Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_5.22na 1ON1611618521e-118
YEL066W (HPA3)na 1ON1791617421e-101
Smik_5.21na 1ON1611617311e-100
Suva_5.1na 1ON1611617082e-96
KAFR0D02290singletonON1621564894e-63
Skud_16.497na 2ON1551554737e-61
Suva_16.525na 2ON1551524651e-59
YPR193C (HPA2)na 2ON1561524606e-59
NCAS0A09820na 2ON1501504406e-56
KNAG0B02050singletonON1531514302e-54
Smik_16.457na 2ON1591524224e-53
NDAI0C02350na 2ON1581614225e-53
SAKL0B12606gsingletonON1551544131e-51
KNAG0B02060singletonON1541503556e-43
ZYRO0D10912g8.697ON164125810.017
TBLA0G035208.69ON211744700.88
KLTH0E14806g3.331ON17464671.3
TBLA0B044808.570ON60864691.3
CAGL0K04983g2.26ON55973681.7
NDAI0I014706.140ON68649671.9
AAL102C8.697ON15986661.9
Kwal_27.125343.331ON17464643.9
NDAI0A053003.331ON18764634.1
Kpol_1065.353.331ON17364619.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_5.22
         (161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_5.22 Chr5 (25901..26386) [486 bp, 161 aa] {ON} YEL066W (REAL)    332   e-118
YEL066W Chr5 (26667..27206) [540 bp, 179 aa] {ON}  HPA3D-Amino a...   290   e-101
Smik_5.21 Chr5 (29109..29594) [486 bp, 161 aa] {ON} YEL066W (REAL)    286   e-100
Suva_5.1 Chr5 (2428..2913) [486 bp, 161 aa] {ON} YEL066W (REAL)       277   2e-96
KAFR0D02290 Chr4 complement(464557..465045) [489 bp, 162 aa] {ON}     192   4e-63
Skud_16.497 Chr16 complement(865054..865521) [468 bp, 155 aa] {O...   186   7e-61
Suva_16.525 Chr16 complement(905109..905576) [468 bp, 155 aa] {O...   183   1e-59
YPR193C Chr16 complement(922909..923379) [471 bp, 156 aa] {ON}  ...   181   6e-59
NCAS0A09820 Chr1 (1963035..1963487) [453 bp, 150 aa] {ON}             174   6e-56
KNAG0B02050 Chr2 (392828..393289) [462 bp, 153 aa] {ON}               170   2e-54
Smik_16.457 Chr16 complement(785830..786309) [480 bp, 159 aa] {O...   167   4e-53
NDAI0C02350 Chr3 complement(535450..535926) [477 bp, 158 aa] {ON}     167   5e-53
SAKL0B12606g Chr2 (1089114..1089581) [468 bp, 155 aa] {ON} simil...   163   1e-51
KNAG0B02060 Chr2 (393547..394011) [465 bp, 154 aa] {ON}               141   6e-43
ZYRO0D10912g Chr4 (921315..921809) [495 bp, 164 aa] {ON} similar...    36   0.017
TBLA0G03520 Chr7 complement(934734..941087) [6354 bp, 2117 aa] {...    32   0.88 
KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} simil...    30   1.3  
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    31   1.3  
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    31   1.7  
NDAI0I01470 Chr9 complement(347591..349651) [2061 bp, 686 aa] {O...    30   1.9  
AAL102C Chr1 complement(163467..163946) [480 bp, 159 aa] {ON} Sy...    30   1.9  
Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR05...    29   3.9  
NDAI0A05300 Chr1 complement(1194117..1194680) [564 bp, 187 aa] {...    29   4.1  
Kpol_1065.35 s1065 complement(74947..75468) [522 bp, 173 aa] {ON...    28   9.3  

>Skud_5.22 Chr5 (25901..26386) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  332 bits (852), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60
           MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK
Sbjct: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60

Query: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120
           LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH
Sbjct: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY
Sbjct: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161

