  ++ K       I   FW LDI G+LLI    GC+
Sbjct: 251 PLVGFLVYMFYKASR--TDEWK-ELRSVTKKMPTPVYIKEVFWNLDIPGVLLIAISLGCI 307

Query: 299 LVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXX 358
           L+P T++GG  EEW+ +  I    +G V+  P+++LWE K ++ P+     +KDRG    
Sbjct: 308 LIPLTVSGGETEEWKDSRNIGVLCLGSVL-FPIFLLWEGKIAKRPVLALTYLKDRGVWAP 366

Query: 359 XXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRR 418
                     + +  DY+Y VL+V  ++S  ++ RIT L SF  V++    G ++ + + 
Sbjct: 367 LAASFFMSNAYLIATDYLYAVLLVGFNQSESASQRITWLPSFAGVVITPFTGLLITRWKH 426

Query: 419 TKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKT 478
            K   + G   + ++FGL   YRG S   AGII     +GFG+G  TY    S+QA   +
Sbjct: 427 LKVLTITGCIFYYIAFGLFYRYRGGSTNVAGIIVGTIFMGFGSGISTYPLMVSLQA-VSS 485

Query: 479 HARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRI-SDPTLAAQAYGSPFTFI 537
           H ++AIVT+L+     +            WT ++ +EISKR+  +P +A  AY SP+TF+
Sbjct: 486 HTKIAIVTALFYTFEQVGRAVGSSISGAIWTQVMFKEISKRLPEEPEVALAAYASPYTFV 545

Query: 538 ITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKL-TDSIALEGSD 594
             Y W T +R+A+V +Y +VQKIL ++ L+   PL   A+M+R+ +L T  +AL  SD
Sbjct: 546 TKYGWETSQRMAVVGAYMHVQKILLLVALLMLCPLFLMAIMMRDAELSTSDVALSSSD 603

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score =  306 bits (785), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 250/439 (56%), Gaps = 5/439 (1%)

Query: 123 QIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
           Q+  ARLSD FGR  I + S + YI  +++ES A NI+ +  G   Y +G   + ++L V
Sbjct: 2   QLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAGAVLYNVGFCCVNIVLLV 61

Query: 183 IASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIG--TNWKWGIGMWAFILPLACIPL 240
           + SDFS+L WR+L  F P    ++  WISG+V ++IG   +W WGIG WAF  PLA +P 
Sbjct: 62  VMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKHWSWGIGFWAFSFPLASLPF 121

Query: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300
             CM++M Y  RK  + +L  + + LN+ K  +  + I F ++D IG L+ +   GCVLV
Sbjct: 122 ICCMVYMIYTTRKSDQWKLFNQEKPLNEAKLLTRVMRI-FHQVDFIGTLIFSVALGCVLV 180

Query: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           P TLAGG   +W  +  IVP V+G V+ +  Y++WE   + +P  P+ L+KDRG      
Sbjct: 181 PLTLAGGYSSKWSHSDSIVPLVVGSVLFV-FYIVWESFMASYPALPFKLLKDRGIWIPIL 239

Query: 361 XXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   +Y   DYMY VL+VA++ES KSAT I SL  FV+ +       +L    R K
Sbjct: 240 AGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVTTVASPFFAVLLRWTGRLK 299

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
            + + G + W+VS GL   YR   G+H G++ ++ LLG G     +    ++QA A  H 
Sbjct: 300 WYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVVLLGLGRTFTQFPLLTTMQARAP-HT 358

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540
           +MA VT L+    ++            WT  +P+++ K +    LA  AY SP+TFII+Y
Sbjct: 359 KMATVTGLFHVWGSVGSVVGASISGAVWTQKMPKKLLKMLGSNGLATAAYASPYTFIISY 418

Query: 541 TWGTPERIALVMSYRYVQK 559
            WGT ER+A+V++Y+ VQK
Sbjct: 419 PWGTSERLAVVLAYKNVQK 437

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score =  288 bits (738), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 164/441 (37%), Positives = 252/441 (57%), Gaps = 15/441 (3%)

Query: 153 ESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISG 212
            S   +++ +A G  FY  G  G+ LIL +I SDFS L WR+   +    P+II  W+SG
Sbjct: 8   NSLCKHVSIYAAGAVFYNCGYVGVSLILTLILSDFSTLKWRIFYQYSSYWPYIIIPWVSG 67

Query: 213 NVTSAIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLK 270
           N+ +A     NW W I MWAFI PL+ +PL  C++   YL  K  K    PE++AL +  
Sbjct: 68  NIITAAKPEKNWTWDIAMWAFIFPLSSLPL-YCLI--IYLKMKSVKT---PEWKALKERA 121

Query: 271 W---KSFCIDIAF--WKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGW 325
               + F  +I F  W+LD+IG++LIT   GC+LVP TLA G  E+WR++ II   V G 
Sbjct: 122 HSVKRGFFKNIIFLFWELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGG 181

Query: 326 VVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVH 385
           V+ L ++M WE  Y+ +PL P+ L+KDRG              +Y+  D++Y VL+V+++
Sbjct: 182 VLFL-IFMFWEASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFYIACDFLYPVLLVSMN 240

Query: 386 ESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSG 445
           ES  SA RI +L  FV+         ++ K +R K  ++ G + W++S GL   +RG  G
Sbjct: 241 ESSTSAARILNLPDFVASTASPFYSLLIAKSKRLKISVIVGCATWMLSMGLFYRFRGGYG 300

Query: 446 AHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXX 505
           +H G+I +  ++GF +G     +   +  +  TH+RMA++T ++     I          
Sbjct: 301 SHGGVISASVIMGF-SGLLCSNSVIVLLQAMTTHSRMAVMTGIHYTFSRIGAAVGASVSG 359

Query: 506 XXWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIG 565
             WT  +P  + K + + TLAA+AY SP++FI +Y WGT ER A+V +Y+YVQ+I+ I+G
Sbjct: 360 GVWTQTMPSRLYKLLGNDTLAAEAYESPYSFIDSYPWGTVERYAVVEAYKYVQRIMMIVG 419

Query: 566 LVFCFPLLGCALMLRNHKLTD 586
           L+   PL   +L +R+ +L D
Sbjct: 420 LICTIPLFAFSLFMRDPELID 440

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score =  261 bits (666), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 164/553 (29%), Positives = 284/553 (51%), Gaps = 23/553 (4%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           + AL  +LFL  Y  GL G I  + Q YA +S+ +HS + ++N +K+++A+V  + +AR+
Sbjct: 63  KTALLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARI 122

Query: 130 SDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    + +++ Y +G +I +     +    G    Q G +G  L+   +  D S 
Sbjct: 123 SDRFGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSG 182

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAIGTN-----WKWGIGMWAFILPLACIPLGLCM 244
           L  R  A+ I  +P IINTW+SGN+ S++  N     W+WG G++  I+P++ + L L  
Sbjct: 183 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPY 242

Query: 245 LHMRYLARKHAK---DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVP 301
           ++ +Y++ +  K    +LK + + L +  WK F  DI     ++IG++L TAF   VL+P
Sbjct: 243 VYAQYISWRSGKLPPLKLKEKGQTLRQTLWK-FADDI-----NLIGVILFTAFLVLVLLP 296

Query: 302 FTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXX 361
            T+AGG   +WR  HII   V+G  +   ++++WE+K++++P  P   + D         
Sbjct: 297 LTIAGGATSKWREGHIIAMIVVGGCLGF-IFLIWELKFAKNPFIPRVYLGDPTIYVALLM 355

Query: 362 XXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKP 421
                    ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G +L      K 
Sbjct: 356 EFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIAQLYNFLQSCTNIVVGIMLHFYPHPKV 415

Query: 422 FILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHAR 481
           F++ G    ++  GLL  YR      +G+IG+  ++G   G   +     + AS  TH  
Sbjct: 416 FVVAGSLLGVIGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THNE 474

Query: 482 MAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYT 541
           MA VT L ++ Y I            WT  L +E+ +R+   +L    Y SP  ++  Y 
Sbjct: 475 MATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGS-SLGMAIYKSPLNYLKKYP 533

Query: 542 WGTPERIALVMSYRYVQKILCIIGLVF-CFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600
            G+  R+ ++ SY  +Q++L I+ + F  F  + C   LR   +    +L      E ++
Sbjct: 534 IGSEVRVQMIESYSKIQRLLIIVSISFAAFNAVLC-FFLRGFTVNKKQSLSA----EERE 588

Query: 601 AFEPKEKEETFLK 613
             + K K++++L+
Sbjct: 589 KEKLKIKQQSWLR 601

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score =  226 bits (575), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 159/554 (28%), Positives = 272/554 (49%), Gaps = 33/554 (5%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           ++ L  +LFL  Y  GL G I  + Q YA +S+ +HS + ++N +K+++A+V  + +AR+
Sbjct: 62  KITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARM 121

Query: 130 SDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    + +++ Y +G +I +          G    Q G +G  L+   +  D S 
Sbjct: 122 SDRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSG 181

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAIGT-----NWKWGIGMWAFILPLACIPLGLCM 244
           L  R  A+ I  +P IINTW+SGN+ S++       NW+WG G++  I+P + + L L  
Sbjct: 182 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPY 241

Query: 245 LHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWK----LDIIGMLLITAFFGCVLV 300
            + +Y+  ++    L P      KL+ K   +    WK    +++IG++L +AF   +L+
Sbjct: 242 AYAQYIGWRNGT--LPPY-----KLREKGQNLRQTLWKIVEDINLIGVILFSAFLVLLLL 294

Query: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           P T+AGG   +WR  +II   V+G  +   ++++WE++++++P  P   + D        
Sbjct: 295 PLTIAGGATSKWREGYIIAMIVVGGCLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALL 353

Query: 361 XXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                     ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G IL      K
Sbjct: 354 MEFVWRLSLQIELEYLVTVLMVAFGESKLSAQRIAQLYNFLQSCTNIVVGIILHFYPHPK 413

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
            F++ G    ++  GLL  YR      +G+IG+  ++G   G   +     + AS  TH 
Sbjct: 414 LFVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THN 472

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540
            MA VT L ++ Y I            WT  L +E+ +R+    L    Y SP  ++  Y
Sbjct: 473 EMATVTGLLMSVYQIGDAVGASIAGAIWTQCLAKELIQRLGS-NLGMSIYKSPLNYLKKY 531

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVF-CFPLLGCALMLRNHKLTDSIALEGSDYLESK 599
             G+  R  +V SY  +Q++L I+ + F  F  + C   LR   +              K
Sbjct: 532 PIGSEVRDQMVESYSKIQRLLIIVSISFAAFNAVLC-FFLRGFTVNK------------K 578

Query: 600 DAFEPKEKEETFLK 613
            +F  +E+E+  L+
Sbjct: 579 QSFSTEEREKEKLR 592

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score =  218 bits (554), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 144/486 (29%), Positives = 245/486 (50%), Gaps = 17/486 (3%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           +  L  +LFL  Y  GL G I  + Q YA + + +HS + ++N +K+++++V  + +AR+
Sbjct: 58  KTVLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARM 117

Query: 130 SDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    + +++ Y +G +I +   N      G    Q G +G  L+   +  D S 
Sbjct: 118 SDRFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSG 177

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAIGTN-----WKWGIGMWAFILPLACIPLGLCM 244
           L  R  A+ I  +P IINTW+SGN+ S++  +     W+WG G++  I+P + + L L  
Sbjct: 178 LRDRTFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILVLPY 237

Query: 245 LHMRYLARKHAKD---RLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVP 301
            + +Y++ ++      +LK + + L +  WK F  DI     ++IG++L TAF   VL+P
Sbjct: 238 AYAQYISWRNGTLPPFKLKEKGQNLRQTIWK-FAEDI-----NLIGIILFTAFLVLVLLP 291

Query: 302 FTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXX 361
            T+AGG   +WR  +II   V+G  +   ++++WE++++++P  P   + D         
Sbjct: 292 LTIAGGATSKWREGYIIAMIVVGGFLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLM 350

Query: 362 XXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKP 421
                    ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G IL      K 
Sbjct: 351 EFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIGQLYNFLQSCTNIVVGIILHFYPHPKV 410

Query: 422 FILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHAR 481
           F++ G    ++  GLL  YR      +G+IG+  ++G   G   +     + AS  TH  
Sbjct: 411 FVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THKE 469

Query: 482 MAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIITYT 541
           MA VT L ++ Y I            WT  L +E+ +R+    L    Y SP  ++  Y 
Sbjct: 470 MATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGY-DLGMSIYKSPLNYLKKYP 528

Query: 542 WGTPER 547
            G+  R
Sbjct: 529 IGSEVR 534

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  216 bits (551), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 172/616 (27%), Positives = 292/616 (47%), Gaps = 37/616 (6%)

Query: 11  PEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNR-PLY 69
           PE   +D V E  +K +  +    P L   S     ++ ++  +     +     R    
Sbjct: 4   PELLKKDHVEEDDDKSSSLSQTNEPPL---SNGVRRMDAVNATLSRAGSFTAFGVRFQTL 60

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           ++AL  +LFL  Y  GL G I  + Q YA +++ +   + ++N +K+V+AA   + +ARL
Sbjct: 61  KIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARL 120

Query: 130 SDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    + +++ Y +G +I +          G    Q G +G  L+   + +D S 
Sbjct: 121 SDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISG 180

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAIGT-----NWKWGIGMWAFILPLACIPLGLCM 244
           L  R  A+ I  +P IINTW+SGN+  ++        W+WG G++  I+P + + L L  
Sbjct: 181 LRDRTFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLILPY 240

Query: 245 LHMRYLARKHAKDRLKPEFEALNKLK-WKSFCIDIAFWKL----DIIGMLLITAFFGCVL 299
            + +YLA +  +    P+FE   + + WK      A WKL    ++IG++L TAF   VL
Sbjct: 241 AYAQYLAWREGR---LPQFEFRKQGQSWKQ-----ALWKLTEDVNLIGIVLFTAFLVLVL 292

Query: 300 VPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXX 359
           +P TLAGG   +W+  HII   V+G    + L+ +WE+  ++ P  P   + D       
Sbjct: 293 LPLTLAGGASTKWKEGHIIAMIVVGGCCGI-LFFVWELWLAKKPFIPRVYLGDATIYVAL 351

Query: 360 XXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRT 419
                      ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G +L      
Sbjct: 352 LMEFAWRLALQIELEYLITVLMVAFGESKLSAQRIGQLYNFLQSCTNVVVGIMLHFYPHP 411

Query: 420 KPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTH 479
           KPFI+ G    ++  GLL  YR      +G+IG+  ++G  AGS       ++  ++ +H
Sbjct: 412 KPFIVAGSLLGVLGMGLLYKYRVAYDGISGLIGAEVVVGI-AGSMVRFPMWTLVHASTSH 470

Query: 480 ARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPTLAAQAYGSPFTFIIT 539
             MA+ T L ++ Y I            WT  L +E+ KR+      A  Y SP +++  
Sbjct: 471 EEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRLGSKVGLA-VYNSPLSYLTK 529

Query: 540 YTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESK 599
           Y  G+  R  ++ SY  +Q++L I+ + F          L  + +++            K
Sbjct: 530 YPLGSEVRNEILESYSEIQRLLIIVSISFAALNAVLCFFLPGYTVSE------------K 577

Query: 600 DAFEPKEKEETFLKSK 615
            +F  +E+E+  L+ K
Sbjct: 578 QSFTQEEREKKKLEMK 593

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  186 bits (472), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 162/636 (25%), Positives = 288/636 (45%), Gaps = 33/636 (5%)

Query: 2   DPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIE----LIDPGVHNI 57
           D  +    + E++ E+   +  EK     V ++ +L   + A S  +    +   GV  I
Sbjct: 9   DSISGKLNVQEKYHEEAKSDAAEKN---LVSIDGSLKQITSATSCYDGEKIIKTRGVTRI 65

Query: 58  EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+  E  +  + R  L  S+FL +    LD    Y +Q YATSS+++HS+LST+    +V
Sbjct: 66  EVVREKMSTRV-RWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSV 124

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGII 177
           I AV + F A++SD+  R     + ++ Y++G VI + +  I  + VG  F  +G +GI 
Sbjct: 125 IGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSGIS 184

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGN-VTSAIGTNWKWGIGMWAFILPLA 236
           L+  VI +D + L WR     + ++P+++ TWISG  V   I +NW+WG GM+A I P+A
Sbjct: 185 LMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVA 244

Query: 237 CIPLGLCMLHMRYLARKH----------AKDRLKPEFEALNKLKWKSFCIDIAFWKLDII 286
             P  L M ++ + A K           +K R++     ++  +     + ++  ++D  
Sbjct: 245 LTPAILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLIEIDAF 304

Query: 287 GMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTP 346
           G++L+   F  +L+P +L    +  W    +I  EV+G +  +  Y+++E+ ++  PL P
Sbjct: 305 GLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLIS-YVVFEVFFAPFPLLP 363

Query: 347 WDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVG 406
             ++ +R                Y    +  +   V ++ S ++   +++  +      G
Sbjct: 364 KRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGLCFFG 423

Query: 407 TILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAH--AGIIGSLCLLGFGAGSF 464
            + G +     R K F + GI+  ++  GL V      G+     ++ +L +  FG  + 
Sbjct: 424 VVWGALFRGFHRYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAALVVTNFGDAAN 483

Query: 465 TYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRISDPT 524
              TQ + QA A  H  MA   S+     +I            WT+ LP  +SK + D  
Sbjct: 484 VMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALSKYVPDRE 542

Query: 525 LAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKL 584
            AA A+    T +    WG+  R   + +Y+ V   L  +GL     +   AL   N+ L
Sbjct: 543 KAA-AFFESLTTVWEEPWGSANREGAIDAYQEVNYTLFCMGLGVSAIMFIVALFQTNYYL 601

Query: 585 TDSI-ALEG---SDYLESKDAFEPKEKEETFLKSKF 616
            D    +EG    DY  + D       ++T L   F
Sbjct: 602 GDQQNCVEGEQREDYHHNADG-----SKKTLLNRAF 632

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score =  184 bits (468), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 152/570 (26%), Positives = 261/570 (45%), Gaps = 28/570 (4%)

Query: 53  GVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV  IE+  E  +  +  + L  S+ L A+   LD    Y +Q YATSS+++HS+LST+ 
Sbjct: 62  GVTRIEVVKEKMSTKVTWI-LAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLSTLT 120

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLG 172
              +VI AV + F A++SD+  R     + +I Y++G +I + +  I  + VG  F  +G
Sbjct: 121 IANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFIAVG 180

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN-VTSAIGTNWKWGIGMWAF 231
            +GI L+  VI +D ++L WR     + ++P+++ TWISG  V + I +NW+WG GM+A 
Sbjct: 181 QSGINLMNMVIVADTTSLKWRSFITSLLSVPYLVTTWISGYIVQNIISSNWRWGYGMFAI 240

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRL--KPEFEALNKLKWKSFCIDIAFWKL------ 283
           I P+A  P  L M ++ + A K  +  +   P  E   +++         +W+L      
Sbjct: 241 ITPVALTPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQLLKTSLI 300

Query: 284 --DIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSR 341
             D  G++L+   F  +L+P +L    +  W+   +I  EVIG +  +  Y+++E+ ++ 
Sbjct: 301 EIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLIS-YVIFEVFFAP 359

Query: 342 HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFV 401
            PL P  ++ +R                Y    +  +   V ++ S K+   +++  +  
Sbjct: 360 FPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTTMG 419

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAH--AGIIGSLCLLGF 459
               G + G +     R K F + GI+  ++  GL V      G+     I+ +L +  F
Sbjct: 420 LCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLIVAALIVTNF 479

Query: 460 GAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKR 519
           G  +    TQ + QA A  H  MA   S+     +I            WTN LP  + K 
Sbjct: 480 GDAANVMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTNELPGALLKY 538

Query: 520 ISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALML 579
           + D   A   + S  T I    WG+  R   + +Y+ V   L  +GL     +   AL  
Sbjct: 539 VPDKEKAITFFES-LTLIWQEPWGSENREGAIAAYQEVNYTLFCMGLGVSSIMFIVALFQ 597

Query: 580 RNHKLTDSIALEGSDYLESKDAFEPKEKEE 609
            N  L D            ++  E ++KE+
Sbjct: 598 TNFYLGD-----------QQNCVEGEQKED 616

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  184 bits (466), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 144/548 (26%), Positives = 257/548 (46%), Gaps = 17/548 (3%)

Query: 53  GVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV  IE+  E  +  +  + L  S+FL ++   LD    Y +Q YATSS+++HS+LST+ 
Sbjct: 61  GVTRIEVVREKMSTKVIWI-LGLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLT 119

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLG 172
              +VI AV + F A++SD+  R     + ++ Y++G VI + + NI+ + +G  F  +G
Sbjct: 120 IANSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVG 179

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN-VTSAIGTNWKWGIGMWAF 231
            +GI L+  VI +D + L WR     + ++P+++ TWISG  V   I +NW+WG GM+A 
Sbjct: 180 QSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAI 239

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK-----DRLKPEFEALNKLKWKSF-----CIDIAFW 281
           I P+A  P  L M ++ + A K  +     D L  +   + + + + F      + ++  
Sbjct: 240 ITPVALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELLKVSLI 299

