Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.23singletonON1241246429e-88
KLLA0A10835g1.367ON100891710.30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.23
         (124 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.23 Chr5 complement(26580..26954) [375 bp, 124 aa] {ON}  Y...   251   9e-88
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    32   0.30 

>Skud_5.23 Chr5 complement(26580..26954) [375 bp, 124 aa] {ON}
           YFR007W (NOVEL)
          Length = 124

 Score =  251 bits (642), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%)

Query: 1   MVKVGLTSTVVPASFSGISGTMSSVNSSGRARLAVDGSIEDIFVSNSLYVLTKNIAACQT 60
           MVKVGLTSTVVPASFSGISGTMSSVNSSGRARLAVDGSIEDIFVSNSLYVLTKNIAACQT
Sbjct: 1   MVKVGLTSTVVPASFSGISGTMSSVNSSGRARLAVDGSIEDIFVSNSLYVLTKNIAACQT 60

Query: 61  HRRLRLRLVYILSPTTAYCPNTLKNHERLSPVVNVLGELPDCTLERVPQKLTNEARPVLH 120
           HRRLRLRLVYILSPTTAYCPNTLKNHERLSPVVNVLGELPDCTLERVPQKLTNEARPVLH
Sbjct: 61  HRRLRLRLVYILSPTTAYCPNTLKNHERLSPVVNVLGELPDCTLERVPQKLTNEARPVLH 120

Query: 121 HGSS 124
           HGSS
Sbjct: 121 HGSS 124

>KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 1008

 Score = 32.0 bits (71), Expect = 0.30,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 14/91 (15%)

Query: 22  MSSVNSSGRARLAVDGSIEDIFVSNSLYVLTKNIAACQTHRRLRLRL-VYILSPTTAYCP 80
           M++V    R R++ DG    + V+  ++V ++N +A +  R   LR  +  LS     CP
Sbjct: 1   MATVQQLRRKRIS-DG----LTVTQKVFVRSRNGSAQKVVREHYLRKDIPCLSRICDICP 55

Query: 81  NTLKNHERLSPVVNVLGELPDCTLERVPQKL 111
           N +        V N  GELP   L   PQ+L
Sbjct: 56  NII--------VPNAAGELPKFVLSETPQEL 78

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,090,697
Number of extensions: 453955
Number of successful extensions: 1628
Number of sequences better than 10.0: 7
Number of HSP's gapped: 1628
Number of HSP's successfully gapped: 7
Length of query: 124
Length of database: 53,481,399
Length adjustment: 93
Effective length of query: 31
Effective length of database: 42,817,461
Effective search space: 1327341291
Effective search space used: 1327341291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)