>YEL066W Chr5 (26667..27206) [540 bp, 179 aa] {ON}  HPA3D-Amino acid
           N-acetyltransferase, catalyzes N-acetylation of D-amino
           acids through ordered bi-bi mechanism in which
           acetyl-CoA is first substrate bound and CoA is last
           product liberated; similar to Hpa2p, acetylates histones
           weakly in vitro
          Length = 179

 Score =  290 bits (742), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 135/161 (83%), Positives = 145/161 (90%)

Query: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60
           MS +E EKM NDRIVV+AIE  DEEAWNKLW +YQGFQK VMPPEV  T+FARF+DPTVK
Sbjct: 19  MSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVK 78

Query: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120
           LWGALA DTETGDAIG AHYL+HLTSWHVEEV+Y+NDLYVTE AR+KGVGRKLIEFVY  
Sbjct: 79  LWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSR 138

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           ADELGTPAVYWVTDHYNHRAQLLYTKV YKTDKV+YKR GY
Sbjct: 139 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179

>Smik_5.21 Chr5 (29109..29594) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  286 bits (731), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 146/161 (90%)

Query: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60
           MS KE EKM +DRIVVRAIE  DE+AW+KLW +YQGFQK  MP EV  T+FARFLDPTVK
Sbjct: 1   MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK 60

Query: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120
           LWGALA DTETG+AIG AHYLSHLTSWHVEEV+Y+NDLYVTEHARIKGVGRKLIEFVYK 
Sbjct: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           ADELGTPAVYWVTDHYNHRAQLLYTKV YKTDKV+YKRTGY
Sbjct: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161

>Suva_5.1 Chr5 (2428..2913) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  277 bits (708), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (88%)

Query: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60
           M+  ESEK+ NDRIVVRAIE  DEE WN+LWV+YQGFQKIVMP EV +T+FARFLDP VK
Sbjct: 1   MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK 60

Query: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120
           LWGALA DT TG AIG  HYLSH+T+W VEEV+Y+NDLYVTE ARIKGVGRKLIEFVYKH
Sbjct: 61  LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH 120

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           ADELGTP+VYWVTDH+NHRAQLLYTKV YKT+KVVYKR G+
Sbjct: 121 ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161

>KAFR0D02290 Chr4 complement(464557..465045) [489 bp, 162 aa] {ON} 
          Length = 162

 Score =  192 bits (489), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 116/156 (74%)

Query: 6   SEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWGAL 65
           +E   N+ I VR ++  D+ +W +LW  +  FQ+  +P E  + +F RF+DP V +W AL
Sbjct: 7   TESTENNDITVRLVDKDDKNSWKELWTLFMEFQQTSLPEEQEELNFRRFIDPEVNMWSAL 66

Query: 66  AIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELG 125
           AID  +G AIG+A++ SH+++W + +++YLNDLYV E  R +G+GRKLI+FVY+HAD++G
Sbjct: 67  AIDEASGRAIGMANFFSHMSTWDLTDIIYLNDLYVREDVRTRGIGRKLIDFVYEHADKMG 126

Query: 126 TPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           TP VYW TD +NHRAQLLYTKVG +T KVVYKR GY
Sbjct: 127 TPKVYWWTDEHNHRAQLLYTKVGKRTPKVVYKRIGY 162

>Skud_16.497 Chr16 complement(865054..865521) [468 bp, 155 aa] {ON}
           YPR193C (REAL)
          Length = 155

 Score =  186 bits (473), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 113/155 (72%), Gaps = 2/155 (1%)

Query: 9   MAN--DRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWGALA 66
           M+N  D ++VR +   D+E W  LW  +Q F  +  P E+ + +F RFLDP VK+W A+A
Sbjct: 1   MSNTGDSVIVRFVTEDDKEGWQGLWRSFQDFYSVSFPNELDEFNFKRFLDPNVKMWAAVA 60