Query: 282 KLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSR 341
           ++D  G++L+   F  +L+P +L    +  W    +I  EV+G ++ +  Y+++E+ ++ 
Sbjct: 300 EIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLIS-YVVFEVFFAP 358

Query: 342 HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFV 401
            PL P  ++ +R                Y    +  +   V ++ S +    +++  +  
Sbjct: 359 FPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTTMG 418

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAH--AGIIGSLCLLGF 459
               G + G +     R K F + GI+  ++  GL V      G+     ++ +L +  F
Sbjct: 419 LCFFGVVWGALFRGFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLVVAALVVTNF 478

Query: 460 GAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKR 519
           G  +    TQ + QA A  H  MA   S+     +I            WT+ LP  + K 
Sbjct: 479 GDAANVMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTDQLPGALFKY 537

Query: 520 ISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALML 579
           + D   A  A+    T I    WG+  R   + +Y+ V   L  +GL     +   AL  
Sbjct: 538 VPDKEKAV-AFFESLTSIWEEPWGSINREGAISAYQEVNYTLFCMGLGVSSIMFVVALFQ 596

Query: 580 RNHKLTDS 587
            N+ L D 
Sbjct: 597 TNYYLGDQ 604

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  139 bits (350), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 133/500 (26%), Positives = 225/500 (45%), Gaps = 37/500 (7%)

Query: 78  FLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR-- 135
           F++A++ G+ G    T   Y TSS+ QHSL +   C         QI   +  DI+GR  
Sbjct: 76  FVLAFSSGIIG----TLTPYVTSSFEQHSLTAFDWCYFNSYCWSDQIALCQSIDIWGRAQ 131

Query: 136 -FSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRL 194
            F+ +V+S+    +GT++ +   N+  +     FY +G  GI   + +  +D + L  R 
Sbjct: 132 GFAFMVLSI---TIGTIMMAGCNNVKTYCAAQVFYWVGYNGIDFTITIFIADTTKLKNRA 188

Query: 195 LALFIPALPFIINTWISGNVTSAI--GTNWKWGIGMWAFILPLACIPL-GLCMLHMRYLA 251
             L   +  +I   W  G    +I     ++WG G+WA I+P+ C PL GL    + Y  
Sbjct: 189 FILAYTSSCYIATVWAYGPAAESILNTIGFRWGFGIWAIIIPVVCSPLFGL----LYYYQ 244

Query: 252 RKHAKDRLKPEFEALNKLKWKSFCIDIAFW--KLDIIGMLLITAFFGCVLVPFTLAGGLK 309
           +K  K  L P+ E   +  W+S    + F+  + D+IG+ ++       L+ F L    K
Sbjct: 245 QKAVKVGLIPKREKSGRTFWQS----VVFYGKEFDVIGIFILALGLALFLLGFNLYSYQK 300

Query: 310 EEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXW 369
            EWR+  II   +IG ++ +  + +WE  ++     PW+L+ +R               +
Sbjct: 301 NEWRSPLIICFLIIGGLLIIS-FGIWEY-FAPVSFIPWELLTNRTVIFTYSMAAAMYCSF 358

Query: 370 YMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILF-GIS 428
           Y+   Y +       + S   AT IT++YS  S     ++G I+    R K   LF G+ 
Sbjct: 359 YIWDSYFFRHH-CRFNLSTARATYITNIYSIGSCFCALVVGVIIRCYGRLKSIALFWGVP 417

Query: 429 CWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQA-SAKTHARMAIVTS 487
             ++  GL++ YR        I+     + FG G+     Q ++ A SA+ H  +  V +
Sbjct: 418 ITMLGCGLMIKYRSPDSNLGLIVMCQLFIAFGGGALVICEQMTVMAVSAQQH--IPAVLA 475

Query: 488 LYLATYNIXXXXXXXXXXXXWTNILPREISK----RISDPTLAAQAYGSPFTFIITYTWG 543
           +      I            WT I P+++++     + D  L+   YGS  T  I+Y  G
Sbjct: 476 MEAMVIAIGEAVGQTIAGAMWTGIFPKKLAEYLPADVQDQLLS--IYGS-LTVQISYPRG 532

Query: 544 TPERIALVMSYRYVQKILCI 563
           T  R A+  SY   Q+++CI
Sbjct: 533 TAAREAIDRSYGDTQRLMCI 552

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score =  109 bits (273), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 61/130 (46%), Positives = 78/130 (60%), Gaps = 2/130 (1%)

Query: 464 FTYVTQASIQASAKTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPREISKRIS-D 522
           FTY    S QA A +H  MA VT+L    Y I            WT  L  EI KR+  +
Sbjct: 2   FTYPVTVSCQA-ATSHEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEILKRLGGN 60

Query: 523 PTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNH 582
            ++A  AY SP+TFI TYTWGT ER A+V +Y+YVQK+  ++ LVFC PLL  +L LR+ 
Sbjct: 61  VSMATAAYASPYTFITTYTWGTSEREAVVEAYKYVQKLETVVALVFCAPLLMFSLCLRDA 120

Query: 583 KLTDSIALEG 592
           KLTD +A +G
Sbjct: 121 KLTDKVAHDG 130

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score =  109 bits (272), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 47/121 (38%), Positives = 77/121 (63%)

Query: 58  EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ +  +N   YR+ +  + FL  + + LD  +R T+  YAT+SY++HSLLST+  I  V
Sbjct: 45  ELISSQFNSLTYRILILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQVINAV 104

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ F+RLSD FGR  +  ++ I YI+GT+++SQA +++ +A G  FY  G  G+ 
Sbjct: 105 VSVGSQVVFSRLSDYFGRLELFTVASILYIIGTIVQSQAYSVSIYAAGAVFYNCGYVGVS 164

Query: 178 L 178
           L
Sbjct: 165 L 165

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 148/344 (43%), Gaps = 24/344 (6%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    L+ISV+ + +G++I + +  +     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTN--WKWG------IGMWAF 231
             V+ +     N+R + +   A+ ++I   +   +  A   +  W+W       IG +AF
Sbjct: 117 AFVVGTSIVQENYRGIMITALAVSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAF 176

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I    C   G   L  ++L  K         +E      WK     I  +KLD+IG++L 
Sbjct: 177 ISLAFCCASGGKWLSKKWLLSKINSITSYKYYEIFKASFWKK-VFQILVFKLDMIGIILS 235

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVV----------ALPLYML-WEMKYS 340
           +A F  +++  +  GG    W ++ II    +G ++           LPL  + ++ KY+
Sbjct: 236 SAGFTLLMLGLSF-GGNNFAWNSSIIISFFTLGPILLILFCAYDFHILPLLGVHYKSKYA 294

Query: 341 RHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-IVAVHESIKSATRITSLYS 399
           R PL  W +  + G              + +Q  Y+  +  +V    S+ ++  +  L S
Sbjct: 295 R-PLLTWKIASNAGIFTSSITGFFSCFAYELQSAYLVQLYQLVLKRNSMLASIHLWEL-S 352

Query: 400 FVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGD 443
             ++I      ++  K    KP I+FG+ C IV  G+     G+
Sbjct: 353 IPAMITTMATAYLNAKYGIIKPAIVFGVLCGIVGSGIFTLINGE 396

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 86/377 (22%), Positives = 149/377 (39%), Gaps = 24/377 (6%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    L+ISVI + +G++I + + ++     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTN--WKWG------IGMWAF 231
             V+ +     N R   +   A  ++I   +   +  A   +  W+W       IG +A 
Sbjct: 117 AFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAL 176

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I+   C   G  +  +  L++  +    K + E      WK     +  +KLD+IG+ L 
Sbjct: 177 IILAFCNTSGESLPKVSLLSKIKSIMSYKYD-EVFKASFWKK-AFKVFVFKLDMIGVTLS 234

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVA----------LPLYMLWEMKYSR 341
           +A F  +++  +  GG    W ++ II    +G ++           LPL  L       
Sbjct: 235 SAGFTLLMLGLSF-GGNNFAWNSSTIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRT 293

Query: 342 HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFV 401
            PL  W +  + G              + +Q  Y+  +  + +      A+      S  
Sbjct: 294 KPLLTWSIASNSGIFTSSVTGFFSCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIP 353

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGA 461
           ++I    + ++  K    KP I+FG+ C IV  GL     G S      IG   L G   
Sbjct: 354 AIIATMAIAYLNAKYGIIKPAIVFGVLCGIVGSGLFTLINGKSSQS---IGYSILPGLAF 410

Query: 462 GSFTYVTQASIQASAKT 478
           GS    T  S Q   K+
Sbjct: 411 GSIFQATLLSSQVQIKS 427

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/347 (21%), Positives = 141/347 (40%), Gaps = 31/347 (8%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    L+ISVI + +G++I + + ++     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTN--WKWG------IGMWAF 231
             V+ +     N R + +   A+ ++I   +   +  A   +  W+W       IG +AF
Sbjct: 117 AFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAF 176

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I+   C   G    H +       K  +  ++  L K  +     ++  +KLD++G++L 
Sbjct: 177 IILAFCNTSG--EPHQKMWLPSKIKKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILS 234

Query: 292 TAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRH--------- 342
           +A F  +++  +  GG    W +  II    +G     P+ +L    Y  H         
Sbjct: 235 SAGFTLLMLGLSF-GGNNFPWNSGIIICFFTVG-----PILLLLFCAYDFHFLSLSGLHY 288

Query: 343 ------PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITS 396
                 PL  W++  + G              + +Q  Y+  +  +   +    A+    
Sbjct: 289 DNKRIKPLLTWNIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLW 348

Query: 397 LYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGD 443
             S  ++I    + ++  K    KP I+FG+ C IV  GL     G+
Sbjct: 349 ELSIPAMIATMAIAYLNSKYGIIKPAIVFGVLCGIVGSGLFTLINGE 395

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/377 (22%), Positives = 159/377 (42%), Gaps = 34/377 (9%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIIL 178
           +A+  + + R++ + G  + L++SV+ + +G++I + + ++     G      G +GI  
Sbjct: 91  SALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQS 150

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACI 238
           ++ ++ +   +   R + + +    F+ +      +  A+  +  W    W F + L   
Sbjct: 151 LVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASW---RWCFFINL--- 204

Query: 239 PLGLCMLHMRYL----ARKHAKDRLKPEFEALNKLKWKSFC--------IDIAFWKLDII 286
           P+G     M +L    + K     L  + EA    ++ + C        +D+  ++ DII
Sbjct: 205 PIGGAAAFMLFLCYNPSGKPLLSTLTSKLEAARDYRYSNVCTRKFWAHALDLGVFRFDII 264

Query: 287 GMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIG--WVVALPLY-------MLWEM 337
           G  L +A F  +L+  T  G  K  W +   I    +G   +V   LY       +   +
Sbjct: 265 GFALSSAGFVLLLLGLTFGG-RKYSWSSGTTIAYLTVGPVLIVVFCLYDFLVLPVLARSL 323

Query: 338 KYSRH--PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRIT 395
            YS    PL PW +I   G              + MQ  Y+     V  +ES  +A+   
Sbjct: 324 AYSSEVTPLVPWPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHNESPTNASTHM 383

Query: 396 SLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLC 455
              S  +++V  +LG I  K    KP  + G +C  +  GLL   +G + +   I    C
Sbjct: 384 WALSIPALVVIIVLGRINKKFGILKPVAVIGAACGTIGAGLLTLLKGSTTSGQSI--GYC 441

Query: 456 LLGFGAGSFTYVTQASI 472
           +L  GAG F+ V Q+++
Sbjct: 442 ILA-GAG-FSAVMQSTL 456

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 151/387 (39%), Gaps = 44/387 (11%)

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R++ I G  S ++ ++I + +G++I   A ++     G     +G +GI  +  VI
Sbjct: 131 LLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVI 190

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
            S+  +   R L +   +  F + + I   +  A  T+  W    W F + L    +   
Sbjct: 191 GSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTHATW---RWCFYINLPVGGVAFA 247

Query: 244 MLHMRYLARKHAKDRLK------------PEFEALNKLK----WKSFCIDIAFWKLDIIG 287
           +  + Y  ++ + + +              +   +  LK    WKS    + F + DII 
Sbjct: 248 LFVVFYNPQRKSLEGISILSSLKEFCNTLRQITVIKNLKNWPTWKSIVYSLVF-RFDIIE 306

Query: 288 MLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWV----------VALPLYMLWEM 337
            +  +A F  VL+ FT  GG +  W +A IIV  VIG +          V  P +   + 
Sbjct: 307 FIFCSAGFVLVLLAFTF-GGNQYNWSSASIIVMFVIGIILLIVSLLYDFVIFPRFKAVKE 365

Query: 338 KYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSL 397
                PL  W +    G              +  Q     TV I+   + ++  T   + 
Sbjct: 366 NSLYQPLIKWSIFSHPGIFTANAALFFECTAYICQ-----TVYIIQFFQLVRGNTAWKAA 420

Query: 398 YSFVSVIVGTIL-----GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIG 452
              ++ +V T++     G    K    K     G+   +V  GLL     +S + A  IG
Sbjct: 421 VHLIATVVPTVITTFSSGIANSKFGLVKHVTFIGVVTSLVGAGLLTLLDNNS-SSAKHIG 479

Query: 453 SLCL--LGFGAGSFTYVTQASIQASAK 477
            L L  +GFGA   + +  A IQ   K
Sbjct: 480 LLILPGIGFGATMQSTMIGAQIQLDKK 506

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 87/381 (22%), Positives = 154/381 (40%), Gaps = 41/381 (10%)

Query: 127 ARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G    ++ +++ + +G++I + A ++     G     +G  GI  +  VI S+
Sbjct: 132 GRIATPIGFKRTMLFAIVIFEVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSN 191

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGNVTSAIGTNWKWGI-------GMWAFILPL 235
               + R + + I +  F    ++  ++ G  TS +   W+W         G+  F+  +
Sbjct: 192 LVEESNRGVLIAILSCSFAIASVVGPFLGGVFTSRV--TWRWCFYINLPIGGLTFFLFLM 249

Query: 236 ACIPLGLCMLH-MRYLAR---------KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDI 285
            C P        +R + R         +     L    E   +  WK    ++ F   DI
Sbjct: 250 FCNPDPHTFQETVRNILRIPSQLIEFVRKVGHHLSKVKELGKRTSWKILLTELVFM-YDI 308

Query: 286 IGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVAL----------PLYMLW 335
           I  +L TA F  +L+ FT  GG +  W +A IIV  VIG ++ +          P + + 
Sbjct: 309 IEFVLCTAGFTSILLAFTF-GGNRYAWDSAEIIVLFVIGVILVILAAVYDFFVFPKFDVV 367

Query: 336 EMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESI-KSATRI 394
           +      PL  W  IK  G              +  Q  Y+     +  ++S  K+A  +
Sbjct: 368 KTAPRYQPLMSWRNIKRPGIFTVNIALFLLCTGYISQFTYIVQYFQLIYNDSAWKAAVHL 427

Query: 395 TSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSL 454
            +     +VI   + G I  K R+ KP I+      +V  GLL     +S +++  IG L
Sbjct: 428 VACI-IPTVITSVVCGVITDKTRQIKPIIVISSILGVVGAGLLT-LLNNSASNSAHIGLL 485

Query: 455 CLLGFGAGSFTYVTQASIQAS 475
            L G   G    + Q+S+ AS
Sbjct: 486 ILPGIAFGG---LMQSSMLAS 503

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 94/386 (24%), Positives = 158/386 (40%), Gaps = 51/386 (13%)

Query: 127 ARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G  + ++ +++ + +G++I + A ++     G     +G  GI  +  VI S 
Sbjct: 117 GRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGST 176

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGNVTSAIGTNWKWG------IGMWAFILPLA 236
               + R + + I +  F    ++  ++ G  TS++   W+W       IG  AF L + 
Sbjct: 177 LVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSV--TWRWCFYINLPIGGLAFFLFVL 234

Query: 237 CIPLGLCMLH--MRYL----------ARKHAKDRLK-PEFEALNKLKWKSFCIDIAFWKL 283
               GL      M+ +           RK A   LK   F   N   WK   I++ F   
Sbjct: 235 FYNPGLHTFRETMKNIPRIPSQFVKVVRKVAHHSLKVKNFNKSNS--WKKLFIELVFM-Y 291

Query: 284 DIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAH----------IIVPEVIGWVVALPLYM 333
           D+I ++L +A F  +L+ FT  GG +  W +            +++  +I      P + 
Sbjct: 292 DVIELVLCSAGFTSILLAFTF-GGNRYAWNSTSIIILFIVGIILVISAIIYDFFVFPKFN 350

Query: 334 LWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESI-KSAT 392
           L +   S  PL  W  IK  G              +  Q  Y+     +  ++S  K+A 
Sbjct: 351 LVKATPSYQPLMLWRNIKKPGVFTVNIALFLLCAGYISQFTYIVQYFQLIYNDSAWKAAV 410

Query: 393 R-ITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGL--LVHYRGDSGAHAG 449
             IT + S  +VI   + G I  K R+ KP I+      +V  GL  L++    S AH  
Sbjct: 411 HLITCVIS--TVITAIVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLNNNASSSAH-- 466

Query: 450 IIGSLCLLGFGAGSFTYVTQASIQAS 475
            IG L L G   G    + Q+S+ AS
Sbjct: 467 -IGLLILPGIAFGG---LAQSSMLAS 488

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 93/382 (24%), Positives = 168/382 (43%), Gaps = 42/382 (10%)

Query: 122 GQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILE 181
           G+I F+ L    G  + ++ +++ + +G++I + A ++     G     +G +GI  +  
Sbjct: 114 GRIAFSFL----GFKTAMLSAIVIFEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSF 169

Query: 182 VIASDFSNLNWR-LLALFIPA---LPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLAC 237
           VI S   +   R  +  F+ A   +  +I  +I G  TS +   W+W    W   LP+  
Sbjct: 170 VIGSTLVSPRGRGFIIAFMSASFGIASVIGPFIGGAFTSHV--TWRWC--FW-INLPVGA 224

Query: 238 IPLGLCMLHMRYLARKHAK---DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAF 294
           + L +         +K        LK   E + K+++K     + F KLDII  +LI+A 
Sbjct: 225 VALVIFTWVYNPTGKKQVLLTIHDLKELSEKVKKVRFKDLLKHLLF-KLDIIEFMLISAG 283

Query: 295 FGCVLVPFTLAGGLKEEWRTAHIIVPEVIGW---VVAL-------PLYMLWEMKYSRH-P 343
             C+L+ FT  GG + +W +  II+  VIG    +VAL       P   + +  Y ++ P
Sbjct: 284 IVCILLAFTF-GGNRFKWGSYSIILLFVIGGCLVIVALVYDFVIFPNLQIVKANYIQYQP 342

Query: 344 LTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSV 403
           L  W  ++ RG              +  Q     TV  V   + I +++   +    ++V
Sbjct: 343 LISWKNLRIRGIFTASMTTFFFCIGYMSQ-----TVYYVQFFQLIYNSSPWKASIHLIAV 397

Query: 404 IVGTIL-----GFILIKVRRTKPFILFGISCWIVSFGL--LVHYRGDSGAHAGIIGSLCL 456
           ++ T+L     GF+  K    KP  + G+   ++  GL  L+    +S  H G++  L  
Sbjct: 398 MIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIGAGLLTLLDNHSNSAQHIGLL-ILPG 456

Query: 457 LGFGAGSFTYVTQASIQASAKT 478
           + FGA +   +  A I+   K+
Sbjct: 457 VAFGACNQCTMMAAQIELDKKS 478

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 119/549 (21%), Positives = 201/549 (36%), Gaps = 80/549 (14%)

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVI----ESQAVNITRFAVGGCFYQLGLTGIILI 179
           + + RL+ I G  + L  S++ + +G++I     S  + I    V GC    G +GI  +
Sbjct: 60  LLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGRVVAGC----GGSGIQSL 115

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIP 239
           + V+ +       R + + +  L F +   +   +  A   N  W    W F + L    
Sbjct: 116 VFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVSW---RWCFYINLPIGG 172

Query: 240 LGLCMLHMRY-LARKHAKDRLKPEFEALNKLKWKSFCIDIAFWK---------LDIIGML 289
           + L ML   Y    K  ++ L      L   ++  + +  +FW+         LD IG  
Sbjct: 173 VALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQW-VTASFWRRAYNFLMFDLDFIGFA 231

Query: 290 LITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIG------WVV----ALPLYMLWEMKY 339
           L +  F   ++  T  GG    W +  II    +G      W+V     L  +  W  K 
Sbjct: 232 LSSTGFVLFMLGLTF-GGNTYAWNSGTIISFLTVGAILVLFWLVFDFVLLYKWAAWCRKR 290

Query: 340 SRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYS 399
              PL    L    G              + MQ     TV IV +++ + ++    +   
Sbjct: 291 EATPLLRRSLCFRPGIFTSSIANLFTCFGFNMQ-----TVYIVQLYQLVFNSGPTAASMH 345

Query: 400 FVSVIVGTILGFILIKVRRT-----KPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSL 454
             + ++ T++  I+I          KP I+FG +C +V  GL+   R  S     +IG  
Sbjct: 346 LWAFLIATMVSVIIIGKAAAIFGLIKPAIVFGATCGLVGSGLMTLVRNTS-TTGNVIGYC 404

