Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.937.343ON75575536350.0
YDL164C (CDC9)7.343ON75575532860.0
Suva_4.827.343ON75575532630.0
Smik_4.747.343ON84575632560.0
NCAS0A141107.343ON75373726210.0
CAGL0I03410g7.343ON72472025560.0
TDEL0C020407.343ON70572025410.0
NDAI0A019407.343ON76572225200.0
KNAG0C037407.343ON72763224600.0
KAFR0B008307.343ON71061224470.0
ZYRO0F11572g7.343ON73172424300.0
Kpol_2001.717.343ON72673323950.0
SAKL0F10912g7.343ON69361323360.0
Kwal_56.246167.343ON71571723250.0
KLTH0H01408g7.343ON72372022660.0
TPHA0D045707.343ON73673922350.0
KLLA0D12496g7.343ON70061321670.0
ACL155W7.343ON69771721240.0
TBLA0E020507.343ON72061520600.0
TPHA0M002606.18ON9662322647e-23
ACR008W6.18ON9814052522e-21
Smik_15.1746.18ON9452442513e-21
TBLA0G010406.18ON9722402513e-21
KNAG0F028706.18ON9542392442e-20
CAGL0E02695g6.18ON9462882442e-20
YOR005C (DNL4)6.18ON9442682371e-19
NCAS0D026506.18ON9502772362e-19
Skud_15.1666.18ON9472392353e-19
ZYRO0C07854g6.18ON9444352334e-19
KLLA0D01089g6.18ON9073722281e-18
Suva_15.1806.18ON9484172282e-18
TDEL0G045106.18ON9694092282e-18
KLTH0C11286g6.18ON9512372245e-18
Kwal_56.224146.18ON9632592192e-17
Kpol_1032.76.18ON9652242131e-16
NDAI0I022606.18ON9672682131e-16
KAFR0A050506.18ON9482362103e-16
AFR603C3.107ON956114743.4
CAGL0D06622g4.39ON117890725.9
AFR049W2.113ON717115717.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.93
         (755 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...  1404   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...  1270   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...  1261   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...  1258   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...  1014   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   989   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   983   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   975   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   952   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   947   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   940   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   927   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   904   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   900   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   877   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   865   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   839   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   822   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   798   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   106   7e-23
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   101   2e-21
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   101   3e-21
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   101   3e-21
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    99   2e-20
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    99   2e-20
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    96   1e-19
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    96   2e-19
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    95   3e-19
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...    94   4e-19
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    92   1e-18
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    92   2e-18
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    92   2e-18
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    91   5e-18
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    89   2e-17
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    87   1e-16
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    87   1e-16
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    86   3e-16
AFR603C Chr6 complement(1525293..1528163) [2871 bp, 956 aa] {ON}...    33   3.4  
CAGL0D06622g Chr4 complement(629323..632859) [3537 bp, 1178 aa] ...    32   5.9  
AFR049W Chr6 (517312..519465) [2154 bp, 717 aa] {ON} Syntenic ho...    32   7.5  

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1404 bits (3635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/755 (92%), Positives = 696/755 (92%)

Query: 1   MRRLLAGLLFSPARXXXXXXXXXXXXXXXXXAGKKPKQATLARFFSSMKNEPSGSSSSPE 60
           MRRLLAGLLFSPAR                 AGKKPKQATLARFFSSMKNEPSGSSSSPE
Sbjct: 1   MRRLLAGLLFSPARSLNPRLSLLMPPSLPSSAGKKPKQATLARFFSSMKNEPSGSSSSPE 60

Query: 61  KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMGXXXXXXXXXXXXXXGVDVS 120
           KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMG              GVDVS
Sbjct: 61  KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMGSSPFSLPSSAPSSSGVDVS 120

Query: 121 QESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMN 180
           QESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMN
Sbjct: 121 QESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMN 180

Query: 181 QSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLG 240
           QSSKNLIPTTYLFINRLGPDY             MKTISESCGKSMSQIKLKYKEMGDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLG 240

Query: 241 EIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300
           EIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAK
Sbjct: 241 EIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQ 360

Query: 361 VPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQ 480
           DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQ
Sbjct: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQ 480

Query: 481 KKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVV 540
           KKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVV
Sbjct: 481 KKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVV 540

Query: 541 PGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660

Query: 661 HERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720
           HERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
Sbjct: 661 HERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755
           RFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN
Sbjct: 721 RFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 1270 bits (3286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/755 (81%), Positives = 657/755 (87%)

Query: 1   MRRLLAGLLFSPARXXXXXXXXXXXXXXXXXAGKKPKQATLARFFSSMKNEPSGSSSSPE 60
           MRRLL G L S AR                 AGKKPKQATLARFF+SMKN+P+  + SP+
Sbjct: 1   MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK 60