Query: 67  IDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELGT 126
           +D+ +G  IG+ ++LSH+T+W  ++ +Y+NDLYV E +R+KGVGR+LI+FVY+ AD+L T
Sbjct: 61  VDSTSGKIIGMINFLSHMTTWDFKDKVYINDLYVDESSRVKGVGRELIQFVYEEADKLDT 120

Query: 127 PAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           P VYW TD  NHRAQLLYTK+GYK  K +YKR GY
Sbjct: 121 PNVYWCTDESNHRAQLLYTKIGYKAPKSLYKRNGY 155

>Suva_16.525 Chr16 complement(905109..905576) [468 bp, 155 aa] {ON}
           YPR193C (REAL)
          Length = 155

 Score =  183 bits (465), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 77/152 (50%), Positives = 112/152 (73%)

Query: 10  ANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWGALAIDT 69
           A+D +VVR +   D++ W +LW  YQ F K+  P E+   +F RFLDPTVK+W A+A++ 
Sbjct: 4   ADDSVVVRLVTEDDKDGWQRLWRSYQDFYKVSFPNELDDFNFERFLDPTVKMWAAVAVNG 63

Query: 70  ETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAV 129
            +G+ IG+ ++ SH+++W  ++ +Y+NDLYV  ++R+KGVGRKLI+ VY+ AD+L TP+V
Sbjct: 64  SSGEVIGMINFFSHMSTWDFKDKIYINDLYVDGNSRVKGVGRKLIQLVYEEADKLETPSV 123

Query: 130 YWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           YW TD  N+ AQLLYTK+GYK  K +YKR GY
Sbjct: 124 YWCTDESNYSAQLLYTKIGYKAHKTIYKRNGY 155

>YPR193C Chr16 complement(922909..923379) [471 bp, 156 aa] {ON}
           HPA2Tetrameric histone acetyltransferase with similarity
           to Gcn5p, Hat1p, Elp3p, and Hpa3p; acetylates histones
           H3 and H4 in vitro and exhibits autoacetylation activity
          Length = 156

 Score =  181 bits (460), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 109/152 (71%)

Query: 10  ANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWGALAIDT 69
           + D I VR +   D+E W +LW  YQ F ++  P ++   +F RFLDP +K+W A+A+++
Sbjct: 5   SEDNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVES 64

Query: 70  ETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAV 129
            +   IG+ ++ +H+T+W  ++ +Y+NDLYV E++R+KG G KLI+FVY  AD+LGTP+V
Sbjct: 65  SSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSV 124

Query: 130 YWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           YW TD  NHRAQLLY KVGYK  K++YKR GY
Sbjct: 125 YWCTDESNHRAQLLYVKVGYKAPKILYKRKGY 156

>NCAS0A09820 Chr1 (1963035..1963487) [453 bp, 150 aa] {ON} 
          Length = 150

 Score =  174 bits (440), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 110/150 (73%)

Query: 9   MANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWGALAID 68
           M+ ++I+VR +   DEE W +LW  YQ   ++ +  EV + +F  FL+P V++W A+AI+
Sbjct: 1   MSEEKIIVRPVSLNDEEDWKRLWKHYQEHYEVHLSEEVAERNFKNFLEPGVEMWAAIAIN 60

Query: 69  TETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPA 128
           TETG  IG+ +YL HLT+W +   + L+DL+V E +RIKGVGRKL+E+V+  AD++G   
Sbjct: 61  TETGVPIGMVNYLHHLTTWDIRGKMLLHDLFVEEGSRIKGVGRKLMEYVFHEADKMGIEI 120

Query: 129 VYWVTDHYNHRAQLLYTKVGYKTDKVVYKR 158
           VYW TDHYNHRAQLLYTK+G+K  KV+Y+R
Sbjct: 121 VYWTTDHYNHRAQLLYTKIGHKNSKVIYER 150

>KNAG0B02050 Chr2 (392828..393289) [462 bp, 153 aa] {ON} 
          Length = 153

 Score =  170 bits (430), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 77/151 (50%), Positives = 108/151 (71%), Gaps = 1/151 (0%)