Query: 455 CLLGFGAGSFTYVT----QASIQASAKTHARMAI-VTSLYLATYNIXXXXXXXXXXXXWT 509
            L G   GS    T    Q  +    +    M I  T+L     ++            +T
Sbjct: 405 ILPGAAFGSIMQGTLLSAQVQVDHDDENFQTMFIEATALNTFVKSLGFSFGGVVATMIFT 464

Query: 510 NILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQKILCIIGLVFC 569
           N +  ++       T A  A  S    +I Y     +     +S  +V+ I  ++     
Sbjct: 465 NSVKNQLRS-----TSAGVAAFSSVEALIAYRGQNYDGPGSTLSLMFVKAIKDVM----- 514

Query: 570 FPLLGC-------ALMLRNHKLTDSIALEGSDYLESK-DAFEPKEKEETFL---KSKFLS 618
           +  LGC       +L   N +L           L SK D  E   +E++     KS+   
Sbjct: 515 YAALGCYGIVFIASLFTSNRRLR----------LPSKNDGVEATAQEKSISGGDKSQLAP 564

Query: 619 QFTGKNKEN 627
           Q T +N EN
Sbjct: 565 QSTSENDEN 573

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/376 (19%), Positives = 148/376 (39%), Gaps = 29/376 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + R++ + G  + LV S++ +  G+++ + A ++     G      G +GI  +
Sbjct: 56  ALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETL 115

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIP 239
           +  + +   +   R   + I  + +++       +  A   +  W    W F + +    
Sbjct: 116 VFAVGTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHVSW---RWCFFINIPIGG 172

Query: 240 LGLCMLHMRYL-ARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKLDIIGMLL 290
           + L +L   Y  A +   + L   +++  K  WK           + +  ++LDI+G+LL
Sbjct: 173 VALAILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLL 232

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEM-----------KY 339
            +  F  +++  T  GG K  W +A II    IG +  L ++ML++              
Sbjct: 233 SSGGFALIMLALTF-GGNKFAWNSASIICMFTIG-IALLGIFMLYDFVVLPYIGRRLENG 290

Query: 340 SRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYS 399
              PL PW L  +                + +Q  Y+     +  +E    A+      S
Sbjct: 291 EAMPLVPWSLACNMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMS 350

Query: 400 FVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGF 459
             ++I   +   I  K    KP I+ G+    +  GLL  +  ++   A I  S+     
Sbjct: 351 VPALITVIVSAAINEKFGIVKPIIVTGVVFGFIGSGLLTLFGSNTSTGASIGYSM----L 406

Query: 460 GAGSFTYVTQASIQAS 475
              SF  V Q S+ +S
Sbjct: 407 AGASFGCVYQLSLLSS 422

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 61/120 (50%)

Query: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + ++SDIFGR
Sbjct: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125

Query: 136 FSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLL 195
             +++IS +F+I+G +I   + N+     G     +G  G+  +  + ASD   L  R L
Sbjct: 126 RPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLRSRAL 185

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 86/211 (40%), Gaps = 20/211 (9%)

Query: 248 RYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGG 307
           R LAR   + R  P    L    W+     + F +LDI G+ L +  F  V++  T  GG
Sbjct: 191 RALARFWVRARAFPYGTLLQAQFWRRAAALMVF-RLDIPGLALSSGGFALVMLALTF-GG 248

Query: 308 LKEEWRTAHIIVPEVIGWVVALPLYMLWEM-----------KYSRHPLTPWDLIKDRGXX 356
            +  WR+A I+   V G  + L L+ML++             Y   PL PW L  +    
Sbjct: 249 NQYAWRSATIVCMFVFGAAL-LALFMLYDFVVLPRVGARIAGYEPLPLVPWRLAANVPVL 307

Query: 357 XXXXXXXXXXXXWYMQGDYM--YTVLIVAVHESIKSATR-ITSLYSFVSVIVGTILGFIL 413
                       + +Q  Y+  Y  L+V    ++ S      SL + VSVI   ++    
Sbjct: 308 TSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVSVIASAVVN--- 364

Query: 414 IKVRRTKPFILFGISCWIVSFGLLVHYRGDS 444
            +    KP +L G+    V  GLL   R D+
Sbjct: 365 ERFGVVKPLVLAGVVMGFVGSGLLTLVRSDT 395

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 121/284 (42%), Gaps = 16/284 (5%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + ++SDI
Sbjct: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182

Query: 133 FGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192
           FGR  +L+   I + +G++I   + +      G     +G  GI  +  +  SD   L  
Sbjct: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRN 242

Query: 193 RLLALFIPALPFIINTWISGNVT---SAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRY 249
           R L   I    F + T + G V    S     W+     +   LP+A     L +L +R 
Sbjct: 243 RALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMS---FLIQLPIAFFSTILIILFLR- 298

Query: 250 LARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLK 309
           L ++     L+ +    + +K +   +D   W    IG   +  F    ++  +L G  K
Sbjct: 299 LPKESKGRGLQVDGNYFSTIKVRLSAVD---W----IGATTLVLFLFSFMITASLGG--K 349

Query: 310 EEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDR 353
           E   T+H  +   +  V+   ++   E+K ++ P+ P   +KDR
Sbjct: 350 EIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDR 393

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 129/297 (43%), Gaps = 49/297 (16%)

Query: 2   DPSTASRALP--EEFTEDIVPEIP---EKEAGTTVDVNPTLTISSPAPSYIELIDPGVHN 56
           +P  AS  LP   E  +D   ++P    +E G   +V         A  Y  + DP  H+
Sbjct: 42  EPIEASLLLPIKPEILQDPSTDLPGFVAEEIGQQEEV---------ANGYGSITDP--HD 90

Query: 57  IEIYAEIYNRPLYRV---------ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
            +  +E   RP+             +  S++L  +   +D  I  T  A+  S ++Q S 
Sbjct: 91  GDNKSE---RPVSTAEEISGARLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSK 147

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN-----ITRF 162
           +S +     + +A  Q  + ++SDIFGR  +LV + + +++G ++   + +     I RF
Sbjct: 148 VSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARF 207

Query: 163 AVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNW 222
             G     +G  G+  +  +  +D   L  R +   I  + + + T   G V      N 
Sbjct: 208 VAG-----VGGGGLTSMSSITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDN- 261

Query: 223 KWGIGMWAFIL--PLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCID 277
           K G  M AF++  PL+ I L + +LH++  +++  +++        N +K K   ID
Sbjct: 262 KGGWRM-AFLIQVPLSAISLLVIILHLKLPSKRATRNQ-------DNSIKRKLLAID 310

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 107/249 (42%), Gaps = 27/249 (10%)

Query: 127 ARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R + I G  S +++S+I + +G+++ + A ++     G     +G +G+  +  +I S 
Sbjct: 99  GRAASIIGFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIIST 158

Query: 187 FSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLH 246
             N   R +A+ + +  F + + +   +  A  T+  W    W F + L    L   +  
Sbjct: 159 LVNERSRGMAISVLSCSFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGGLAFLVFV 215

Query: 247 MRYLARKHAKDRLKPEFEALNK---------LKWKSF--CIDIAFWKLDIIGMLLITAFF 295
           + Y    +  + +K   +A+           LK KS+    +   +K D +G  L +A F
Sbjct: 216 LSY--NPNGGNSIKNFTKAVRSISHVDFGGLLKAKSYYNTFEKLVFKFDFVGFALCSAGF 273

Query: 296 GCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSR----------HPLT 345
             +L+  T  GG +  W +  II   VIG V+++  ++     ++R           PL 
Sbjct: 274 CLILLGLTF-GGNEYSWGSGTIIAYLVIGIVLSIAFFLYDFFVFNRFKAPRENMVYRPLV 332

Query: 346 PWDLIKDRG 354
            W++I   G
Sbjct: 333 SWNVISKPG 341

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 118/289 (40%), Gaps = 36/289 (12%)

Query: 75  FSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFG 134
            S++L  +    DG +  T  A+  S +++   +S +     + +A  Q  + +LSDIFG
Sbjct: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142

Query: 135 RFSILVISVIFYIMGTVIESQAVNI-----TRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           R  +L+++ I +++G ++     +       RF  G     +G  G+  +  +  SD   
Sbjct: 143 RKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISG-----IGGGGVTSMCSITISDIVP 197

Query: 190 LNWRLLALFIPALPFIINTWISGNVT---SAIGTNWKWGIGMWAFIL--PLACIPLGLCM 244
           L  R L   +    F + T   G V    S  G  W+      AF++  PL+ +   L  
Sbjct: 198 LRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWR-----MAFLIQVPLSALSSLLIA 252

Query: 245 LHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTL 304
           + M+   R     R+       NKL             +D IG   +  F    LV  +L
Sbjct: 253 VFMKLPPRSK---RVNSPASIKNKL-----------LSVDWIGASALVVFLSLFLVTASL 298

Query: 305 AGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDR 353
            G  KE    +   V   IG  +A   ++  E+  ++ P+ P   +++R
Sbjct: 299 GG--KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNR 345

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 79/362 (21%), Positives = 144/362 (39%), Gaps = 31/362 (8%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + RLS + G    ++  +I +  G++I + A ++     G     +G +G+  +
Sbjct: 93  ALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTL 152

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     N   R L L +    F + + +   +  A  T+  W    W F + L   P
Sbjct: 153 SLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINL---P 206

Query: 240 LG-LCMLHMRYLARKHAKDRLKPEFEALNKL--------KWKSFCIDIAFWKLDIIGMLL 290
           +G L +    +       D L+   +   KL          K   +D   +  DI+  +L
Sbjct: 207 IGGLAIAIFIFFYNPEGADLLEKGSQTFKKLLSYRRANLSLKQL-LDQLLFGFDIVSFVL 265

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRH-------- 342
            TA +   L+  T  GG    W++  I++  +I  V+ + L ++++ +   H        
Sbjct: 266 FTAGWLLFLLALTF-GGQTHPWKSG-IVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFR 323

Query: 343 PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-IVAVHESIKSATRITSLYSFV 401
           PL  W L+  R               + +Q  Y      +V    + K+   +  +   V
Sbjct: 324 PLLSWHLMSQRAILNANFTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPI--LV 381

Query: 402 SVIVGTIL-GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFG 460
           S +V +I  G I+ K    KP ++FG +  ++  GL++     S  H   IG L L G  
Sbjct: 382 STVVFSIASGVIIKKTGHIKPLLVFGSAMGVLGSGLMILLNNTSTKHTQ-IGVLILPGVA 440

Query: 461 AG 462
            G
Sbjct: 441 LG 442

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 86/210 (40%), Gaps = 9/210 (4%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S+FL  +   LDG I  T      S ++    +S +     + ++  Q  + +LSD 
Sbjct: 84  IMISMFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQ 143

Query: 133 FGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192
            GR  +LV S + + +G +I   + +I    VG     +G  G+  +  ++ SD   L  
Sbjct: 144 LGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRE 203

Query: 193 RLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLA- 251
           R +   +    F + T  SG +  A   +W+      AF +    I L  C L + YL  
Sbjct: 204 RAVYQGLCNFIFGLGT-ASGGLVGAAFQDWR-----MAFTIQCP-ISLASCALIVSYLEL 256

Query: 252 -RKHAKDRLKPEFEALNKLKWKSFCIDIAF 280
             +H  D+ +     L  L W      + F
Sbjct: 257 PPRHEDDKDRHWTSKLRDLDWAGVVTLVCF 286

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 85/201 (42%), Gaps = 31/201 (15%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR +D  GR   +VI V+ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARFADKLGRRLAIVIVVLV 145

Query: 146 YIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y++G +I+ S +    ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSSHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 205

Query: 203 PFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML--------------HMR 248
            F I         S  GT        W        +PLGLC L                R
Sbjct: 206 TFGIFL----GYCSVYGTRKYDDTAQWR-------VPLGLCFLWALIIIVGMLLVPESPR 254

Query: 249 YLARKHAKDRLKPEFEALNKL 269
           YL  +   +  +     +NK+
Sbjct: 255 YLIEREKHEEARISLAKINKV 275

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 64/152 (42%), Gaps = 5/152 (3%)

Query: 42  PAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSS 101
           P P  +E +      +E     YN  L +  + FSL+L ++   LDG I           
Sbjct: 12  PVPEEVETLP-----LEQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEE 66

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITR 161
           +S+ S    +     +     Q  + +LSDI GR S L+ +  F+ +G ++   A N+T 
Sbjct: 67  FSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTE 126

Query: 162 FAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           F++      +G  G+  I  +  SD      R
Sbjct: 127 FSIARAICGIGAGGLNAIGSIAVSDICTARER 158

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           N +  F +Y  S+   Y  +  +  +  + ++  A+G + FARL+D  GR   +VI V+ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLV 145

Query: 146 YIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y++G +I+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 205

Query: 203 PFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
            F I         S  GT        W        +PLGLC L
Sbjct: 206 TFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGLCFL 237

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           N +  F +Y  S+   Y  +  +  +  + ++  A+G + FARL+D  GR   +VI V+ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLV 145

Query: 146 YIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y++G +I+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 205

Query: 203 PFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
            F I         S  GT        W        +PLGLC L
Sbjct: 206 TFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGLCFL 237

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%)

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           YN  L +  + FSL+L ++   LD  I           +S+ S    +     +     Q
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQ 88

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSDI GR S L+I+  F+ +G ++   A N+T F++      +G  G+  I  + 
Sbjct: 89  PLYGKLSDITGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIA 148

Query: 184 ASD 186
            SD
Sbjct: 149 VSD 151

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 84/380 (22%), Positives = 162/380 (42%), Gaps = 36/380 (9%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + R + IFG  + L++S+I + +G+++ + + ++     G      G +GI  +
Sbjct: 69  ALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTL 128

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINT----WISGNVTSAIGTNWKWGIGMWAFILPL 235
           +  IA+   + + R   + + +L + + +    +I G +T  +   W+W    +   LP+
Sbjct: 129 VFAIATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEYV--TWRW---CFYINLPI 183

Query: 236 ACIPLGLCMLHMRYLARK-------HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGM 288
             + LG+  L      RK         K     EF+ L  LK+    +    ++LD  G 
Sbjct: 184 GGLALGVFYLSYNPAQRKVLKCFPHFFKSVTSLEFKQLLSLKFYRMLLKFLVFELDFFGF 243

Query: 289 LLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIG--WVVALPLY------MLWEMKYS 340
              +  F  +L+     GG    W++  II   V+G  ++V   +Y      M W+ + +
Sbjct: 244 TFCSVGF-VLLLLGLTFGGNLHPWQSGTIIAYLVVGSFFIVIFFVYEFVIFDMFWQSQRN 302

Query: 341 RH--PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHES-IKSATRITSL 397
            +  PL  W      G              + +Q  ++  +  +   +S  ++A+ + SL
Sbjct: 303 GNARPLISWTTFSKSGIFTATATMFFGCCAYNLQSIHVVQLFQLVFGQSPSRAASHLWSL 362

Query: 398 Y--SFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLC 455
              +FVS+I+    G I  +    KP  LF     ++  GLL    G+S  ++  IG   
Sbjct: 363 LIPAFVSIIIS---GKITSRYGYVKPITLFAGISGVIGAGLLTLLNGES-TNSEQIGYAI 418

Query: 456 LLG--FGAGSFTYVTQASIQ 473
           L G  FG  + + +  A IQ
Sbjct: 419 LSGAAFGCINLSTLLSAQIQ 438

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 100/236 (42%), Gaps = 24/236 (10%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           R+ +  SL++  +   +D  I        T  + +   +  V     + + V Q  + +L
Sbjct: 46  RLPMLLSLWMANFLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKL 105

Query: 130 SDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD+ GR  +LV++   +++G ++ + A NI  FA G     +G  GI  +  +   D  +
Sbjct: 106 SDVTGRRFVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFS 165

Query: 190 LN----WRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
           +     ++  A  I  +  ++   I G     +G         W  I  LA +P+    +
Sbjct: 166 VKEQSIYQSYAHIIYTIGEVLGAPIGGIALETVG---------WRAIF-LAQVPVLTICI 215

Query: 246 HMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG-MLLITAFFGCVLV 300
           ++       A+  + P  E   +L WK+        ++D+ G +LLI +  G +L+
Sbjct: 216 YLTLCDDDLAQQHIPPHGE---RLTWKNIS------RMDLSGSILLIISLCGVILL 262

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 102/246 (41%), Gaps = 37/246 (15%)

Query: 24  EKEAGTTVDV-NPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAY 82
           +  AG+  ++ N ++ +  PA    E  D    N  +  +    P   +  + +++L+ Y
Sbjct: 5   KSSAGSNTEIQNASIQVEPPAKK--ESSDGFYDNEVLNGDTIEAPKRGLLGYLTIYLLCY 62

Query: 83  AYGLDG-----------------NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVG 122
                G                 N +  F +Y  S+   Y  +  +  +  + ++  ++G
Sbjct: 63  PVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCSLG 122

Query: 123 QIFFARLSDIFGRFSILVISVIFYIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILE 181
            + FARL+D  GR   +VI V+ Y++G +I+ S      ++ VG   Y LG  G  ++  
Sbjct: 123 GVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCP 182

Query: 182 VIASDFSNLNWR--LLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIP 239
           ++ S+ +  + R  L++LF   + F I         S  GT        W        IP
Sbjct: 183 MLLSEIAPKDLRGGLVSLFQLNVTFGIFL----GYCSVYGTRKYDNTAQWR-------IP 231

Query: 240 LGLCML 245
           +GLC L
Sbjct: 232 VGLCFL 237

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 65/145 (44%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           R  +  S+ L  +   LDG I  T   +  S +++   +S +     + +A  Q  + +L
Sbjct: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198

Query: 130 SDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SDIFGR  +LV S + + +G +I   + N+    +G     +G  G+  +  +  +D   
Sbjct: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258

Query: 190 LNWRLLALFIPALPFIINTWISGNV 214
           L  R L   I  + F + T   G V
Sbjct: 259 LRSRALYQGICNVFFGLGTACGGLV 283

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 63/152 (41%), Gaps = 5/152 (3%)

Query: 42  PAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSS 101
           PAP   E++      +E     YN  L +  + FSL+L ++   LD  I           
Sbjct: 12  PAPEEAEVLP-----LEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEE 66

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITR 161
           +S+ S    +     +     Q  + +LSDI GR   L+ +  F+ +G ++   A N+T 
Sbjct: 67  FSESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFARNVTE 126

Query: 162 FAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           F++      +G  G+  I  +  SD      R
Sbjct: 127 FSIARAVCGIGAGGLNAISSIAVSDICTARER 158

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  ++G + FARL+D  GR   +VI V+ 
Sbjct: 89  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLV 148

Query: 146 YIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y++G +I+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 149 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 208

Query: 203 PFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
            F I         S  GT        W        IP+GLC L
Sbjct: 209 TFGIFL----GYCSVYGTRKYSNTAQWR-------IPVGLCFL 240

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 119/295 (40%), Gaps = 25/295 (8%)

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE Y      + + FS+FL  +   LDG I  T   +  S ++     S +     + ++
Sbjct: 76  AEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSS 135

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
             Q  + +LSD  GR  +LV S   + +G +I   + +I     G     +G  G+  + 
Sbjct: 136 TCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLA 195

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFIL--PLACI 238
            +I SD   L  R +   +    F + T  SG +  A   +W+      AFIL  P++ +
Sbjct: 196 TMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWR-----LAFILQCPISVL 249

Query: 239 PLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCV 298
              L ++++           L P   A NK  W +        +LD  G   + AF    
Sbjct: 250 SGILIVVYL----------ELPPRASASNKDCWSA-----RLRRLDWAGATSLIAFLFLF 294

Query: 299 LVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDR 353
           ++  ++ G        + +        +V   +++  E++ +  P+ P   ++DR
Sbjct: 295 MLTSSMGG--SSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDR 347

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  ++G + FARL+D  GR   +VI V+ 
Sbjct: 89  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLV 148

Query: 146 YIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y++G +I+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 149 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 208

Query: 203 PFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
            F I         S  GT        W        IP+GLC L
Sbjct: 209 TFGIFL----GYCSVYGTRKYSNTAQWR-------IPVGLCFL 240

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 99/240 (41%), Gaps = 35/240 (14%)

Query: 18  IVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSL 77
           I P + EKE     D N  L   +        I+P    +  Y  IY   L    + F  
Sbjct: 24  IAPRV-EKEWSDEFDDNEVLNGDT--------IEPPKRGLLGYLVIY---LLCYPISFGG 71

Query: 78  FLIAYAYGLDG------NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFAR 128
           FL  +  G+        N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR
Sbjct: 72  FLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGVSFAR 131

Query: 129 LSDIFGRFSILVISVIFYIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDF 187
            +D  GR   +VI V+ Y++G +I+ S      ++ VG   Y LG  G  ++  ++ S+ 
Sbjct: 132 FADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEI 191

Query: 188 SNLNWR--LLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
           +  + R  L++L+   + F I         S  GT        W        +PLGLC L
Sbjct: 192 APKDLRGGLISLYQLNMTFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGLCFL 240

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR +D  GR   +VI V+ 
Sbjct: 158 NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGVSFARFADKLGRRLAIVIVVLV 217

Query: 146 YIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y++G +I+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 218 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 277

Query: 203 PFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
            F I         S  GT        W        +PLGLC L
Sbjct: 278 TFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGLCFL 309

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 71/165 (43%), Gaps = 12/165 (7%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN------ITRFAVGGC 167
           I  V  A+G +   RL DI+GR   L+++   +++G VIE  +++      I R   G  
Sbjct: 123 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIGRIIAGIG 182

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIG 227
              + +   +LI EV   D          L I    F+ +    G  T +  T W+ G+G
Sbjct: 183 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDSTQWRVGLG 242

Query: 228 M-WAFILPLACIPLGLCML--HMRYLARKHAKDRLKPEFEALNKL 269
           + +A+ L   C+  G+  +    RYL  K   +  K      NKL
Sbjct: 243 LQFAWCL---CMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKL 284

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 82/388 (21%), Positives = 155/388 (39%), Gaps = 48/388 (12%)

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           +N  L ++ +  SL+L ++   LDG I           + +      +     +     Q
Sbjct: 30  HNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQ 89

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSD+ GR   ++ +  F+ +G ++   A ++T+FA+      +G  GI  +  + 
Sbjct: 90  PLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSIT 149

Query: 184 ASDFSNLNWRLL----ALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIP 239
            SD      R +    A  +  L  I+   I G     +G         W  +  L    
Sbjct: 150 VSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFIDTLG---------WRILFGLQVPT 200

Query: 240 LGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVL 299
           + LC      L  K+   +L        + KW +        ++DI+G           L
Sbjct: 201 ILLC----SSLVHKNVNIKLSHLLPVEERFKWSNLS------RIDILG--------SSTL 242

Query: 300 VPFTLAGGL---KEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGXX 356
           V FT++G L     E   A + +  VI ++     ++L E+ YS+  + P++L+K     
Sbjct: 243 V-FTISGVLFLCSTELNKALLSIFTVISFIA----FILIELYYSKERIMPFELLKGS--- 294

Query: 357 XXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIK-SATRITSLYSFVSVIVGTI-LGFILI 414
                       + + GD   + + + + + +  + T    L+  +SV VG++  G+IL 
Sbjct: 295 FGLASAATVISSFIIFGDIFRSPIYLQLIQGVSVTKTGFFMLFPSISVAVGSLATGWIL- 353

Query: 415 KVRRTKPFILFGISCWIVSFGLLVHYRG 442
             R TK   L   + WIV+ G+ +   G
Sbjct: 354 --RHTK-MKLSHCAYWIVTIGMSIQLLG 378

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (44%)

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           YN  L +  + FSL+L ++   LD  I           +S+ S    +     +     Q
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQ 88

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSDI GR S L+ +  F+ +G ++   A N+T F++      +G  G+  I  + 
Sbjct: 89  PLYGKLSDITGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIA 148

Query: 184 ASD 186
            SD
Sbjct: 149 VSD 151

>Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON}
           YJL214W (REAL)
          Length = 470

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 85/197 (43%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYI 147
           GN  ++  AY  S+     ++S  N    V +A+G +F ++L DI+GR   L+I ++ Y+
Sbjct: 100 GNYSHSRNAYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCVGLIIVIVVYM 155

Query: 148 MGTVIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNL---NWRLLALF 198
           +G VI+  +V+      I R   G     + +   +LI E             W+L+  F
Sbjct: 156 VGIVIQIASVDKWYQYFIGRIVAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 215

Query: 199 IPALPFIINTWISGNVTSAIGTNWKWGIGM---WAFILPLACIPLGLCML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 216 AIFLGYCTNY---GTKSYSNSIQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 266

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ K  F   NKL
Sbjct: 267 VGRVEKAKASFAKSNKL 283

>Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)
          Length = 569

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 90/198 (45%), Gaps = 28/198 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYI 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   L+I ++ Y+
Sbjct: 101 GNYSHSKGTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 MGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           +G VI+  +V+   ++ +G     +G   I ++  ++ S+ +  +        W+L+  F
Sbjct: 157 VGIVIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGNVTSAIGTNWKWGIGM---WAFILPLACIPLGLCML---HMRYLAR 252
              L +  N    G  T +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 217 AIFLGYCTNY---GTKTYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 267

Query: 253 KHAKDRLKPEFEALNKLK 270
               ++ +  F   NKL 
Sbjct: 268 VKKTEQARASFAKSNKLS 285

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 63/141 (44%), Gaps = 2/141 (1%)

Query: 53  GVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           G   IE   E+ N  +    +  S++L  +   LD  +  T  A+  S ++Q   +  V 
Sbjct: 381 GTLPIEPSVEMSNMKMN--IIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVA 438

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLG 172
               + +AV Q  + +LSDIFGR ++L+ S + +  G +I   + ++     G     +G
Sbjct: 439 TSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIG 498

Query: 173 LTGIILILEVIASDFSNLNWR 193
             GI  +  +  SD   L  R
Sbjct: 499 GGGITSMTTITVSDIVPLRSR 519

>YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein of
           unknown function with similarity to hexose transporter
           family members, expression is induced by low levels of
           glucose and repressed by high levels of glucose
          Length = 569

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 90/196 (45%), Gaps = 26/196 (13%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYI 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   L+I ++ Y+
Sbjct: 101 GNYSHSKNTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 MGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           +G VI+  +++   ++ +G     +G   I ++  ++ S+ +  +        W+L+  F
Sbjct: 157 VGIVIQIASIDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGNVTSAIGTNWKWGIGM---WAFIL--PLACIPLGLCMLHMRYLARK 253
              L +  N    G  T +    W+  +G+   WA I+   +  +P        R+L + 
Sbjct: 217 AIFLGYCTNY---GTKTYSNSVQWRVPLGLCFAWAIIMIGGMTFVP-----ESPRFLVQV 268

Query: 254 HAKDRLKPEFEALNKL 269
              ++ K  F   NKL
Sbjct: 269 GKIEQAKASFAKSNKL 284

>Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1407
           bp, 468 aa] {ON} YJL214W (REAL)
          Length = 468

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 84/197 (42%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYI 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   LVI ++ Y+
Sbjct: 98  GNYSHSKDVYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLVIVIVVYM 153

Query: 148 MGTVIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNL---NWRLLALF 198
           +G VI+  +V+      I R   G     + +   +LI E             W+L+  F
Sbjct: 154 VGIVIQIASVDKWYQYFIGRIVAGVGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 213

Query: 199 IPALPFIINTWISGNVTSAIGTNWKWGIGM---WAFILPLACIPLGLCML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 214 AIFLGYCTNY---GTKSYSNSIQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 264

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ K  F   NKL
Sbjct: 265 VGRVEKAKASFAKSNKL 281

>Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)
          Length = 315

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 89/197 (45%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYI 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR + L+I ++ Y+
Sbjct: 97  GNYSHSKGTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCTGLIIVIVVYM 152

Query: 148 MGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           +G VI+  +V+   ++ +G     +G   I ++  ++ S+ +           W+L+  F
Sbjct: 153 VGIVIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 212

Query: 199 IPALPFIINTWISGNVTSAIGTNWKWGIGM---WAFILPLACIPLGLCML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 213 AIFLGYCTNY---GTKSYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 263

Query: 253 KHAKDRLKPEFEALNKL 269
               +  +  F   NKL
Sbjct: 264 VKKTEEARASFAKSNKL 280

>SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON}
           highly similar to gnl|GLV|KLLA0C16852g Kluyveromyces
           lactis KLLA0C16852g and similar to uniprot|P25297
           YML123C Saccharomyces cerevisiae PHO84 High- affinity
           inorganic phosphate (Pi) transporter and low- affinity
           manganese transporter
          Length = 570

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 82/192 (42%), Gaps = 34/192 (17%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-----SQAV 157
           S  +LL     + TVI   GQI F  ++DI GR  I  + +I  +  TV++     S AV
Sbjct: 96  STTTLLKVSTSVGTVI---GQIGFGTMADIVGRKKIYGLELIVMMAATVLQCTLGKSPAV 152

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR---LLALF-----------I 199
           +   F     FY+    +G+ G   +  +I S+FS   WR   + A+F           I
Sbjct: 153 S---FVAVLAFYRVIMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAGI 209

Query: 200 PALPFII---NTWISGNVTSAIGTNW-KWGIGMWAFILPLACIPLGLCMLHMRYLARKHA 255
            AL  +    N  I  N  +  G    K    MW  ++ L C+P G+  L+ R    +  
Sbjct: 210 VALVLVAAYKNQLIDVNTGAECGIECAKACDQMWRILVGLGCVP-GVVALYFRLTIPESP 268

Query: 256 KDRLKPEFEALN 267
           + +L    EA N
Sbjct: 269 RYQLDVHVEAEN 280

>Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)
          Length = 569

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 89/197 (45%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYI 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   L+I ++ Y+
Sbjct: 101 GNYNHSKDTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 MGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           +G +I+  +V+   ++ +G     +G   I ++  ++ S+ +           W+L+  F
Sbjct: 157 VGIIIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGNVTSAIGTNWKWGIGM---WAFILPLACIPLGLCML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 217 AIFLGYCTNY---GTKSYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 267

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ +  F   NKL
Sbjct: 268 VKKTEQARASFAKSNKL 284

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVI 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   LVI  + Y++G VI
Sbjct: 93  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 149

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 150 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 209

Query: 204 FIINTWISGNVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGLCMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 210 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 269

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 270 SNKIDVEDP 278

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVI 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   LVI  + Y++G VI
Sbjct: 92  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 148

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 149 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 208

Query: 204 FIINTWISGNVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGLCMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 209 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 268

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 269 SNKIDVEDP 277

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVI 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   LVI  + Y++G VI
Sbjct: 95  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 151

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 152 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 211

Query: 204 FIINTWISGNVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGLCMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 212 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 271

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 272 SNKIDVEDP 280

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 67/155 (43%), Gaps = 4/155 (2%)

Query: 42  PAPSYIELIDPGVHNIEI---YAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYA 98
           PA S IE +  G + I +   Y E +N  L +V +  SL+L ++   LD  I        
Sbjct: 12  PARSTIEEVPEGEYEISLEKKYHE-HNLSLPKVPILSSLWLGSFFSSLDSTIVANIMNRV 70

Query: 99  TSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN 158
              +++      +     +     Q  + +LSDI GR   ++ +  F+ +G ++   A N
Sbjct: 71  AEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLLTCFAQN 130

Query: 159 ITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           +T+F++      +G  GI  +  +  SD      R
Sbjct: 131 VTQFSIARAICGMGAGGINAMSSITTSDICTTRER 165

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 282 KLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSR 341
            +D IG    T   G +L  F       + W +A++IV  VI  V+AL  + ++E++Y+ 
Sbjct: 250 SMDWIGSF--TGVLGLILFNFVWNQAPADGWNSAYLIVLLVIS-VIALIAFGIYELRYAE 306

Query: 342 HPLTPWDLIKDR 353
           +PL P ++I++R
Sbjct: 307 NPLLPSEIIRNR 318

>TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.858
           YML123C
          Length = 661

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 73/170 (42%), Gaps = 44/170 (25%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIES---QAVNI 159
           S  +LL     + TV   VGQ+ F  L+D+ GR  I    +I  I+ T++++   QA  +
Sbjct: 99  STQTLLKVSTSVGTV---VGQVGFGVLADLLGRKKIYGCELIIIIVCTILQTMCGQAPGL 155

Query: 160 TRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVT 215
           + F     FY+    LG+ G   +  +I S+F+   WR                  G + 
Sbjct: 156 S-FTAMLTFYRIVMGLGIGGDYPLSSIITSEFATTKWR------------------GAIM 196

Query: 216 SAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEA 265
            A+  N  WG  +++ I+ + CI                 KD+LKP +++
Sbjct: 197 GAVFANQAWG-QIFSGIVSIVCIAA--------------YKDQLKPAYDS 231

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 73/179 (40%), Gaps = 3/179 (1%)

Query: 48  ELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           + ID    +IE        P     +  S++L  +   LD  I  T  A+  S +++   
Sbjct: 106 KTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPH 165

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGC 167
           +S +     + +A  Q  + ++SDIFGR  +L+ S + + +G +I   +  +     G  
Sbjct: 166 ISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVT---SAIGTNWK 223
              +G  G+  +  +  SD   L  R L   I    F + T   G V    S  G  W+
Sbjct: 226 IAGIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGGGWR 284

>Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii AFR442C
          Length = 572

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 73/173 (42%), Gaps = 34/173 (19%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-----SQAV 157
           S +SLL     + TVI   GQ+ F  L+D+ GR  I  + +I  I  TV++     S ++
Sbjct: 97  STNSLLKVSTSVGTVI---GQVGFGTLADVVGRKKIYGVELIIMIAATVLQCTIGSSPSI 153

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR---LLALFIPA--------- 201
           N         FY+    +G+ G   +  +I S+FS   WR   + A+F            
Sbjct: 154 NFVAVLT---FYRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQLSCGI 210

Query: 202 LPFIINTWISGNVTSAIGTN------WKWGIGMWAFILPLACIPLGLCMLHMR 248
           L  I+     G++  A   +       K    MW  ++   C+P GL  L+ R
Sbjct: 211 LALILVAAYKGDLVGATTGDECGFECQKACDQMWRILVGFGCVP-GLIALYFR 262

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 69/164 (42%), Gaps = 12/164 (7%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN------ITRFAVGGCFYQLG 172
            AVG +   +L DI+GR   L+++ I +++G +IE  +V+      I R   G     + 
Sbjct: 126 CAVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIA 185

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIG---MW 229
           +   +LI EV   +          L I    F+ N    G  + +    W+ G+G   +W
Sbjct: 186 VLSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYSNSAQWRIGVGLQFLW 245

Query: 230 AFILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKS 273
           + I+  A +         RYL +K   ++ K      NK+   S
Sbjct: 246 SIIMVCAMM---FVPESPRYLIQKGKTEQAKISIARSNKVDIDS 286

>AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YDR343C (HXT6), YDR342C (HXT7) and YHR092C (HXT4)
          Length = 539

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 75/184 (40%), Gaps = 25/184 (13%)

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-SQAVNIT 160
           Y  ++ +  +  I  +  AVG I  +RL D++GR   L+I  + Y++G +I+ S      
Sbjct: 88  YWSNARVGLIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWY 147

Query: 161 RFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGT 220
           ++ +G     LG+ GI ++  ++ S+ S  + R     +     +I   I     +  GT
Sbjct: 148 QYCIGRVISGLGVGGIAVLSPMLISETSPKHLR--GTLVSCYQLMITAGILLGYCANYGT 205

Query: 221 NWKWGIG-MWAFILPLACIPLGLCML--------------HMRYLARKHAKDRLKPEFEA 265
             ++     W        IPLGLC L                RYL  K   +  K     
Sbjct: 206 KSRYDDSRQWR-------IPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLAT 258

Query: 266 LNKL 269
            NK+
Sbjct: 259 SNKV 262

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 282 KLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSR 341
           K+D +G +L    FG +++ F         W++A+IIV  V+ +  AL +++++E+KY++
Sbjct: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326

Query: 342 HPLTPWDLIKDRG 354
            PL P  +  +RG
Sbjct: 327 TPLIPKAISSNRG 339

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 106/250 (42%), Gaps = 23/250 (9%)

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + I G  S L++S++ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 171 LLWGRFATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVI 230

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           AS  +    R++ + + +  + +   +   +  A+ T+  W    W F + L    L   
Sbjct: 231 ASTLTPDRSRVIIISVLSCSYAVAAVVGPFLGGALTTHVTW---RWCFYINLPIGGLAFV 287

Query: 244 MLHMRY--LARKHAKDRL---KPEF-EALNKLKWKSFCIDIAFW---KLDIIGMLLITAF 294
           +L M Y    RK  KD     K  +   + +L    F   I  W   ++D +G +L TA 
Sbjct: 288 VLAMVYNPSGRKSIKDVFSVTKANYRRGMGRLLTARFYSKIPNWLVFQIDFVGFVLCTAG 347

Query: 295 FGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVV----------ALPLYMLWEMKYSRHPL 344
           F  +L+  T  G +   W +  IIV  V+G ++            P +       S  PL
Sbjct: 348 FTLLLLGLTFGGSM-YAWSSGTIIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCMPL 406

Query: 345 TPWDLIKDRG 354
            PW ++   G
Sbjct: 407 LPWRVVSRPG 416

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 283 LDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRH 342
           +D IG +L  A  G +L+ F    G    W+TA+II   V+  V  L L+  +E+KY+  
Sbjct: 265 MDWIGSVL--AVIGLILLNFVWNQGPIVGWQTAYIIALLVVS-VFFLALFFTYEVKYAES 321

Query: 343 PLTPWDLIKDR 353
           PL P ++ K+R
Sbjct: 322 PLLPVEVTKNR 332

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 69/168 (41%), Gaps = 18/168 (10%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN------ITRFAVGGC 167
           I  V  A+G +   RL DI+GR   L+++ + +++G VIE  +++      I R   G  
Sbjct: 124 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGIG 183

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIG 227
              + +   +LI EV   D          L I    F+ +    G+ T +  T W+ G+G
Sbjct: 184 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCTEYGSKTYSDSTQWRVGLG 243

Query: 228 M---WAFILPLACIPLGLCML---HMRYLARKHAKDRLKPEFEALNKL 269
           +   W   +      +G  M      R+L  K   +  K      NKL
Sbjct: 244 LQFAWCLFM------VGGMMFVPESPRFLIEKGKLEEAKRSVATSNKL 285

>NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}
           Anc_8.858
          Length = 613

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 64/150 (42%), Gaps = 36/150 (24%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-----SQAV 157
           S ++LL     + TVI   GQI F  ++DI GR  I  + +I  I+ T+++     S ++
Sbjct: 113 STNTLLKVSTSVGTVI---GQIGFGTMADIMGRKKIYGLELILMIVTTILQCMTGSSPSI 169

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N         FY+    +G+ G   +  +I S+FS   WR                  G 
Sbjct: 170 NFVAILT---FYRIVMGIGIGGDYPLSSIITSEFSTTKWR------------------GA 208

Query: 214 VTSAIGTNWKWGI---GMWAFILPLACIPL 240
           +  A+  N  WG    G+ A IL  A  P+
Sbjct: 209 IMGAVFANQAWGQILGGIVALILVAAYKPM 238

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 116 TVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLT 174
            V  A+G  F  RL DI+GR   L+++ + +I+GTVI+  +V    ++ +G     LG  
Sbjct: 128 NVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIGRIIAGLGCG 187

Query: 175 GIILILEVIASDFSNLNWR 193
            I ++  ++ S+ S  N R
Sbjct: 188 LIAILSPMLISEVSPKNMR 206

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%)

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           +NR L +  +  SL+L ++   +D +I           + +      +     +  A  Q
Sbjct: 37  HNRSLPKAPILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQ 96

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVG 165
             + R SDI GR   L+I+  F+++GT++   A N+T FA+ 
Sbjct: 97  PLYGRCSDIVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIA 138

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 145/353 (41%), Gaps = 33/353 (9%)

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + IFG    L++S++ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           AS  +    R +A+ + +  + +    S  + SA  T+  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHVTW---RWCFYINLPIGGLAFA 210

Query: 244 MLHMRYLARKHAKDRLKPEFEALNKL----KWKSFCIDIAFWKL--DIIGMLLITAFFGC 297
           +L + Y  + H  +  +     L         + F  D+ + K+  +++       F  C
Sbjct: 211 VLVLTY--KPHEGNSARSIVSVLKSCCEFGTARLFSKDL-YLKMFNELVFGFDFIGFIFC 267

Query: 298 VL--VPFTLA---GGLKEEWRTAHIIVPEVIGWVVALPLYMLWEM----KYSR------- 341
            +  + F L    GG K  W +  IIV  V+G  +++  ++L++     K+ R       
Sbjct: 268 SVGFILFRLGLTFGGDKYTWSSGAIIVYFVVGVTISVA-FLLYDFMVFPKFGRVRKNASF 326

Query: 342 HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-IVAVHESIKSATRITSLYSF 400
            PL PW ++   G              +  Q  Y+     +V   ++ +++  + +L   
Sbjct: 327 RPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EI 385

Query: 401 VSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGA--HAGII 451
             +I   I G I       KP I  GI   +V  GLL     DSG+  H G++
Sbjct: 386 PDIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHIGLL 438

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 55/121 (45%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  SL+L      +DG I  T      S + + SL++ V     +     Q  + + SD+
Sbjct: 53  VLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSDL 112

Query: 133 FGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192
            GR   L+ + + +I+G V+   A  +   A+      +G +G+  +  +I SD + L+ 
Sbjct: 113 LGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLSQ 172

Query: 193 R 193
           R
Sbjct: 173 R 173

>SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P53387 Kluyveromyces lactis
           KHT2 Hexose transporter 2
          Length = 571

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 105/246 (42%), Gaps = 39/246 (15%)

Query: 55  HNIEIYAEIYNRP--------LYRVALFFSLFLIAYAYG-LDGNIRYT-----FQAYATS 100
              EI AEI  +P        +  + + F  F++ +  G + G +  T     F  Y+ S
Sbjct: 49  EETEIVAEIPKKPASAYITVSIMCLCVAFGGFVVGWDTGTISGFVNQTDFKRRFGEYSHS 108