Query: 9   MANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWGALAID 68
           MA+D I +R +  GD+E W +LW+ ++    I +P  +G  +F R +D +V +W A A+D
Sbjct: 1   MASDSIAIRYVTDGDKEEWTRLWLGFRAHYDIPIPDGLGDANFKRIMDDSVDMWSAFAVD 60

Query: 69  TETGD-AIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELGTP 127
           T   D  IGL +++S  ++W + +++YL+DLYV E+ R++GVGRKLIEFVY  AD+ GTP
Sbjct: 61  TSRDDKPIGLVNWVSRPSTWDLTDIVYLHDLYVDENERVRGVGRKLIEFVYSEADKRGTP 120

Query: 128 AVYWVTDHYNHRAQLLYTKVGYKTDKVVYKR 158
            VYW TDHYNHRAQLLYTKV  KT KV+Y+R
Sbjct: 121 LVYWTTDHYNHRAQLLYTKVAKKTSKVIYER 151

>Smik_16.457 Chr16 complement(785830..786309) [480 bp, 159 aa] {ON}
           YPR193C (REAL)
          Length = 159

 Score =  167 bits (422), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 104/152 (68%)

Query: 10  ANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWGALAIDT 69
           + D I++R +   D+E W +LW  YQ F K+    ++   +F RFLD  +K+W A+A++ 
Sbjct: 8   SEDNIIIRFVTENDKEGWQRLWKSYQKFYKVSFSNDLDDFNFNRFLDSNIKMWTAVAVER 67

Query: 70  ETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAV 129
            +G  IG+ ++ SH+T+W  ++ +Y+NDLYV   +R K  G KLIEFVY   D+LGTP+V
Sbjct: 68  SSGKNIGMINFFSHVTTWDFKDKVYVNDLYVDVGSRAKVTGVKLIEFVYGEIDKLGTPSV 127

Query: 130 YWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           YW TD  N+RAQLLYTK+GYK  K++YKR GY
Sbjct: 128 YWCTDESNYRAQLLYTKIGYKAPKIMYKRKGY 159

>NDAI0C02350 Chr3 complement(535450..535926) [477 bp, 158 aa] {ON} 
          Length = 158

 Score =  167 bits (422), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 80/161 (49%), Positives = 107/161 (66%), Gaps = 7/161 (4%)

Query: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60
           MSE+ S       +V+R I+  D++ W  LW QYQ      M  ++   +F RFLDP VK
Sbjct: 1   MSEEAS-------VVIRPIQETDKDDWLLLWKQYQKCYNRTMKEDIPLLTFERFLDPEVK 53

Query: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120
           +W A AI+T T   IG+  YL H T+W+++  ++L+DL+V E  R+KGVGRKL+EFVY  
Sbjct: 54  MWAAFAINTTTNKPIGMVTYLHHFTTWNLDGKIFLHDLFVQEDQRVKGVGRKLMEFVYDA 113

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
           +D +  P VYW TD +NHRAQLLYTKVG KT KV+Y+R GY
Sbjct: 114 SDRMDVPFVYWTTDDFNHRAQLLYTKVGKKTSKVLYERGGY 154

>SAKL0B12606g Chr2 (1089114..1089581) [468 bp, 155 aa] {ON} similar
           to uniprot|Q06592 Saccharomyces cerevisiae YPR193C HPA2
           Tetrameric histone acetyltransferase with similarity to
           Gcn5p, Hat1p, Elp3p, and Hpa3p
          Length = 155

 Score =  163 bits (413), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 102/154 (66%)

Query: 6   SEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWGAL 65
           S     D ++VR +   DEE W +LW  Y  F K  +P EV + +F RFL P VK+W AL
Sbjct: 2   SANPCKDSVIVRLVGTEDEEEWKRLWKLYLVFYKSSLPEEVAELNFKRFLKPEVKMWSAL 61