Query: 101 S---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAV 157
               Y  +  +  +  I  V  AVG +  ++L DI+GR   L+   I Y++G VI+  +V
Sbjct: 109 KDEYYLSNVRVGLIVSIFNVGCAVGGLVLSKLGDIYGRCIGLMAVTIVYVVGIVIQISSV 168

Query: 158 NI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALFIPALPFIINT 208
           +   ++ +G     LG+ G+ ++  ++ S+ +  +        W+L+  F   L +  N 
Sbjct: 169 DKWYQYFIGRIVSGLGVGGVCVLAPMLISETAPKHLRGTLLACWQLMVTFAIFLGYCANY 228

Query: 209 WISGNVTSAIGTNWKWGIGM---WAFILPLACIPLGLCML--HMRYLARKHAKDRLKPEF 263
              G  +      W+  +G+   WA I+      +G+C +    R+L +    +  K   
Sbjct: 229 ---GTKSYDNSVQWRVPLGLCFAWAIIM-----VVGMCFVPESPRFLVKVGRVEDAKRSV 280

Query: 264 EALNKL 269
              NK+
Sbjct: 281 AKSNKI 286

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 282 KLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSR 341
            +D IG +L    FG +++ F         W++A+IIV  V+ +  AL +++++E+KY++
Sbjct: 294 SMDWIGAIL--GIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 350

Query: 342 HPLTPWDLIKDRG 354
            PL P  +  +RG
Sbjct: 351 TPLIPKAISSNRG 363

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 120/306 (39%), Gaps = 38/306 (12%)

Query: 51  DPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D G+   E Y E YN  L +  +  SL+L ++   LD  I           + +      
Sbjct: 23  DNGLE--EQYHE-YNLSLPKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEFEESDKKQW 79

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQ 170
           +     +     Q  + +LSDI GR   ++ S  F+ +G  +   A NIT+F++      
Sbjct: 80  IATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCFAQNITQFSIARAICG 139

Query: 171 LGLTGIILILEVIASDFSNLNWRLL----ALFIPALPFIINTWISGNVTSAIGTNWKWGI 226
           +G  G+  +  +  SD  +   R +    A  +  L  ++   + G    ++G       
Sbjct: 140 IGAGGVNAMSSITVSDICSTRERGIYQGYANIVFGLGQLLGAPLGGLFIDSVG------- 192

Query: 227 GMWAFILPLACIPLGLC-MLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDI 285
             W  I  +    L LC  L  R +  K A   + P  E   +  WK+        ++DI
Sbjct: 193 --WRVIFGVQVPMLLLCSTLATRNINVKLA--HIPPRKE---RFTWKNLS------RIDI 239

Query: 286 IGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLT 345
            G L +      +L  F  +  L +   T  +I   +        L++  E+ Y++  + 
Sbjct: 240 FGSLALVGTISSLL--FLTSTTLNKIVLTLSMIASFI--------LFIWIELYYAKERIL 289

Query: 346 PWDLIK 351
           P+DL+K
Sbjct: 290 PFDLLK 295

>TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 12/160 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN------ITRFAVGGCFYQLGL 173
           A+G +   RL DI+GR   L+++   +++G VIE  +++      I R   G     + +
Sbjct: 130 AIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAI 189

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGM-WAFI 232
              +LI EV   +          L I    F+ +    G  T +    W+ G+G+ +A+ 
Sbjct: 190 LSPMLISEVSPREMRGAMVSCFQLMITLGIFLGDCTEYGTKTYSNSVQWRVGLGLQFAWC 249

Query: 233 LPLACIPLGLCML--HMRYLARKHAKDRLKPEFEALNKLK 270
           L   C+  G+  +    RYL  K   +  K      NKL 
Sbjct: 250 L---CMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKLN 286

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 105/443 (23%), Positives = 179/443 (40%), Gaps = 45/443 (10%)

Query: 71  VALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLS 130
           ++L  S+FL A    LD  I  T        +  +S    +    ++ +A+  + + R++
Sbjct: 59  ISLILSIFLAA----LDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIA 114

Query: 131 DIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNL 190
            + G  S ++ ++I + +G+++ + A ++     G     LG +GI  +  VI S     
Sbjct: 115 AVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEE 174

Query: 191 NWRLLALFIPALPF----IINTWISGNVTSAIGTNWKW---------GIGMWAFILPLAC 237
           + R L +      F    ++  ++ G  T+ +   W+W         G+    FIL    
Sbjct: 175 SKRGLLIACMGSAFGIASVVGPFLGGAFTTHV--TWRWCFWINLPIGGLAFAFFILFYN- 231

Query: 238 IPLGLCMLHMRYLAR--KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFF 295
            P G     + Y+    K     LK   + L    W+    ++  +K DII   L T   
Sbjct: 232 -PHGSDQTFVGYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHEL-IYKFDIIEFALCTT-- 287

Query: 296 GCVLVPFTLA-GGLKEEWRTAHIIVPEVIGWVVALPLYMLWE------MKYSR-----HP 343
           G VL+   L+ GG K  W +   I   VIG +V + L ++++      +K  R      P
Sbjct: 288 GLVLILLALSFGGNKYAWNSGSTIAMFVIGILVTI-LALVYDFAIFPRLKVVRENPRYQP 346

Query: 344 LTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSV 403
           L P  + K                 +  Q +Y+     +  +E+   A+ I  +   V  
Sbjct: 347 LIPLRVAKKFFICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKAS-IHVIACVVPT 405

Query: 404 IVGTILGFIL-IKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLG--FG 460
           ++  I   IL  K    KP  + GI+  IV  GLL      S  ++  IG L L G  FG
Sbjct: 406 VITVITSGILNSKFGIVKPINVLGITAAIVGAGLLTLLTNKS-TNSEHIGLLILPGVAFG 464

Query: 461 AGSFTYVTQASIQASAK-THARM 482
           A   + +  + IQ   K TH RM
Sbjct: 465 ATMQSTLIGSQIQLDKKSTHYRM 487

>NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}
           Anc_8.858
          Length = 570

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 64/145 (44%), Gaps = 34/145 (23%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVI-----ESQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I  I+ +V+     ES+A+
Sbjct: 88  STATLLKVSTSVGTVI---GQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAI 144

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N   F     FY+    +G+ G   +  +I S+F+   WR                  G 
Sbjct: 145 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 183

Query: 214 VTSAIGTNWKWGIGMWAFILPLACI 238
           +  A+  N  WG  + A I+ L C+
Sbjct: 184 IMGAVFANQAWG-QIAAGIVALVCV 207

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 89/206 (43%), Gaps = 24/206 (11%)

Query: 97  YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTV 151
           + ++S S    LS V       +  V  A+G  F  RL DI+GR   L+++   +I+GTV
Sbjct: 97  FGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGSFFLGRLGDIYGRRIGLIVASFIFIVGTV 156

Query: 152 IESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWI 210
           I+  +V    ++ +G     LG   I ++  ++ S+ S  N R   +    L   +  ++
Sbjct: 157 IQIASVKAWYQYMIGRIVAGLGCGLIAILSPMLISEVSPKNMRGAMVSCYQLMITLGIFL 216

Query: 211 S-----GNVTSAIGTNWKWGIGMWAFILPLA-CIPLGLCMLHM----RYLARKHAKDRLK 260
                 G       T W+ G+G     L  A C+ + + ML +    R+L  K    R++
Sbjct: 217 GYCTNYGTKRYHDSTQWRVGLG-----LQFAWCLCMIVAMLFVPESPRFLVEKG---RIE 268

Query: 261 PEFEALNKLKWKSFCIDIAFWKLDII 286
               ++ K    S    +  W+LD I
Sbjct: 269 EAKRSIGKSNGVSPDDPVTLWELDEI 294

>Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 86/217 (39%), Gaps = 32/217 (14%)

Query: 75  FSLFLIAYAYG-LDGNIRYT--FQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFF 126
           F  F+  +  G + G +R T   + + T+  +  S LS V       I  +  A+G I  
Sbjct: 95  FGGFVFGWDTGTISGFVRQTDYIRRFGTTRANGTSYLSNVRTGLLVSIFNIGCAIGGIVL 154

Query: 127 ARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIAS 185
           +RL D++GR   LVI V+ Y +G +I+  +++   ++ +G     LG+ GI ++  ++ S
Sbjct: 155 SRLGDMYGRKIGLVIVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLIS 214

Query: 186 DFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
           + S    R     +     +I   I     +  GT        W        +PLGLC  
Sbjct: 215 EVSPKQLR--GTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWR-------VPLGLCFA 265

Query: 246 --------------HMRYLARKHAKDRLKPEFEALNK 268
                           RYL      D  K     +NK
Sbjct: 266 WSIFMIFGMSFVPESPRYLVEVGKMDEAKRALARVNK 302

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 55/122 (45%)

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
           A+  SL +  +   LDG I  T   Y  S +     +S +     + A + Q  + +LSD
Sbjct: 153 AIVSSLVVGVFLGSLDGTILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSD 212

Query: 132 IFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
           IFGR +IL+ S + + +G ++   A  +     G     +G  G+  +  +I SD   L 
Sbjct: 213 IFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLR 272

Query: 192 WR 193
            R
Sbjct: 273 SR 274

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 6/119 (5%)

Query: 51  DPGVHNI---EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           D  VH+I   E + +  N P  +  +  SL+L ++   LDG I           + +   
Sbjct: 19  DNNVHSILEKEYHEQNLNLP--KTPILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDK 76

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDI-FGRFSILVISVIFYIMGTVIESQAVNITRFAVG 165
              +     +     Q  + +LSD+  GR    +++  F+ +G VI   A N+T+FAVG
Sbjct: 77  KQWIATSFLLTNTAFQPLYGKLSDVATGRKGAALVAQFFFCLGLVISCFAQNVTQFAVG 135

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 74/352 (21%), Positives = 137/352 (38%), Gaps = 31/352 (8%)

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + IFG    L++S++ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           AS  +    R +A+ + +  + +       +  A  T+  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHVTW---RWCFYINLPIGSLAFA 210

Query: 244 MLHMRYLARKHAKDRLKPEFEALNKL----KWKSFCIDIAFWKLDIIGMLLITAFFGCVL 299
           +L + Y  + H  +  +     L         + F  D+     D +        F    
Sbjct: 211 VLVLTY--KPHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFDELVFGFDFIGFIFCS 268

Query: 300 VPFTL------AGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEM----KYSR-------H 342
           V F L       GG K  W +  IIV  ++G  +++  ++L++     K+ R        
Sbjct: 269 VGFILFLLGLTFGGDKYAWSSGAIIVYFIVGVTISVA-FLLYDFMIFPKFGRVRKNASFR 327

Query: 343 PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-IVAVHESIKSATRITSLYSFV 401
           PL PW ++   G              +  Q  Y+     +V   ++ +++  + +L    
Sbjct: 328 PLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EIP 386

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGA--HAGII 451
            +I   I G I       KP I  GI   +V  GLL     DSG+  H G++
Sbjct: 387 DIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHIGLL 438

>Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}
           YML123C (REAL)
          Length = 585

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN--IT 160
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I  I+ T++++   +    
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAI 158

Query: 161 RFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
            F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN--IT 160
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I  I+ T++++   +    
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAI 158

Query: 161 RFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
            F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 56/131 (42%), Gaps = 1/131 (0%)

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           +N  L ++ +  SL+L ++   LDG I           + +      +     +     Q
Sbjct: 33  HNLALPKIPILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQ 92

Query: 124 IFFARLSDIF-GRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
             + +LSD+  GR    +I+  F+ +G +I   A N+T+FA+G     +G  G+  +  +
Sbjct: 93  PLYGKLSDVATGRKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSI 152

Query: 183 IASDFSNLNWR 193
             SD      R
Sbjct: 153 AVSDICTAKER 163

>KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 68/166 (40%), Gaps = 24/166 (14%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGII 177
            A+G I  ++  D++GR   L+I V  YI+G VI+   +N   ++ +G     LG+ GI 
Sbjct: 120 CAIGGIILSKAGDMYGRKKGLIIVVSIYIVGIVIQIATINKWYQYFIGRIISGLGVGGIS 179

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLAC 237
           ++  ++ S+ S  + R     +     +I   I     +  GT        W        
Sbjct: 180 VLSPMLISEVSPKHLR--GTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWR------- 230

Query: 238 IPLGLCM---LHM-----------RYLARKHAKDRLKPEFEALNKL 269
           +PLGLC    L M           RYL  K+  +  K      NK+
Sbjct: 231 VPLGLCFAWALFMIGGMTFVPESPRYLLEKNLIEEAKHSISISNKV 276

>Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}
           similar to Ashbya gossypii AFR602W
          Length = 530

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 123/281 (43%), Gaps = 41/281 (14%)

Query: 24  EKEAGTT-------VDVNPTLTISSPAPSYIELID--PGVHNIEIYAEIYNRPLYRVALF 74
           EK +G++        DVN  +  SS   S  +L+   P V +  +   +    L+ + + 
Sbjct: 6   EKASGSSYLYDVEKADVNGVIA-SSTDKSVEQLVTVVP-VMDSPVMGSLAKPVLFCMVIA 63

Query: 75  FSLFLIAYAYGLDGNIRY--TFQAYATSSYSQHS--------LLSTVNCIKTVIAAVGQI 124
           F  F++ +  G  G +    +F+ +  + Y+  +        LL  +  I  V  A+G +
Sbjct: 64  FGGFILGWDIGTIGGLMNMPSFKNHFGTRYNASTGLNEFPNLLLGLIIGIFNVACALGGL 123

Query: 125 FFARLSDIFGRFSILVISVIFYIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             A++ D  GR   + +S++ Y+ G VIE ++  +  +F +G  F  +G+  + +++ + 
Sbjct: 124 TLAKVGDFKGRKVGIAVSLLVYVFGVVIELAKPTHWGQFFIGRIFTGVGVGSLTVLVPMY 183

Query: 184 ASDFSNLNWR--LLALFIPALP--FIINTWISGNVTSAIG-----TNWKWGIG---MWAF 231
            ++ S +  R  ++ LF   +    ++  +++       G      +W+  I    MWA 
Sbjct: 184 VAEISPVRIRGSMVVLFQLNITVGVLVGNFVNYGCKKGFGDILSKKHWQVPIALGPMWA- 242

Query: 232 ILPLACIPLGLCML--HMRYLARKHAKDRLKPEFEALNKLK 270
               A + LGL M+     YLA K      +  F  +N L+
Sbjct: 243 ----AVVLLGLVMIPESSHYLASKDKIKEAERSFAVMNALE 279

>ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON}
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123C PHO84 High-affinity inorganic phosphate (Pi)
           transporter and low-affinity manganese transporter
           regulated by Pho4p and Spt7p mutation confers resistance
           to arsenate exit from the ER during maturation requires
           Pho86p
          Length = 604

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 89/221 (40%), Gaps = 44/221 (19%)

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
           A+   + ++ Y Y  DGNI            S  +LL     + TVI   GQ  F  L+D
Sbjct: 77  AINLGVSMMTYVYWKDGNI----------PSSSETLLKVSTSVGTVI---GQFGFGILAD 123

Query: 132 IFGRFSILVISVIFYIMGTVIE-----SQAVNITRFAVGGCFYQLGLTGIIL----ILEV 182
           + GR  I  + +I  I   +++     S AVN T       F+++ +   I     +  +
Sbjct: 124 VLGRKKIYGVELIIMIAACIMQCVIGASPAVNFTAIMT---FFRIIMGIGIGGDYPLSSI 180

Query: 183 IASDFSNLNWR---LLALF-----------IPALPFI---INTWISGNVTSAIGTNWKWG 225
           I S+FS   WR   + A+F           I AL  +    +   +    S  G + K  
Sbjct: 181 ITSEFSTTKWRGAIMSAVFANQAFGQVAAGIVALILVEGYKDDLKAAKSGSTCGPSCKRA 240

Query: 226 IG-MWAFILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEA 265
              MW  ++ + C+P G   L+ R    +  +  L  EF+A
Sbjct: 241 CDQMWRILIGMGCVP-GCIALYFRLTIPESPRYTLDVEFDA 280

>TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 80/185 (43%), Gaps = 14/185 (7%)

Query: 98  ATSSYSQHSLLSTVN----CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE 153
           +T+ Y +H L          I  +  A+G +    + DI+GR   L+I+ I ++ G VIE
Sbjct: 101 STNKYGEHYLSKARTGLLVSIFNIGCAIGSVTLGNIGDIYGRRLGLIIATIIFVAGVVIE 160

Query: 154 SQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPALPFIIN 207
             +++   ++ +G     +G+  ++++  ++ S+ S    R        L I    F+ +
Sbjct: 161 IASIDKWYQYFIGRIISGVGMGVVVILSPMLISEVSPKELRGAMVSSFQLMITLGMFLGD 220

Query: 208 TWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML--HMRYLARKHAKDRLKPEFEA 265
               G    +  T W+ G+G+  F   L C+  G+  +    R+L  K   +  K     
Sbjct: 221 CTEYGTKKYSNSTQWRVGLGL-QFAWSL-CMVGGMLFVPESPRFLVEKGKIEEAKRSVAI 278

Query: 266 LNKLK 270
            NKL 
Sbjct: 279 SNKLN 283

>NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {ON}
           Anc_3.23
          Length = 530

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 33  VNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRP---------LYRVALFFSLFLIAYA 83
           + PT  I+   P    ++     + E      N+P         L  +A+ F+ F + + 
Sbjct: 14  ITPTDRITITVPDDPLIVTSNKKSNEQDGRYVNKPEKSHLLIPILICIAIAFAGFTLGWD 73

Query: 84  YGLDGNIRY--TFQAYATSSYSQHS--------LLSTVNCIKTVIAAVGQIFFARLSDIF 133
            G  G +    +FQ    +SY            LL  +  I  +  AVG +  A+L+D F
Sbjct: 74  IGTIGGMTSMESFQNRFGTSYDSQRGVQYFPDLLLGLIISIFNIGCAVGSVTLAKLADWF 133

Query: 134 GRFSILVISVIFYIMGTVIE 153
           GR + L ++VI Y++G +I+
Sbjct: 134 GRKTGLYVTVIIYVIGLLIQ 153

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 71  VALFFSLFLIAYAYGLD-GNIRYTFQAYATS-----SYSQHSLLSTVNCIKTVIAAVGQI 124
           V L F   L  + +G D G I    Q+  T      +Y     +++   +  +IAA+G  
Sbjct: 67  VMLTFVASLSGFLFGYDTGYISSALQSVGTDLGHQLTYRDKEYITSATSLGALIAALGAG 126

Query: 125 FFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGL 173
             A   D+FGR   ++ S I +++GTV++  A N  +  VG      G+
Sbjct: 127 ICA---DLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGI 172

>Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 22/189 (11%)

Query: 27  AGTTVDVNPTLTISSPAPSYIELIDPGVHNIE-IYAEIYNRPLYRVA---LFFSLFLIAY 82
           A  T   N  L    P  SY+    P    +E +  E+ N+   +     LF S+  +  
Sbjct: 34  APGTAGYNNDLPQVKPVSSYVSHEGPPKDELEELQKEVDNQLESKSKSDLLFVSICCLMV 93

Query: 83  AYG----------LDGNIRYT--FQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIF 125
           A+G          + G +R T   + + ++     S LS V       I  +  A+G I 
Sbjct: 94  AFGGFVFGWDTGTISGFVRQTDFIRRFGSTRADGTSYLSDVRTGLMVSIFNIGCAIGGIV 153

Query: 126 FARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIA 184
            +RL D++GR   L+  V+ Y +G +I+  +++   ++ +G     LG+ GI ++  ++ 
Sbjct: 154 LSRLGDMYGRKIGLMSVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLI 213

Query: 185 SDFSNLNWR 193
           S+ S    R
Sbjct: 214 SEVSPKQLR 222

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 116 TVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLT 174
            V  A+G  F  RL DI+GR   L+++ + +I GT+I+  ++    ++ +G     LG  
Sbjct: 131 NVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQYMIGRIVAGLGCG 190

Query: 175 GIILILEVIASDFSNLNWR 193
            I ++  ++ S+ S  N R
Sbjct: 191 LIAILSPMLISEVSPKNMR 209

>TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.395
           YHR094C
          Length = 571

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 73/187 (39%), Gaps = 39/187 (20%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLG 172
           I  V  A+G I  +R+ D++GR   L+  VI Y++G +I+  + +   ++ +G     LG
Sbjct: 122 IFNVGCAIGGIILSRIGDVYGRRVGLITVVIIYVVGILIQICSFDKWYQYFIGRIISGLG 181

Query: 173 LTGI-----ILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIG 227
           + GI     +LI EV   +          L I    F+      G  T +  T W+    
Sbjct: 182 VGGISVLSPMLISEVSPKEMRGAMVSSYQLMITLGIFLGYCCNYGTKTYSDSTQWR---- 237

Query: 228 MWAFILPLACIPLGLC----------MLHM----RYLARKHAKDRLKPEFEALNKLKWKS 273
                     +PLGLC          ML +    RYL      D  +     +NK     
Sbjct: 238 ----------VPLGLCFAWALFMIGGMLFVPESPRYLIEAGKHDEARRSLARVNKCP--- 284

Query: 274 FCIDIAF 280
             ID AF
Sbjct: 285 --IDSAF 289

>Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}
           YML123C (REAL)
          Length = 586

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN--IT 160
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I  I  T++++   +    
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGMELIVMIFCTILQTTVAHSPAI 158

Query: 161 RFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
            F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 79/192 (41%), Gaps = 23/192 (11%)

Query: 20  PEIPEKEAGTTVDVNPTLT-----ISSPAPSYIELIDPGVHNIEIY-AEIYNRPLYRVAL 73
           P I  K         P+ +     + +P+    E  + G +++ I  AE+  +P      
Sbjct: 10  PTIGPKRVNNDFQSQPSESGSHSIMEAPSNKGEEEENKGFNDVNIPPAEMPKKPASEYVT 69

Query: 74  FFSLFLI----AYAYGLD-GNI-----------RYTFQAYATSSYSQHSLLSTVNCIKTV 117
              L L+     Y YG D G I           R+  Q    + Y        +  I  +
Sbjct: 70  VSILCLMIAFGGYVYGWDTGTISGFVSQTDWIRRFGQQRADGTYYLSKVRTGLLLAIFNI 129

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGI 176
             A+G + F+RL DI+GR   LV   I Y++G VI   +++   ++ +G     +G+ GI
Sbjct: 130 GCAIGGLAFSRLGDIYGRRKALVFVTIVYMVGLVISIASIDKWYQYFIGRIISGMGVGGI 189

Query: 177 ILILEVIASDFS 188
            +   ++ S+ S
Sbjct: 190 AVYSPLLISEVS 201

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 119/292 (40%), Gaps = 32/292 (10%)

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           YN  L +  +  SL+L ++   LD  I           ++  +    +     +     Q
Sbjct: 59  YNLSLSKGPILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQ 118

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + RLSDI GR    +I   F+ MG+ + + +  + +FA+      +G  GI  +  + 
Sbjct: 119 PLYGRLSDIIGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIA 178

Query: 184 ASDFSNLNWRLL----ALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIP 239
            SD   +  R +    A        +I   I G +   IG  W+    ++AF +P+  + 
Sbjct: 179 VSDICTVKERGMYQGYANIFYGAGQLIGAPIGGLLIDRIG--WR---ALFAFQVPMVAVA 233

Query: 240 LGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVL 299
           +    L   YL  K A   L P+ E   + KWK         KLDI G + +    G  +
Sbjct: 234 M---FLSFTYLNIKLA--HLPPKEE---RYKWKHLS------KLDIFGSITLVITIGICI 279

Query: 300 VPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIK 351
           V  +   GL         +V   +G +++  L+++ E  Y++H + P   ++
Sbjct: 280 VILS-DNGLNR-------MVLGAMG-LLSFGLFLIIEKYYTKHQILPLKCLQ 322

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 97/231 (41%), Gaps = 17/231 (7%)

Query: 49  LIDPGVHNIEIYAEIYNRPLYRVAL-FFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           L+D G  +   ++E+   P  +V +   +L + ++   LD  I  T      S     S 
Sbjct: 21  LVDTGEESTTSHSEL---PPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDASSQ 77

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQ--AVNITRFAVG 165
           +S +     +  +  Q  + +LSDIFGR  +L++S + + +G  I       N+   + G
Sbjct: 78  MSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLSTG 137

Query: 166 GCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAI---GTNW 222
                +G  G   +  +  SD   L  R +   +  + F +    SG+V  A+   G  W
Sbjct: 138 RFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGC-ASGSVLGAVLQQGIGW 196

Query: 223 KWGIGMWAFI--LPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKW 271
           +     WAF+  +P+A +   +  + +   A    +  L  E +   +LKW
Sbjct: 197 R-----WAFLVQVPMALVCALMIAVVLDLPADSPGRGLLWLELKRGKRLKW 242

>AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR094C
           (HXT1)
          Length = 546

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIIL 178
           AVG IF ++ +D++GR   L+I  + Y++G V++ S      ++ +G     LG+ GI +
Sbjct: 111 AVGGIFLSKFADMYGRRIGLMIVTLVYVIGIVVQISSTDKWYQYCIGRVISGLGVGGIAV 170

Query: 179 ILEVIASDFSNLNWR 193
           +  ++ S+ S  + R
Sbjct: 171 LSPMLISETSPKHLR 185

>KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 68/166 (40%), Gaps = 24/166 (14%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGII 177
            A+G I  ++  D++GR   L+I ++ YI G VI+   +N   ++ +G     LG+ GI 
Sbjct: 120 CAIGGIILSKAGDMYGRKKGLLIVLVIYIAGIVIQIATINKWYQYFIGRIISGLGVGGIS 179

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLAC 237
           ++  ++ S+ S  + R     +     +I   I     +  GT        W        
Sbjct: 180 VLSPMLISEVSPKHLR--GTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWR------- 230

Query: 238 IPLGLCM---LHM-----------RYLARKHAKDRLKPEFEALNKL 269
           +PLGLC    L M           RYL  K+  +  K      NK+
Sbjct: 231 VPLGLCFAWALFMIGGMTFVPESPRYLLEKNLVEEAKHSISISNKV 276

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 62/153 (40%), Gaps = 5/153 (3%)

Query: 41  SPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATS 100
           S  PS+     P     E   + +  P     +  SL+L      +DG I  T      S
Sbjct: 23  STVPSF-----PDTGEEEDLEKDFRDPNTFPYILLSLWLNTSICAVDGTIISTTMNEIAS 77

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNIT 160
            + + S ++ V     +     Q  + + SD+ GR   L+ + + +I+G V+   A  I 
Sbjct: 78  IFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLVMCGAARTIE 137

Query: 161 RFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
              V      +G +G+  +  +I SD + L+ R
Sbjct: 138 ELIVARAICGVGGSGLGAMCNIILSDLAPLSQR 170

>TPHA0L01570 Chr12 complement(333218..334585) [1368 bp, 455 aa] {ON}
           Anc_8.521 YBR207W
          Length = 455

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%)

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNIT 160
           S S+H     ++ I +VI +V  +FF R+  +  +F + + S+I+   G ++E QAVN +
Sbjct: 153 SVSEHYYEGILSIIASVIISVMGLFFLRMGKLREKFRVKLASMIYSEHGNLLERQAVNDS 212

Query: 161 RFAV 164
           +  V
Sbjct: 213 KNVV 216

>NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 65/154 (42%), Gaps = 10/154 (6%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGT 150
           R+  + +  + Y     +  +  I  +  A G I  A+  DI+GR   L+I V  YI+G 
Sbjct: 98  RFGQKHHNGTHYLSKVRMGLMVSIFNIGCAFGGIILAKSGDIYGRKMGLIIVVCIYIVGI 157

Query: 151 VIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTW 209
           VI+  +V    ++ +G     LG+ GI ++  ++ S+ S  + R     +     +I   
Sbjct: 158 VIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHMR--GTLVSCYQLMITAG 215

Query: 210 ISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           I     +  GT        W        +PLGLC
Sbjct: 216 IFLGYCTNYGTKNYSNSVQWR-------VPLGLC 242

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLG 172
           I  +  A+G + F+RL DI+GR   LV   + Y++G +I   +++   ++ +G     +G
Sbjct: 125 IFNIGCAIGGLLFSRLGDIYGRRKALVFVTVVYMVGLIISIASIDKWYQYFIGRIISGMG 184

Query: 173 LTGIILILEVIASDFS 188
           + GI +   ++ S+ S
Sbjct: 185 VGGIAVYSPLLISEVS 200

>Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081W
           (REAL)
          Length = 588

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 107/271 (39%), Gaps = 44/271 (16%)

Query: 29  TTVDVNPTLTISSPAPSYIEL----IDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAY 84
           +T DV+ T  I         L    ++P       Y  IY   L  + + F  FL  +  
Sbjct: 37  STADVHVTPPIEKEGSDEFALNEGPLEPPTRGFLGYLTIY---LLCIPISFGGFLPGWDS 93

Query: 85  GLDG------NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           G+        N +  F +Y  S+   Y  +  +  +  + +V  A+G + FARL+D  GR
Sbjct: 94  GITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLADTLGR 153

Query: 136 FSILVISVIFYIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR- 193
              +VI V+ YI+G +I+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R 
Sbjct: 154 RLAIVIVVLVYIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRG 213

Query: 194 -LLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML------- 245
            L++L+   + F I         S  GT        W        IP+GLC L       
Sbjct: 214 GLISLYQLNMTFGIFL----GYCSVYGTRKYDNTAQWR-------IPIGLCFLWALIIII 262

Query: 246 -------HMRYLARKHAKDRLKPEFEALNKL 269
                    RYL      +  +     +NK+
Sbjct: 263 GMLLVPESPRYLIESEKHEEARTSIAKVNKV 293

>Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON}
           YMR011W (HXT2) - high affinity hexose transporter-2
           [contig 245] FULL
          Length = 570

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 77/202 (38%), Gaps = 38/202 (18%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYI 147
           GN     Q Y  S      ++S  N    +  A+G +   RL D++GR   L+  ++ Y+
Sbjct: 102 GNFDVGEQKYVLSDVRTGLIVSIFN----IGCAIGGLTLGRLGDMYGRRLGLMAVILVYV 157

Query: 148 MGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFII 206
           +G +I+  + N   ++ +G     LG+ GI ++   + S+ +  + R   +    L   +
Sbjct: 158 VGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITL 217

Query: 207 NTWIS-----GNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML--------------HM 247
             ++      G  T +    WK              +PLGLC L                
Sbjct: 218 GIFMGYCTNYGTKTYSNAVQWK--------------LPLGLCFLWAIFMIAGMIFVPESP 263

Query: 248 RYLARKHAKDRLKPEFEALNKL 269
           RYL  K   +  K      NKL
Sbjct: 264 RYLIEKGNFEEAKRSIAKSNKL 285

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 6/103 (5%)

Query: 97  YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTV 151
           + ++S S    LS V       +  V  A+G  F  RL DI+GR   L+++ + +I+G+V
Sbjct: 102 FGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGCFFLGRLGDIYGRRIGLIVASVIFIIGSV 161

Query: 152 IESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           I+  +V    ++ +G     +G   I ++  ++ S+ S  N R
Sbjct: 162 IQIASVKAWYQYMIGRIVAGIGCGLIAILSPMLISEVSPKNMR 204

>KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 20/162 (12%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G +  A+L D  GR   L I V  YI+G VI+  ++N   ++ +G     LG+ GI +
Sbjct: 117 AIGGLVLAKLGDTHGRKLALAIVVSIYIVGIVIQIASINKWYQYFIGRIISGLGVGGISV 176

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGT-------NWKWGIGM--- 228
           +  ++ S+ S    R     + +   +I   I     +  GT        W+  +G+   
Sbjct: 177 LSPMLISEVSPKQLR--GTLVSSYQLMITLGIFLGYCTNFGTKNYDNSVQWRVPLGLSFA 234

Query: 229 WAFIL--PLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNK 268
           WA ++   L+ +P        RYL  K   D  +      NK
Sbjct: 235 WALLMIGGLSFVP-----ESPRYLIEKGRMDEARDSLAQANK 271

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 78/360 (21%), Positives = 140/360 (38%), Gaps = 27/360 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + +ARLS + G    +V  +I +  G++I + A ++     G     +G +G+  +
Sbjct: 93  ALFSLLWARLSAVLGPRISVVSCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTL 152

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     +   R L L +    F + + +   +  A  T+  W    W F + L    
Sbjct: 153 SLVIGCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGG 209

Query: 240 LGLCMLHMRY------LARKHAKDRLK-PEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
           L + +    Y      L  K      K   F  + K   K   +    +  DI+  +  T
Sbjct: 210 LAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVKKSPKK--VLQQLLFGFDILSFISFT 267

Query: 293 AFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKY--------SRHPL 344
           A +   L+  T  GG    W +  +I   +IG V+ + + ++++ K         S  PL
Sbjct: 268 AGWLLFLLALTF-GGQTHAWNSGIVISFIIIG-VLLIAISLVYDFKVFEQIKTQDSFRPL 325

Query: 345 TPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-IVAVHESIKSATRITSLYSFVSV 403
             W+++ +R               + +Q  Y      +V    + K+   +  +   VS 
Sbjct: 326 LSWEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPI--LVST 383

Query: 404 IVGTILGFILIK-VRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAG 462
           +V +I   IL K     KP ++FG +  ++  GL+      S  H   IG L L G   G
Sbjct: 384 VVFSIASGILTKKTGHIKPLLVFGSAMGVLGGGLMTLLDNKSTKHTQ-IGVLILPGVALG 442

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 47/102 (46%)

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           +N  L ++ + FSL++ ++   LDG I           + +      +     +     Q
Sbjct: 44  HNLDLPKLPIVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQ 103

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVG 165
             + +LSDI GR   L+++  F+ +G ++   A N+T F++ 
Sbjct: 104 PLYGKLSDITGRKFALLVAHTFFCLGCLLTCFARNVTEFSIA 145

>NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON}
           Anc_8.858
          Length = 571

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 15/97 (15%)

Query: 106 SLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVI-----ESQAVNIT 160
           +LL     + TVI   GQ+ F  L+D+ GR  I  + +I  I+  ++     ES+A+N  
Sbjct: 90  TLLKVSTSVGTVI---GQLGFGTLADVVGRKKIYGLELIIMIITAILQCTTGESKAINFV 146

Query: 161 RFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
                  FY+    +G+ G   +  +I S+F+   WR
Sbjct: 147 AILT---FYRIVMGIGIGGDYPLSSIITSEFATTKWR 180

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 47/102 (46%)

Query: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           +N  L ++ +  SL+L ++   LDG I           +S+      +     +     Q
Sbjct: 28  HNLSLPKLPILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQ 87

Query: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVG 165
             + +LSD+ GR   L+++  F ++G ++   A N+T FAV 
Sbjct: 88  PLYGKLSDVTGRKFALLMAYFFLVIGCLLTCLARNVTEFAVA 129

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%)

Query: 86  LDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           LDG I  T      S + Q S+++ V     +     Q  + ++SDI GR   L+   I 
Sbjct: 117 LDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIV 176

Query: 146 YIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           + +G  +   + +I + A+      +G +G   +  +I SD + L+ R
Sbjct: 177 FAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSER 224

>Skud_18.5 Chr18 (13411..13461,13465..13500,13504..13575) [159 bp,
           53 aa] {OFF}  YCL073C (HSP)
          Length = 53

 Score = 32.0 bits (71), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 94  FQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVI 144
           F  Y TS+YS+H   S+ +   ++++   QI F+ LSD F R  +  ++ I
Sbjct: 5   FTGYTTSAYSEH---SSQHFNPSILSEFSQITFSSLSDYFRRLELSAVATI 52

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%)

Query: 109 STVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCF 168
           S V+ +  + A  G I     S++ GR + LVIS  FY MG +I + A+N+     G  F
Sbjct: 134 SLVSSLMPLGAVAGSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFF 193

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 137/333 (41%), Gaps = 43/333 (12%)

Query: 127 ARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G    ++ +++ + +G++I + A +++    G     +G  GI  +  VI S 
Sbjct: 123 GRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGST 182

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGNVTSAIGTNWKWG------IGMWAFILPLA 236
               + R + + + +  F    ++  ++ G  TS++   W+W       IG  AF L L 
Sbjct: 183 LVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSV--TWRWCFYVNLPIGGLAFFLFLF 240

Query: 237 CIPLGLC-----MLHMRY-------LARKHAKDRLKPE-FEALNKLKWKSFCIDIAFWKL 283
               GL      M ++R        + R  A   LK + F  LN   W+   +++ F   
Sbjct: 241 FYNPGLSTFQETMDNIRKFPSQFIEIVRNVAYHLLKIKGFSKLNG--WRKPFMELIFM-Y 297

Query: 284 DIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAH----------IIVPEVIGWVVALPLYM 333
           DII  +  +A F C+L+ FT  GG +  W +A           ++V   I   +  P + 
Sbjct: 298 DIIEFVFCSAGFTCILLAFTF-GGNRYAWNSASIIILFIIGIVLVVLAGIYDFLVFPKFN 356

Query: 334 LWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESI-KSAT 392
           + +      PL  W  IK  G              +  Q  Y+     +  ++S  ++A 
Sbjct: 357 IVKATPHYQPLMSWTNIKKPGIFTVNIALFLTCAGYISQFTYIVQYFQLIYNDSAWRAAV 416

Query: 393 RITSLYSFVSVIVGTIL-GFILIKVRRTKPFIL 424
            + +    +S +V  IL G I  K R+ KP I+
Sbjct: 417 HLVA--CIISTVVTAILCGAITDKTRQIKPIIV 447

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 277 DIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWE 336
           ++  +K+D IG  +    FG +L  F         W +A+IIV  ++  VVAL  ++ +E
Sbjct: 240 NVNEYKMDWIGSAI--GVFGLILFNFVWNQAPIAGWGSAYIIVLLIVA-VVALIAFITYE 296

Query: 337 MKYSRHPLTPWDLIKDR 353
           +++++ PL P  ++ +R
Sbjct: 297 IRFAKQPLLPHSVLFNR 313

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 10/127 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A G +   +L DI+GR   L+I ++ Y++GT+I+  A +   ++ +G   Y  G+ G+ +
Sbjct: 129 AFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKIIYGWGVGGVSV 188

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACI 238
           +  ++ S+ +  + R     I     ++   I     +  GT        W        I
Sbjct: 189 LAPMLISETAPKHLR--GTLISCYQLMVTFGIFLGYCAVYGTRKYNSSAQWR-------I 239

Query: 239 PLGLCML 245
           P+GLC L
Sbjct: 240 PVGLCFL 246

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 38/207 (18%), Positives = 89/207 (42%), Gaps = 4/207 (1%)

Query: 58  EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+Y   +N  L +  + +SL++ ++   LD  I           + +      +     +
Sbjct: 28  EMYHR-HNLALPKGPILYSLWMGSFLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLL 86

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGII 177
                Q  + +LSD+ GR + L+++  F+++G +  + + N+  F++      +G  GI 
Sbjct: 87  TNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGIS 146

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPL-- 235
            +  +  SD      R +      + F   + + G +   +  ++ W + ++A  +PL  
Sbjct: 147 ALSSISVSDICTPKERGVYQGYANVVFGTGSMLGGPIGGWLMDSFGWKV-IFAGQVPLIM 205

Query: 236 ACIPLGLCMLHMRYLARKHAKDRLKPE 262
            C+ LG   ++++ L      +R + E
Sbjct: 206 TCMFLGYRNVNIKLLHVPPRHERYRWE 232

>NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}
           Anc_8.858
          Length = 625

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  ++D+ GR  I  + +I  I+ T+++     S  +
Sbjct: 136 STATLLKVSTSVGTVI---GQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGI 192

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I S+FS   WR
Sbjct: 193 N---FVAVLTFYRILMGIGIGGDYPLSSIITSEFSTTKWR 229

>KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I F++L D +GR   LVI  I YI+G VI   +++   ++ +G     LG+ GI +
Sbjct: 127 AIGGIAFSKLGDQYGRRIALVIVTIVYIVGIVISIASIDKWYQYFIGRIIAGLGVGGIAV 186

Query: 179 ILEVIASDFSNLNWR 193
              +  S+ S  + R
Sbjct: 187 YSPLFISEISPKHLR 201

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 67/149 (44%), Gaps = 15/149 (10%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTV--IESQAVNITRFAVGGCFYQLGLTGII 177
           AVG IF +++ DI+GR   ++   + YI+G +  I S      ++ +G     L + G +
Sbjct: 202 AVGGIFLSKIGDIYGRKIGIIFMNVIYIIGQLICITSMKHKWYQYTIGRIISGLAVGGFM 261

Query: 178 LILEVIASDFSNLNWRLLALFIPA--------LPFIINTWISGNVTSA-----IGTNWKW 224
            ++ +  ++ +  + R LA+ +          L +  N  +    T+A     +G  + W
Sbjct: 262 TLIPIFLAETAPKHLRGLAISVGMFMCTLGILLGYCANLGLKDYTTTAQWRIPLGLTFAW 321

Query: 225 GIGMWAFILPLACIPLGLCMLHMRYLARK 253
            I ++A +L     P  LC      LA+K
Sbjct: 322 AILLFAGVLVTPESPRYLCECKKIELAKK 350

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G  F  RL D++GR   ++++ I +I+GTVI+  +V    ++ +G     LG  GII 
Sbjct: 126 AIGCFFLGRLGDMYGRRIAIIVASIIFIVGTVIQIASVKAWYQYMIGRIVAGLG-CGIIA 184

Query: 179 I 179
           I
Sbjct: 185 I 185

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 94/236 (39%), Gaps = 25/236 (10%)

Query: 44  PSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYS 103
           P Y+E       + E+  ++  R ++   +   LF IA    +D +I     +   S + 
Sbjct: 230 PPYVE----NTSSDELVHDLTRRRIFSSCMCTYLFFIA----MDSSIILVIASKIASEFH 281

Query: 104 QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFA 163
           +   LS V     +  A+GQ+ F +LS I     +L I+   +I+G  +   + +   F 
Sbjct: 282 ELWRLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLCIAQFSFILGGYLSWSSAHFWTFI 341