Query: 66  AIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELG 125
           AIDT T   IG+ +Y  H  +W V++ + LNDLYV E+ R+KGVGR+LI  VY HA++L 
Sbjct: 62  AIDTVTNKPIGMVNYFGHFHTWDVKDKILLNDLYVDENFRVKGVGRRLITHVYGHAEKLE 121

Query: 126 TPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRT 159
              VYW TD +NHRAQLLYTK+G +T KV Y+RT
Sbjct: 122 IWNVYWHTDFFNHRAQLLYTKIGERTTKVQYRRT 155

>KNAG0B02060 Chr2 (393547..394011) [465 bp, 154 aa] {ON} 
          Length = 154

 Score =  141 bits (355), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 93/150 (62%), Gaps = 2/150 (1%)

Query: 14  IVVRAIEAGDEEAWNKLWVQYQGFQKIV--MPPEVGKTSFARFLDPTVKLWGALAIDTET 71
           + VR ++ GD E   +L+  Y  F K +  +P      +F RFLDP  ++W A+AIDT T
Sbjct: 5   VEVRYVQPGDREELARLFTLYLNFYKSLDKVPATQFDLNFKRFLDPKERMWAAVAIDTST 64

Query: 72  GDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAVYW 131
           G  IG+  +  H ++W  E  + LNDLYV E +R+ GVGR L+EFV+   D++G   VYW
Sbjct: 65  GKHIGMVQWFHHTSTWEPEGCILLNDLYVDEDSRLGGVGRALMEFVFSEGDKIGVGNVYW 124

Query: 132 VTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161
            TD  NHRAQLLYTKVGY + +  Y R GY
Sbjct: 125 HTDTSNHRAQLLYTKVGYLSSQCRYVRNGY 154

>ZYRO0D10912g Chr4 (921315..921809) [495 bp, 164 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 164

 Score = 35.8 bits (81), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 55/125 (44%), Gaps = 13/125 (10%)

Query: 30  LWVQYQG--FQKIVMPPEVGKTSFARFLDPTVKLWGALAIDTETGDAIGLAHYLSHLTSW 87
           L VQY    FQ+IV      +TSFA+           LA  +E       A  +++    
Sbjct: 27  LPVQYPDSFFQEIVQNKNGKETSFAQ-----------LAFYSEVAVGAVKAKLIANKKGG 75

Query: 88  HVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAVYWVTDHYNHRAQLLYTKV 147
            +   +Y+  L V EH   KG+G KL+E+V   A +    A+Y      N RA   Y K 
Sbjct: 76  ILPHGMYIEVLAVLEHYSGKGIGTKLLEYVESEAKKHYQHALYVHVASDNVRAITWYKKR 135

Query: 148 GYKTD 152
           G++ D
Sbjct: 136 GFEQD 140

>TBLA0G03520 Chr7 complement(934734..941087) [6354 bp, 2117 aa] {ON}
           Anc_8.69 YFL007W
          Length = 2117

 Score = 31.6 bits (70), Expect = 0.88,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 95  LNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAVYWVTDHYNH 138
           LND+    H  I  +G++LIEF+    DE+ +P +  +T    H
Sbjct: 857 LNDILRQSHEEILKIGKELIEFMIYVYDEISSPPLAVITSILVH 900

>KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} similar
           to uniprot|Q03503 Saccharomyces cerevisiae YPR051W MAK3
           Catalytic subunit of N-terminal acetyltransferase of the
           NatC type required for replication of dsRNA virus
          Length = 174

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%)

Query: 94  YLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDK 153
           Y+  L V +  R +G+ +KL+E   +   E+G   +   T+  N  A  LY  +G+   K
Sbjct: 77  YIGMLAVDQKYRRRGIAKKLVEQAIQKMQEIGCDEIMLETEVENTTALQLYEGMGFIRLK 136

Query: 154 VVYK 157
            +++
Sbjct: 137 RMFR 140

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 4   KESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVKLWG 63
           +  EK   DR  +R IE+ ++  WN       G QK V   E  K  + +   PT+K +G
Sbjct: 339 ESKEKFEGDREEIREIESLNDPRWN--LCSNLGIQKPVSDDEQFKQLYPKPPKPTLKQYG 396

Query: 64  ALAI 67
            L I
Sbjct: 397 KLFI 400

>CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa]
           {ON} highly similar to uniprot|P40151 Saccharomyces
           cerevisiae YNL218w
          Length = 559

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)

Query: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVM--PPEVGKTSFARFLDPT 58
           +SEK   K   D +  + I + +    NK +VQ      +++  PP VGKT+ AR L  T
Sbjct: 118 LSEKLRPKEIRDYVGQQHILSQESGVLNK-YVQEGLVPSMILWGPPGVGKTTLARLLTKT 176

Query: 59  VKLWGALAIDTET 71
             L G+     ET
Sbjct: 177 ASLHGSRYTMVET 189

>NDAI0I01470 Chr9 complement(347591..349651) [2061 bp, 686 aa] {ON}
           Anc_6.140 YGL113W
          Length = 686

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 2   SEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTS 50
           S +++EK   D I V+A+ A  +E   +L    + F+  +MPP++G +S
Sbjct: 93  SREDNEKELTDIIDVKALFASCKEKTKELSPDAETFKLQMMPPDIGTSS 141

>AAL102C Chr1 complement(163467..163946) [480 bp, 159 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR253W
          Length = 159

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 4/86 (4%)

Query: 45  EVGKTSFARFLDPTVKLWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHA 104
           E GK  F+   D    L+  LA   E   A+G     + +        + ++ L V E  
Sbjct: 34  EFGKELFSSKKDDKSTLYSQLAFYGEV--AVGAVK--ARIQDMRGHSAVVIDTLAVLEAY 89

Query: 105 RIKGVGRKLIEFVYKHADELGTPAVY 130
           R KGVG KL+++V K        A+Y
Sbjct: 90  RGKGVGTKLLDYVEKETKPFQPRAIY 115

>Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR051W
           (MAK3) - N-acetyltransferase [contig 260] FULL
          Length = 174

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%)

Query: 94  YLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDK 153
           Y+  L V +  R +G+ +KL+E   +    +G   V   T+  N  A  LY  +G+   K
Sbjct: 77  YIGMLAVAQTYRRRGIAKKLVEVAIEKMQAIGCDEVMLETEVENKAALKLYEGMGFIRLK 136

Query: 154 VVYK 157
            +++
Sbjct: 137 RMFR 140

>NDAI0A05300 Chr1 complement(1194117..1194680) [564 bp, 187 aa] {ON}
           Anc_3.331 YPR051W
          Length = 187

 Score = 28.9 bits (63), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%)

Query: 94  YLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDK 153
           Y+  L V  H R +G+ +KL+E      +  G   +   T+  N  A  LY  +G+   K
Sbjct: 90  YIGMLAVESHYRGQGISKKLVEIAITQMESNGCDEIMLETEVENVIALNLYENMGFIKMK 149

Query: 154 VVYK 157
            +++
Sbjct: 150 RMFR 153

>Kpol_1065.35 s1065 complement(74947..75468) [522 bp, 173 aa] {ON}
           complement(74947..75468) [522 nt, 174 aa]
          Length = 173

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%)

Query: 94  YLNDLYVTEHARIKGVGRKLIEFVYKHADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDK 153
           Y+  L V    R KG+ + L+    +   E+G   +   T+  N  A  LY K+G+   K
Sbjct: 80  YIGMLAVDRKYRKKGIAKLLVNKSIEKMKEIGCDEITLETEVENKIALSLYEKIGFIKMK 139

Query: 154 VVYK 157
            +++
Sbjct: 140 RMFR 143

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,972,175
Number of extensions: 732333
Number of successful extensions: 1567
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1565
Number of HSP's successfully gapped: 30
Length of query: 161
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 60
Effective length of database: 41,900,133
Effective search space: 2514007980
Effective search space used: 2514007980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)