Query: 164 VGGCFYQLGLTGIILILEVIASDFSNLN---WRLLALFIP-ALPFIINTWISGNVTSAIG 219
              C    G   +I +   I + FS  N   + L A  I  A+  +I  ++     S+ G
Sbjct: 342 FARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHG 401

Query: 220 TNWKWGIGMWAFILPLA-CIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSF 274
           + W+      AF++P+  C+     ML   Y  +     R  P         WK F
Sbjct: 402 SGWR-----NAFLIPVPFCLVNASIMLADMYSVKSTLYGRPTPTL-------WKRF 445

>KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.858
           YML123C
          Length = 586

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I  I  TV++     S  +
Sbjct: 96  STATLLKVSTSVGTVI---GQLGFGILADIVGRKKIYGLELIVMIFCTVLQCTLGHSPGI 152

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I S+FS   WR
Sbjct: 153 N---FVAVLTFYRVVMGIGIGGDYPLSSIITSEFSTTKWR 189

>CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123c PHO84
          Length = 580

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I  I  T+++     S  +
Sbjct: 103 STQTLLKVSTSVGTVI---GQLGFGTMADIVGRKKIYGLELIVMIATTILQTTIGRSPGI 159

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 160 N---FPAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 196

>YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}
           PHO84High-affinity inorganic phosphate (Pi) transporter
           and low-affinity manganese transporter; regulated by
           Pho4p and Spt7p; mutation confers resistance to
           arsenate; exit from the ER during maturation requires
           Pho86p; cells overexpressing Pho84p accumulate heavy
           metals but do not develop symptoms of metal toxicity
          Length = 587

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 9/95 (9%)

Query: 105 HSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN--ITRF 162
            +LL     + TVI   GQ  F  L+DI GR  I  + +I  I+ T++++   +     F
Sbjct: 104 QTLLKVSTSVGTVI---GQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINF 160

Query: 163 AVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
                FY+    +G+ G   +  +I S+F+   WR
Sbjct: 161 VAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 104 QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRF 162
           +  L+ ++ CI     A+G I F++L D +GR   LVI  I Y++G +I   +++   ++
Sbjct: 103 RTGLIVSIFCIG---CAIGGIVFSKLGDQYGRRIALVIVTIVYMVGILISIASIDKWYQY 159

Query: 163 AVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
            +G     LG+ GI +   ++ S+ S  + R
Sbjct: 160 FIGRIIAGLGVGGIAVYSPLLISEVSPKHLR 190

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G  F  RL D++GR   ++I+ I +++GT+I+  +V    ++ +G     LG  GII 
Sbjct: 131 AIGCFFLGRLGDMYGRRMAIIIASIIFVVGTIIQIASVKAWYQYMIGRIVAGLG-CGIIA 189

Query: 179 I 179
           I
Sbjct: 190 I 190

>CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {ON}
           highly similar to uniprot|P38695 Saccharomyces
           cerevisiae YHR096c HXT5 or uniprot|P32466 Saccharomyces
           cerevisiae YDR345c HXT3
          Length = 588

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 76/189 (40%), Gaps = 16/189 (8%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGT 150
           R+  Q    + Y  +     +  I  +  A+G I  ++L DI+GR   LV  V+ Y +G 
Sbjct: 116 RFGQQRSDGTYYLSNVRTGLIVAIFNIGCAIGGITLSKLGDIWGRRLGLVTVVVVYTIGI 175

Query: 151 VIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPALPF 204
           VI+  +++   ++ +G     LG+ GI ++  ++ S+ S    R        L I    F
Sbjct: 176 VIQIASIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKQLRGTLVSCYQLMITCGIF 235

Query: 205 IINTWISGNVTSAIGTNWKWGIGM---WAF--ILPLACIPLGLCMLHMRYLARKHAKDRL 259
           +      G    +    W+  +G+   WA   I  + C+P        RYL      +  
Sbjct: 236 LGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIFGVMCVP-----ESPRYLVEVGKLEEA 290

Query: 260 KPEFEALNK 268
           K      NK
Sbjct: 291 KRSLARANK 299

>TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858
           YML123C
          Length = 578

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 19/102 (18%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVI-----ESQAV 157
           S  +LL     + TV    GQ+ F  L+D+ GR  I  + +I  I+ T++     +S AV
Sbjct: 90  STTTLLKVSTSVGTVF---GQVGFGTLADVVGRKKIYGLELIVVIVTTILQCTAGQSPAV 146

Query: 158 NIT------RFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           N        R  +G     +G+ G   +  +I S+FS   WR
Sbjct: 147 NFVAILTTYRIVMG-----IGIGGDYPLSSIITSEFSTTKWR 183

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 55/114 (48%), Gaps = 5/114 (4%)

Query: 85  GLDGNIRYTFQAYATSSYSQHSLLSTVNCIKT----VIAAVGQIFFARLSDIFGRFSILV 140
           G + +  +  +  +T+   +H L      + T    V  ++G  F  RL D++GR   L+
Sbjct: 82  GFESHTDFLRRFGSTNKNGEHYLSKVRTGLLTSMFNVGCSIGSFFLGRLGDMYGRRIGLI 141

Query: 141 ISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           I+   +I+GT+I+  +V    ++ +G     +G   I ++  ++ S+ S  + R
Sbjct: 142 IATTIFIVGTIIQVASVKAWYQYMIGRIVAGVGCGVIAMLSPMLISEVSPKHLR 195

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 86/195 (44%), Gaps = 25/195 (12%)

Query: 12  EEFTED--IVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRP-- 67
           E FT +     + P + A + VD +   T + P   Y++  + G   +   AE+  +P  
Sbjct: 4   ELFTSNSATAAQTPTQGASSVVDSH---TATVPKKFYMDEGNDG--QMADMAELPKKPAS 58

Query: 68  ------LYRVALFFSLFLIAYAYGL--------DGNIRY-TFQAYATSSYSQHSLLSTVN 112
                 L  V + F  FL  +  G+        D   R+ T++      Y  +     + 
Sbjct: 59  AYVTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLV 118

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQL 171
            I +   A+G +  ++L DIFGR   L+  V  Y++GT+I+  A +   ++ +G   Y  
Sbjct: 119 AIFSAGCALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGW 178

Query: 172 GLTGIILILEVIASD 186
           G+ G+ ++  ++ S+
Sbjct: 179 GVGGVSVLAPMLISE 193

>Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072W
           (REAL)
          Length = 487

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 84/201 (41%), Gaps = 31/201 (15%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FARL+D  GR   +VI V+ 
Sbjct: 3   NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLADTLGRRLAIVIVVLV 62

Query: 146 YIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFS--NLNWRLLALFIPAL 202
           YI+G +I+ S      ++ VG   Y LG  G  ++  ++ S+ +  +L   L++L+   +
Sbjct: 63  YIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 122

Query: 203 PFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCML--------------HMR 248
            F I         S  GT        W        IP+GLC L                R
Sbjct: 123 TFGIFL----GYCSVYGTRKYDNTAQWR-------IPIGLCFLWALIIIIGMLLVPESPR 171

Query: 249 YLARKHAKDRLKPEFEALNKL 269
           YL      +  +     +NK+
Sbjct: 172 YLIESEKHEEARTSIAKVNKV 192

>KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 17/186 (9%)

Query: 25  KEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYR-VALFFSLFLIAYA 83
           +E G +V  +  ++  S   S  EL D  V +    A +  +P+   + +  S   +A+ 
Sbjct: 7   QELGHSVSNDSRMSTPSNKVSVDELKDGQVQDQVELAGLPQKPMGDYIGVCISCLCVAFG 66

Query: 84  ---YGLDGNIRYTF-----------QAYATSSYSQHSLLST-VNCIKTVIAAVGQIFFAR 128
              +G D      F           Q +A+ SY   ++    +  I  +  A G I  ++
Sbjct: 67  GFIFGWDTGTISGFVAQTDFLERFGQKHASGSYYLSNVREGLIVGIFNIGCAFGGIILSK 126

Query: 129 LSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDF 187
           L D++GR   L    I YI+G VI   +V+   ++ +G     LG+ GI ++  ++ S+ 
Sbjct: 127 LGDMYGRKIGLTCVTIIYIVGQVICIASVDKWYQYFIGRIVAGLGVGGIAVLSPMLISET 186

Query: 188 SNLNWR 193
           S  + R
Sbjct: 187 SPKHLR 192

>Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON}
           (55476..57182) [1707 nt, 569 aa]
          Length = 568

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I  I  T+++     S AV
Sbjct: 103 STQTLLKVSTSVGTVI---GQVGFGIIADIVGRKKIYGLELIIVITATILQCTTGHSPAV 159

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I ++F+   WR
Sbjct: 160 N---FPAILTFYRIVMGIGIGGDYPLSSIITAEFATTKWR 196

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 96/232 (41%), Gaps = 35/232 (15%)

Query: 30  TVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVA-LFFSLFLIAYAYGLDG 88
           T ++ P L   SP P   +L D   H+  +       PL  V  + F+LF+ +Y   LD 
Sbjct: 2   TDELQPLL---SPVP---QLPDQAAHDKNV------EPLRDVNWIVFALFVGSYLAALDT 49

Query: 89  NIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIM 148
            I  T      S     + +S +     +  +  Q  + +LSD+FGR  +L+ S + +  
Sbjct: 50  TIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGF 109

Query: 149 GTVIESQAVN-------ITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPA 201
           G ++             I RF  G     +G  G+  +  +  SD   L  R +   +  
Sbjct: 110 GCILCGAPFTKSLWMLCIGRFIAG-----VGGGGLNSLSTITTSDIIPLRQRGVYQGMGN 164

Query: 202 LPFIINTWISGNVTSAIGTNWKWGIG-MWAFILPLACIPLGL--CMLHMRYL 250
           + F +    SG   S IG   +  IG  WAF   L  +PL L  C L M++L
Sbjct: 165 IVFALGC-ASG---SLIGAFLQQRIGWRWAF---LCQVPLSLLSCSLIMKFL 209

>Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W
           (REAL)
          Length = 265

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 78/184 (42%), Gaps = 17/184 (9%)

Query: 27  AGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYR--------VALFFSLF 78
           A T V V    T  S +PS  E +       E+  +I N+P+          + + F  F
Sbjct: 2   ASTNVSVLEASTKISTSPSGKEEVKRTPEVREVSPDIPNKPIIAYWTVMGLCLMIAFGGF 61

Query: 79  LIAYAYG-LDGNIRYT--FQAYATSSYSQHSLLSTVNC-----IKTVIAAVGQIFFARLS 130
           +  +  G + G I  T   + +          LS V       I  +  AVG +   RL 
Sbjct: 62  IFGWDTGTISGFINQTDFKRRFGEEQRDGSYQLSDVRTGLIVGIFNIGCAVGGLTLGRLG 121

Query: 131 DIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           DI GR   L+  ++ YI+G +I+  +++   ++ +G     +G+ G+ ++   + S+ S 
Sbjct: 122 DICGRRIGLMCVILVYIVGIIIQIASIDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISP 181

Query: 190 LNWR 193
            + R
Sbjct: 182 KHLR 185

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 1/104 (0%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGT 150
           R+  +    S Y     +  +  I  +  A+G +F  RL D  GR   +V++V  Y++G 
Sbjct: 79  RFGSKHRDGSHYLSKVRIGLLVSIFNIGCAIGSVFLGRLGDTIGRRKGIVVAVSIYMVGI 138

Query: 151 VIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           VI+  +V    ++ +G     LG   I ++  ++ S+ S  + R
Sbjct: 139 VIQIASVKKWFQYLIGRIISGLGAGCIAVLSPMLISEVSPKHLR 182

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 97  YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTV 151
           + ++S S    LS V       +  +  A+G  F  RL D++GR   ++++ I +++GTV
Sbjct: 32  FGSTSGSGKRYLSKVRTGLLTSMFNIGQAIGCFFLGRLGDMYGRRIAIIVASIIFVVGTV 91

Query: 152 IESQAVN 158
           I+  +V 
Sbjct: 92  IQIASVK 98

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 58/282 (20%), Positives = 117/282 (41%), Gaps = 11/282 (3%)

Query: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S++L  +   LD  I  T  A   S +++   +S +     + +A  Q  + ++SDIFGR
Sbjct: 100 SMYLGIFLSALDNTIVSTLLARIGSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGR 159

Query: 136 FSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLL 195
             +L    + + +G +I   A +     +G     +G  GI  +  +  SD   L  R L
Sbjct: 160 KIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGITSMSTITVSDIIPLRNRAL 219

Query: 196 ALFIPALPFIINTWISGNV----TSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLA 251
              +    + +   + G +    T  +G+ W+   G + F +PL+ I     M+ ++ L 
Sbjct: 220 YQGVCNFYYGLGIALGGIIGGWFTEKLGS-WR---GAFLFQVPLSVISTVTVMVWLQ-LP 274

Query: 252 RKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEE 311
           +      L+      +        I      +D  G + +  F    ++  + AGG    
Sbjct: 275 KDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLLSFMI-LSSAGGSDIS 333

Query: 312 WRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDR 353
            ++   +   +I  V +   ++  E+K+++ P+ P   +KDR
Sbjct: 334 VKSNTFLYLTLIS-VTSFISFIYIELKFAKDPILPLVFLKDR 374

>TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 69/159 (43%), Gaps = 24/159 (15%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGT 150
           R+T   Y  S      ++S  N    V  A+G I  ++L DI+GR   L+  V+ YI+G 
Sbjct: 103 RHTDGTYYLSKVRTGLVVSIFN----VGCAMGGIILSKLGDIYGRKIGLMTVVVIYIVGI 158

Query: 151 VIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPALPF 204
           +I+  + +   ++ +G     LG+ GI ++  ++ S+ S  + R        L I A  F
Sbjct: 159 LIQICSFDKWYQYFIGRIISGLGVGGIAVLSPMLISESSPKHLRGPLVSSYQLMITAGIF 218

Query: 205 IINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           +      G    +  T W+              +PLGLC
Sbjct: 219 LGYCTNYGTRNYSDSTQWR--------------VPLGLC 243

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%)

Query: 90  IRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMG 149
           IR+  +    + Y        +  I  V  A+G +   RL D++GR   L+I+ I +I+G
Sbjct: 100 IRFGTRRADGTYYLSKVRTGLIVSIFNVGCAIGCVALGRLGDMYGRRMGLIIASIIFIVG 159

Query: 150 TVIESQAV 157
            VIE  +V
Sbjct: 160 NVIEIASV 167

>Kpol_365.10 s365 complement(21800..23701) [1902 bp, 633 aa] {ON}
           complement(21800..23701) [1902 nt, 634 aa]
          Length = 633

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G +  ++  +++GR   L I V+ YI G VI+  ++N   ++ +G     LG+ GI +
Sbjct: 190 AIGGVILSKTGEMYGRKIGLTIVVVIYIAGIVIQIASINKWYQYFIGRIISGLGVGGIAV 249

Query: 179 ILEVIASDFSNLNWR 193
           +  ++ S+ S    R
Sbjct: 250 LSPLLISEVSPKQLR 264

>Kwal_33.14268 s33 complement(593529..595238) [1710 bp, 569 aa] {ON}
           YML123C (PHO84) - 1:1 [contig 104] FULL
          Length = 569

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 35/173 (20%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE---SQAVNI 159
           S  +LL     + TVI   GQ+ F  ++D+ GR  I  + +I  IM TV++    +A  +
Sbjct: 95  STSTLLKVSTSVGTVI---GQVGFGVMADVVGRKKIYGLELIIMIMATVLQCTIGKAPGV 151

Query: 160 TRFAVGGCFYQLGLTGIIL----ILEVIASDFSNLNWR--------------LLALFIPA 201
           +  AV   FY++ +   I     +  +I S+FS   WR               +A  I A
Sbjct: 152 SFVAV-LTFYRIIMGIGIGGDYPLSSIITSEFSTTKWRGAMMGAVFANQAFGQIAAGIVA 210

Query: 202 LPFIIN------TWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMR 248
           L  ++          +GN   A     K    MW  ++ L C+P G+  L+ R
Sbjct: 211 LVLVVAYKSDLIDATNGNCGPACA---KACDQMWRILVGLGCVP-GVFALYFR 259

>CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011w HXT2 high-affinity hexose transporter or
           uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10 or
           uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 87  DGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFY 146
           D   R+  QA   S Y        +  I  +  A+G +   RL D++GR   L+  +  Y
Sbjct: 91  DFKRRFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVY 150

Query: 147 IMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
           ++G VI+ S      ++ VG     LG+ GI ++   + S+
Sbjct: 151 VVGIVIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISE 191

>CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011w HXT2 high-affinity hexose transporter
           or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
           or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 87  DGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFY 146
           D   R+  QA   S Y        +  I  +  A+G +   RL D++GR   L+  +  Y
Sbjct: 91  DFKRRFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVY 150

Query: 147 IMGTVIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
           ++G VI+ S      ++ VG     LG+ GI ++   + S+
Sbjct: 151 VVGIVIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISE 191

>NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYI 147
           G++      Y  S      L+S VN    +  A+G I  ++  D++GR   L I  + Y+
Sbjct: 130 GHLDTAVNTYVLSRVRLGLLVSIVN----IGCAIGGIVLSKAGDVYGRRKGLTIVTMVYM 185

Query: 148 MGTVIESQAVN 158
           +G +I+  AVN
Sbjct: 186 VGIIIQISAVN 196

>Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W
           (REAL)
          Length = 289

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 75/184 (40%), Gaps = 17/184 (9%)

Query: 27  AGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLI----AY 82
           A T V V    T  S +PS  E +       E+  +I N+P+        L L+     +
Sbjct: 2   ASTNVSVLEASTKISTSPSGKEEVKRTPEVREVSPDIPNKPIIAYWTVMGLCLMIAFGGF 61

Query: 83  AYGLDGNIRYTF-------QAYATSSYSQHSLLSTVNC-----IKTVIAAVGQIFFARLS 130
            +G D      F       + +          LS V       I  +  AVG +   RL 
Sbjct: 62  IFGWDTGTISGFINQTDFKRRFGEEQRDGSYQLSDVRTGLIVGIFNIGCAVGGLTLGRLG 121

Query: 131 DIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           DI GR   L+  ++ YI+G +I+  +++   ++ +G     +G+ G+ ++   + S+ S 
Sbjct: 122 DICGRRIGLMCVILVYIVGIIIQIASIDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISP 181

Query: 190 LNWR 193
            + R
Sbjct: 182 KHLR 185

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 282 KLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSR 341
           K+D IG LL     G +L+ F         W  A+IIV  ++  V  L  + ++E+K + 
Sbjct: 269 KMDWIGSLL--GVIGLILMNFVWNQAPISGWSKAYIIVILIVA-VFFLVAFFIYELKKAE 325

Query: 342 HPLTPWDLIKDR 353
            PL P ++ K+R
Sbjct: 326 SPLLPPEVTKNR 337

>AFR442C Chr6 complement(1234193..1235884) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML123C
           (PHO84)
          Length = 563

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 62/146 (42%), Gaps = 36/146 (24%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-----SQAV 157
           S +SLL     + TVI   GQ+ F  L+D+ GR  I  + +I  I+ TV++     S A+
Sbjct: 96  STNSLLKVSTSVGTVI---GQVGFGTLADVVGRKRIYGLELILMILATVLQCMIGKSPAI 152

Query: 158 NITRFAVGGCFYQLGLTGIIL----ILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           +   F     FY++ +   I     +  +I S+FS   WR                  G 
Sbjct: 153 D---FVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR------------------GA 191

Query: 214 VTSAIGTNWKWGI---GMWAFILPLA 236
           +  A+  N  WG    G+ A IL  A
Sbjct: 192 IMGAVFANQAWGQITGGILALILVAA 217

>Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 187] FULL
          Length = 567

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 85/194 (43%), Gaps = 25/194 (12%)

Query: 12  EEFTED--IVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRP-- 67
           E FT +     + P + A + VD +   T + P   Y++  + G   +   AE+  +P  
Sbjct: 4   ELFTSNSATAAQTPTQGASSVVDSH---TATVPKKFYMDEGNDG--QMADMAELPKKPAS 58

Query: 68  ------LYRVALFFSLFLIAYAYGL--------DGNIRY-TFQAYATSSYSQHSLLSTVN 112
                 L  V + F  FL  +  G+        D   R+ T++      Y  +     + 
Sbjct: 59  AYVTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLV 118

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQL 171
            I +   A+G +  ++L DIFGR   L+  V  Y++GT+I+  A +   ++ +G   Y  
Sbjct: 119 AIFSAGCALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGW 178

Query: 172 GLTGIILILEVIAS 185
           G+ G+ ++  ++ S
Sbjct: 179 GVGGVSVLAPMLIS 192

>NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 18/168 (10%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLG 172
           I  V  A+G +   RL D  GR   +VI+V  YI+G VI+  +++   ++ +G     LG
Sbjct: 113 IFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLG 172

Query: 173 LTGIILILEVIASDFSNLNWR--------LLALFIPALPFIINTWISGNVTSAIGTNWKW 224
              I ++  ++ S+ S  + R        L+  F   L +  N    G  T      W+ 
Sbjct: 173 SGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNY---GTKTYDNSIQWRV 229

Query: 225 GIGM---WAFILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKL 269
            +G+   WA ++  A   + +     RYL  K   +  K      NK+
Sbjct: 230 PLGLCFAWALVMIGA---MFIVPESPRYLVEKGQIEEAKRSVAKSNKV 274

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 46/101 (45%)

Query: 65  NRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQI 124
           N  L +  +  SL+L ++   LDG +         + +++      +     +     Q 
Sbjct: 36  NMALPKGPILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQP 95

Query: 125 FFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVG 165
            + +LSDI GR   ++ +  F+ +G ++   A N+T+F++ 
Sbjct: 96  LYGKLSDITGRKVAVITAHFFFALGCLLTCFAQNVTQFSIA 136

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 76/195 (38%), Gaps = 21/195 (10%)

Query: 95  QAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMG 149
           Q + T +      LST+       I  +  A+G +F  +L D++GR   L+     +++G
Sbjct: 105 QRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLYGRRWGLIFGTSIFVVG 164

Query: 150 TVIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
            +I+  +V+      I R   G     + +   +LI EV   +          L I    
Sbjct: 165 VIIQIASVSKWFQYFIGRIIAGIGMGVIAVLSPMLISEVAPKELRGAMVSCYQLMITFGI 224

Query: 204 FIINTWISGNVTSAIGTNWKWGIG---MWAFIL--PLACIPLGLCMLHMRYLARKHAKDR 258
           F+ N    G  +      W+  +G   +W  I+   +  +P        RYL +++  + 
Sbjct: 225 FLGNCCNYGTKSYQNSKQWRIAVGLQFLWCIIMVSGMTFVP-----ESPRYLVQQNMFEE 279

Query: 259 LKPEFEALNKLKWKS 273
            K      NKL  +S
Sbjct: 280 AKESIAISNKLSKES 294

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 69/166 (41%), Gaps = 5/166 (3%)

Query: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           +++ +R ++ ++   S+FL  +   LD  I  T   +  S  +    +S V        A
Sbjct: 73  SDLMSRRIFMISA--SMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVATSYVFSCA 130

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           + Q  F + SD+FGR  +L+ S + +  G +    +  I    +G     +G  G+  + 
Sbjct: 131 IFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIGGGGLTSMC 190

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVT---SAIGTNWK 223
            +I +D   L  R +      L + + T   G V    S  G  W+
Sbjct: 191 TIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWR 236

>TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858
           YML123C
          Length = 581

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI--T 160
           S ++LL     + TVI   GQ+ F  ++DI GR  I  + +I  I  T+++  A +    
Sbjct: 99  SSNTLLKVSTSVGTVI---GQLGFGMMADIIGRKKIYGVELIIMIAATILQCTAGHAPGV 155

Query: 161 RFAVGGCFYQLGLTGIIL----ILEVIASDFSNLNWR 193
            F     FY++ +   I     +  +I S+FS   WR
Sbjct: 156 NFVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR 192

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 6/134 (4%)

Query: 296 GCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           G +L  F    G  + W   +II   ++  V  L  + ++E+K+++ PL P ++IK+R  
Sbjct: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFIL-I 414
                        + +   Y Y   +   H S   A        F+ VI GTI  F++ +
Sbjct: 341 GMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF----FMFVIWGTIAAFLVAL 396

Query: 415 KVRRTKPFILFGIS 428
            ++R  P +L   S
Sbjct: 397 TIKRVGPSVLLCFS 410

>KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P54862 Saccharomyces cerevisiae
           YOL156W HXT11 Putative hexose transporter that is nearly
           identical to Hxt9p, has similarity to major facilitator
           superfamily (MFS) transporters and is involved in
           pleiotropic drug resistance
          Length = 566

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 60/123 (48%), Gaps = 9/123 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIIL 178
           A+G I  +++ D++GR   L+   I Y++G +I+ S      ++ +G     LG+ GI +
Sbjct: 124 AIGGIVLSKIGDVYGRRIGLISVTIVYVIGIIIQISSTDKWYQYFIGRIISGLGVGGIAV 183

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWIS-----GNVTSAIGTNWKWGIGM---WA 230
           +  ++ S+ S  + R + + +  L   +  ++      G       T W+ G+G+   WA
Sbjct: 184 LSPMLLSEVSPKHIRGMLVNLYQLLGTMGIFLGYCTNYGTKKYTDSTQWRVGLGLCFAWA 243

Query: 231 FIL 233
            ++
Sbjct: 244 MLM 246

>Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}
           similar to Ashbya gossypii AFL207C/AFL205C/AFL204C
          Length = 546

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 66/153 (43%), Gaps = 11/153 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIIL 178
           A+G I  ++L D++GR   L+   + Y++G VI+ S      ++ +G     LG+ GI +
Sbjct: 106 AIGGIVLSKLGDMYGRRIGLMCVTLVYVVGIVIQISSTDKWYQYFIGRIVSGLGVGGIAV 165

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACI 238
           +  ++ S+ S  + R     +     +I   I     +  GT        W        +
Sbjct: 166 LSPMLISETSPKHLR--GTLVSCYQLMITAGIFLGYCTNYGTKKHSDAVQWR-------V 216

Query: 239 PLGLCMLHMRYLARKHAKDRLKPEF-EALNKLK 270
           PLGLC +   ++    A     P +   +NK++
Sbjct: 217 PLGLCFVWAAFMVAGMAMVPESPRYLVEVNKIE 249

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 74/168 (44%), Gaps = 18/168 (10%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLG 172
           I  V  A+G +F  RL D  GR   +V+    YI+G VI+  +++   ++ +G     LG
Sbjct: 115 IFNVGCAIGSVFLGRLGDSIGRRKGIVVGASIYIVGIVIQIASIDKWFQYFIGRIIGGLG 174

Query: 173 LTGIILILEVIASDFSNLNWR--------LLALFIPALPFIINTWISGNVTSAIGTNWKW 224
              I ++  ++ S+ S  + R        L+  F   L +  N + + N  +++   W+ 
Sbjct: 175 SGAIAVLSPMLISEVSPKHLRGTLVSCYQLMVTFGIFLGYCTN-YGTKNYNNSV--QWRV 231

Query: 225 GIGM---WAFILPLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKL 269
            +G+   WA ++  A   + L     RYL  K   +  K      NK+
Sbjct: 232 PLGLCFAWALVMIGA---MFLVPESPRYLVEKGLIEEAKRSVAKSNKV 276

>Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}
           similar to Ashbya gossypii AFL207CAFL205C
          Length = 535

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 66/153 (43%), Gaps = 11/153 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE-SQAVNITRFAVGGCFYQLGLTGIIL 178
           A+G I  ++L D++GR   L+   + Y++G VI+ S      ++ +G     LG+ GI +
Sbjct: 113 AIGGIVLSKLGDMYGRRIGLMCVTLVYVVGIVIQISSTDKWYQYFIGRIVSGLGVGGIAV 172

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACI 238
           +  ++ S+ S  + R     +     +I   I     +  GT        W        +
Sbjct: 173 LSPMLISETSPKHLR--GTLVSCYQLMITAGIFLGYCTNYGTKKHSDAVQWR-------V 223

Query: 239 PLGLCMLHMRYLARKHAKDRLKPEF-EALNKLK 270
           PLGLC +   ++    A     P +   +NK++
Sbjct: 224 PLGLCFVWAAFMVAGMAMVPESPRYLVEVNKIE 256

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 3/30 (10%)

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWI 431
            VIVGT++GF++  + R     LFG+SCWI
Sbjct: 94  GVIVGTVMGFLVGTIYRAG---LFGMSCWI 120

>TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 65/160 (40%), Gaps = 10/160 (6%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN------ITRFAVGGCFYQLG 172
            A+G +   RL DI+GR   L+++   +++G VIE  +++      I R   G     + 
Sbjct: 129 CAIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIA 188

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFI 232
           +   +LI EV   +          + I    F+ +    G+   +    W+ G+G+  F 
Sbjct: 189 ILSPMLISEVSPKEVRGGMVSCFQMMITLGIFLGDCTEYGSKEYSNSAQWRVGLGL-QFA 247

Query: 233 LPLACIPLGLCMLHMR--YLARKHAKDRLKPEFEALNKLK 270
             L C+  G+  +     YL  K   +  K      NKL 
Sbjct: 248 WSL-CMVAGMLFVPESPIYLVEKGKIEEAKRSVAISNKLN 286

>NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 100 SSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI 159
           S Y  +  +  +  I  V AA+G +  AR  D++GR   L+  V  Y +G VI+  +++ 
Sbjct: 125 SHYLSNVRMGLLVSIFNVGAAIGGVMLARTGDMWGRRLGLITVVSIYTVGIVIQIASIDK 184

Query: 160 -TRFAVGGCFYQLGLTGIILILEVIASD 186
             ++ +G     LG+ GI ++  ++ S+
Sbjct: 185 WFQYFIGRIISGLGVGGIAVLAPMLISE 212

>ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 589

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 66/166 (39%), Gaps = 22/166 (13%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN------ITRFAVGGCFYQLGL 173
           A G +   + +D++GR   + I+ +FY++GTVI   +++      I R   G     L +
Sbjct: 147 AFGGLILTKPADVYGRKLAVTIAAVFYVVGTVISIASIDKWYQYMIGRIISGLGVGSLAV 206

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGM---WA 230
              +LI EV           +  L + A  F+      G  T      W+  +G+   WA
Sbjct: 207 LSPMLISEVAPKQLRGTLVSIYQLMVTAGIFLGYCANYGTKTYDNSVQWRVPLGLNFAWA 266

Query: 231 FIL----------PLACIPLGLCMLHMRYLARKHAKDRLKPEFEAL 266
            ++          P   + +G      R L+R    +++ PE   L
Sbjct: 267 ILMVAGMTFVPESPRYLVQIGKVQEAKRSLSR---SNKVSPEDPGL 309

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 49/109 (44%)

Query: 85  GLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVI 144
            LDG I  T      S + Q S+++ V     +     Q  + ++SDI GR   L+   +
Sbjct: 74  ALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEV 133

Query: 145 FYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
            + +G ++ + A  I + A+      +G +G   +  ++ +D   L+ R
Sbjct: 134 IFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSVR 182

>TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {ON}
           Anc_5.396 YHR096C
          Length = 570

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGII 177
            A+G I  +++ D++GR   L   V+ YI+G VI+  +++   ++ +G     LG+ GI 
Sbjct: 125 CAIGGIVLSKVGDVYGRKMGLTTVVLIYIVGIVIQIASIDKWYQYFIGRIISGLGVGGIA 184

Query: 178 LILEVIASDFS 188
           +   ++ S+ S
Sbjct: 185 VFSPMLISEVS 195

>TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa]
           {ON} 
          Length = 575

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 56/121 (46%), Gaps = 6/121 (4%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLG 172
           I  V  A+G +   R+ D++GR   L+++ + ++ G VI+  + +   ++ +G     +G
Sbjct: 126 IFNVGCAIGSVTLGRVGDVYGRRLGLIMATVIFVAGVVIQIASTDKWYQYFIGRIIAGIG 185

Query: 173 LTGIILILEVIASDFSNLNWR-----LLALFIPALPFIINTWISGNVTSAIGTNWKWGIG 227
           +  I ++  ++ S+ S  + R        L I    F+ N    G  T      W+ G+G
Sbjct: 186 MGVIAVLSPMLISEVSPKHLRGAMVSCFQLMITFGIFLGNCCNYGTKTYDNSIQWRVGLG 245

Query: 228 M 228
           M
Sbjct: 246 M 246

>TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 632

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/95 (18%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 103 SQHSLLSTVNCIKTVIAAVG----QIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVN 158
            Q+++++ V  +   +  +G     + +A LS+++GR  +LV+S + + +  +  + A N
Sbjct: 221 EQYNIITVVEILGVTLYVLGFAAVPVLYAPLSELYGRKGVLVLSGLRFCLIQIAVATAEN 280

Query: 159 ITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           +    +   F +L  +  ++++  + +D  + N+R
Sbjct: 281 LQTIMICRVFNELICSAPMVVVPAVFADMFDTNFR 315

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 75/165 (45%), Gaps = 14/165 (8%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILI 179
            +G +FFA LS+ FGR  + +I+++  ++  V    A NI           L  +  + +
Sbjct: 171 GIGPMFFAPLSEEFGRNPVYLITLLIAVVFIVPCGAAKNIGTLLAFRFLDGLAFSAPMCL 230

Query: 180 LEVIASDFSNLNWRLLAL-FIPALPFI--INTWISGNVTSAIGTNWKWGIGMWAFILPLA 236
           +    SD      R +A+    A PF+  +   I G++ S +  +W+W    W  ++   
Sbjct: 231 IGGSLSDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSLLS-VYCSWRWVY--WFMVILSG 287

Query: 237 CIPLGLCML----HMRYLARKHAKDRLK----PEFEALNKLKWKS 273
           C+   + +     H + L +K AK   +    P + AL+++K +S
Sbjct: 288 CLYAVMAVFMPETHHQTLLKKRAKKLREITGDPSYRALSEIKVRS 332

>TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 50/92 (54%), Gaps = 9/92 (9%)

Query: 97  YATSSYSQHSLLSTVNC-IKTVIAAVGQ----IFFARLSDIFG-RFSILVISVIFYIMGT 150
           + ++S S    LS V   + T +  VGQ     F  R+ D++G RF I+V S+IF I+GT
Sbjct: 32  FGSTSGSGKRYLSKVRTGLLTSMFNVGQAIDCFFLGRIGDMYGRRFGIIVASIIF-IVGT 90

Query: 151 VIESQAVNI-TRFAVGGCFYQLGLTGIILILE 181
           VI+  +V    ++ +G     LG  G+I IL 
Sbjct: 91  VIQIVSVKAWYQYMIGRIVAGLG-CGLIAILS 121

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 82/187 (43%), Gaps = 23/187 (12%)

Query: 58  EIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+  ++  + ++   +   LF IA    +D +I     +   S + +   LS V  +  +
Sbjct: 246 ELVHDLTRKRIFSSCMCTYLFFIA----MDSSIILVIASKIASEFHELWRLSLVISVYLL 301

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGII 177
             A+GQ+ F +LS + G   +L ++   +I+G+ +   +++   F +       G   +I
Sbjct: 302 GNAIGQLMFLKLSLVSGVKLLLCVAQFSFILGSYLSWSSIHFWTFILARSVTGFGSGSLI 361

Query: 178 LILEVIASDFSNLNWR---------LLALFIPALPFIINTWISGNVTSAIGTNWKWGIGM 228
            +   I + FS  N           + +L +   PF+++ + S +     G+ WK     
Sbjct: 362 ALKSTIMNRFSQKNENQYPLSTSMTVFSLGVAVGPFLVSFFDSSH-----GSGWK----- 411

Query: 229 WAFILPL 235
            AF++P+
Sbjct: 412 NAFLIPV 418

>Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094C
           (REAL)
          Length = 547

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G +   RL DI+GR   L+  V+ YI+G VI+  + N   ++ +G     +G+ GI +
Sbjct: 118 AIGGLTLGRLGDIYGRRIGLMCVVLVYIVGIVIQIASSNKWYQYFIGRIISGMGVGGIAV 177

Query: 179 ILEVIASD 186
           +   + S+
Sbjct: 178 LSPTLISE 185

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (67%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIE 153
           A+G  F  RL D++GR   L+++ + +I+G +I+
Sbjct: 128 AIGCFFLGRLGDMYGRRIGLIVAAVIFIVGNIIQ 161

>AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YHR096C (HXT5) and YDR342C (HXT7)
          Length = 535

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           AVG IF +++ D +GR   L      Y++G VI+  A +   ++ VG     LG+ GI +
Sbjct: 109 AVGGIFLSKIGDAYGRKIGLATVTAVYVIGIVIQISASDKWYQYFVGRIISGLGVGGIAV 168

Query: 179 ILEVIASDFSNLNWR 193
           +  ++ S+ S  + R
Sbjct: 169 LSPMLISETSPKHLR 183

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNIT 160
           +Y    +++    +  +I+AV        +DI+GR   L+IS +F+++G V++  A    
Sbjct: 108 TYGDKEIITAATSLGALISAVAA---GTCADIWGRKPCLMISNLFFVIGAVLQVSASTFW 164

Query: 161 RFAVG 165
           + AVG
Sbjct: 165 QMAVG 169

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 57/135 (42%), Gaps = 6/135 (4%)

Query: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350
           + A  G +L  F         W TA+II   +I  V  L  + ++E+KY++ PL P  + 
Sbjct: 272 VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKVPLLPHAVT 330

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410
           K+R               W   G + +  +   ++    S       Y FV VI GTI  
Sbjct: 331 KNR---HMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-FVFVIFGTIAA 386

Query: 411 FIL-IKVRRTKPFIL 424
           F++ + ++R  P  L
Sbjct: 387 FMVALSIKRVGPAFL 401

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 293 AFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTP 346
              G +L  F    G    W TA+IIV  ++  V A+  + L+E KY+  PL P
Sbjct: 257 GLLGMILFNFVWNQGPIVGWDTAYIIVLLIVS-VAAIVAFFLYETKYANDPLIP 309

>YLR081W Chr12 (290212..291936) [1725 bp, 574 aa] {ON}
           GAL2Galactose permease, required for utilization of
           galactose; also able to transport glucose
          Length = 574

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 66/159 (41%), Gaps = 20/159 (12%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGT 150
           R+  +    + Y  +     +  I  +  A G I  ++  D++GR   L I V  YI+G 
Sbjct: 104 RFGMKHKDGTHYLSNVRTGLIVAIFNIGCAFGGIILSKGGDMYGRKKGLSIVVSVYIVGI 163

Query: 151 VIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPALPF 204
           +I+  ++N   ++ +G     LG+ GI ++  ++ S+ +  + R        L I A  F
Sbjct: 164 IIQIASINKWYQYFIGRIISGLGVGGIAVLCPMLISEIAPKHLRGTLVSCYQLMITAGIF 223

Query: 205 IINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           +      G  + +    W+              +PLGLC
Sbjct: 224 LGYCTNYGTKSYSNSVQWR--------------VPLGLC 248

>KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly
           similar to uniprot|P32466 Saccharomyces cerevisiae
           YDR345C HXT3 Low affinity glucose transporter of the
           major facilitator superfamily expression is induced in
           low or high glucose conditions
          Length = 567

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 10/125 (8%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I   +L +++GR   L I VI Y +G +I+  +++   ++ +G     LG+  I +
Sbjct: 125 AIGGIVLGKLGEVYGRRLGLTIVVIIYSVGIIIQIASIDKWYQYFIGRIISGLGVGAITI 184

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACI 238
           +  ++ S+ S  + R     +    F++   I     +  GT        W        +
Sbjct: 185 LSPMLISEVSPKHLR--GTLVSCYQFMVTGGIFLGYCTNYGTKRYSNSVQWR-------V 235

Query: 239 PLGLC 243
           PLGLC
Sbjct: 236 PLGLC 240

>Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081W
           (REAL)
          Length = 573

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A G I  ++  D++GR   L I V  YI+G +I+  ++N   ++ +G     LG+ GI +
Sbjct: 133 AFGGIILSKAGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISGLGVGGIAV 192

Query: 179 ILEVIASDFSNLNWR 193
           +  ++ S+ +  + R
Sbjct: 193 LSPMLISEIAPKHLR 207

>TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.394
           YHR092C
          Length = 567

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 69/162 (42%), Gaps = 16/162 (9%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I  +++ DI+GR   LV   + Y++G +I+  + +   ++ +G     LG+ GI +
Sbjct: 123 AIGGIILSKIGDIYGRRIGLVAVTVIYVVGILIQICSFDKWYQYFIGRIISGLGVGGIAV 182

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWIS-----GNVTSAIGTNWKWGIGM---WA 230
           +  ++ S+ S    R   +    L   +  ++      G  T    T W+ G+G+   WA
Sbjct: 183 LSPMLISEVSPKQIRGTLVACYQLMITLGIFLGYCTNYGTKTYNDSTQWRVGLGLCFAWA 242

Query: 231 FIL--PLACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLK 270
             +   +  +P        RYL      +  K      NKL 
Sbjct: 243 IFMIGGMLFVP-----ESPRYLVEHGNIEEAKRSLSRSNKLS 279

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 71/165 (43%), Gaps = 22/165 (13%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIIL 178
           A +  IF    +DIFGR   +++S + +++G +I+  A    +  VG      G+    L
Sbjct: 172 ALISSIFAGISADIFGRKPCILLSNLMFLIGAIIQVTAHTFWQMVVGRFIMGFGVGIGSL 231

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGM------WAFI 232
           I  +  S+ +  N R     I +L      W++G    A G     G G+      W  +
Sbjct: 232 IAPLYISEIAPKNIRGRLTVINSL------WLTGGQLIAYGC----GAGLSHVNNGWRIL 281

Query: 233 LPLACIPLGL---CMLHMRYLARKHAKDRLKPEFEALNKLKWKSF 274
           + L+ IP  +   C L +    R +    +K + E  NK+  KS+
Sbjct: 282 VGLSLIPTVIQFSCFLFLPDTPRFYV---MKGQLEKANKVLHKSY 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,054,048
Number of extensions: 2464562
Number of successful extensions: 8545
Number of sequences better than 10.0: 447
Number of HSP's gapped: 8438
Number of HSP's successfully gapped: 448
Length of query: 627
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 511
Effective length of database: 40,180,143
Effective search space: 20532053073
Effective search space used: 20532053073
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)