Query: 61  KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMGXXXXXXXXXXXXXXGVDVS 120
           K+ KH LE+ +DN S E   ATKKLKQ +   T+ APS+MG                D  
Sbjct: 61  KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP 120

Query: 121 QESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMN 180
           Q+S+    +VE   SSN+NDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIM 
Sbjct: 121 QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK 180

Query: 181 QSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLG 240
           QSSKNLIPTTYLFINRLGPDY             MKTISE+CGKSMSQIKLKYK++GDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG 240

Query: 241 EIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300
           EIAMGARNVQPTMFKPK LTVGEVFKNLR IAKTQGKDSQL+KMKLIKRMLTAC+G+EAK
Sbjct: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLHDEN+E+SPDK++PMDVLESAQQ+IRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ 360

Query: 361 VPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCL HGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQ 480
           DGERAQVHLLNDGTMRIYSRNGENMTERYPEI ITDFIQDL++TKNLILDCEAVAWDK+Q
Sbjct: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ 480

Query: 481 KKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVV 540
            KILPFQ+LSTRKRKDVEL+DVKVKVCLFAFDILCYNDERLINKSL+ERRE+L KVTKVV
Sbjct: 481 GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV 540

Query: 541 PGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQI TNNLDELQKFLDESVN+SCEGLMVKML+GPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660

Query: 661 HERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720
           H+RLTPTIIDGPKATFVFD+SAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
Sbjct: 661 HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755
           RFPRFLRIREDKGVEDATSSDQI+ELYENQSH+QN
Sbjct: 721 RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1261 bits (3263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/755 (82%), Positives = 651/755 (86%)

Query: 1   MRRLLAGLLFSPARXXXXXXXXXXXXXXXXXAGKKPKQATLARFFSSMKNEPSGSSSSPE 60
           M R LAGL+ +  R                 AGKKPKQATLARFF+SMKN+PSG SSSPE
Sbjct: 1   MHRSLAGLILTSVRPSSSKLLLFMSSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPE 60

Query: 61  KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMGXXXXXXXXXXXXXXGVDVS 120
           KA KHK+EN  +  SSEGA A KKLK +S VQT V  S M               GVD S
Sbjct: 61  KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDAS 120

Query: 121 QESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMN 180
           Q+SRE TP+VE+E    DNDHYSSNIPYSEVCEVFN+IEAISSRLEIIRICSDFFIKIM 
Sbjct: 121 QKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMK 180

Query: 181 QSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLG 240
           QSSKNLIPTTYLFINRLGPDY             MKTISESCGKSM+QIKLKYKE+GDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLG 240

Query: 241 EIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300
           EIAMGARNVQPTMFKPK LTVGEVFKNLR+IAKTQGKDSQLRKMKLIKRMLTACQGVEAK
Sbjct: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLH  N ENS   +IPMDVLESAQQ+IRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQ 360

Query: 361 VPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCL HGIMNLDK+CTL+PGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQ 480
           DGERAQVHLL+DGTMRIYSRNGENMTERYPEIKITDFIQDL++TKNLILDCEAVAWDKEQ
Sbjct: 421 DGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQ 480

Query: 481 KKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVV 540
            KILPFQ+LSTRKRKDVEL DVKV+VCLFAFD+LC+N ERLINKSLRERRE L KVTKVV
Sbjct: 481 GKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVV 540

Query: 541 PGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQI+T+NLDELQKFLDESVN SCEGLMVKML+GPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDE LQ L
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQL 660

Query: 661 HERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720
           HERLTPTIIDGPKATFVFD+SAEPDVWFEPTTLFEVLTADLSLSPIYKAGS TF KGVSL
Sbjct: 661 HERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755
           RFPRFLRIREDKGVEDATSS+QI+ELYENQSHVQN
Sbjct: 721 RFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 1258 bits (3256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/756 (81%), Positives = 654/756 (86%), Gaps = 1/756 (0%)

Query: 1   MRRLLAGLLFSPARXXXXXXXXXXXXXXXXXAGKKPKQATLARFFSSMKNEPSGSSSSPE 60
           MRRLL GLL S                    AGKKPKQATLARFF+SMKN+PSG++S P+
Sbjct: 90  MRRLLGGLLISSTHPLILRLPLSMSSSLPSSAGKKPKQATLARFFTSMKNKPSGNTSPPD 149

Query: 61  KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMGXXXXXXXXXXXXXXGVDVS 120
           K+ KH L++++D++SS G    KK +QV+  Q       M               G D+S
Sbjct: 150 KSAKHMLQDSVDDDSSVGVRNVKKSQQVAVAQAATVQPFMSSFPSSLPSSAPSSSGADLS 209

Query: 121 QESREFTPQVEK-EPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIM 179
           Q+ +   P+VE  E +SND+DHYSSNIPYS+VCEVFN+IEAISSRLEIIRICSDFFIK+M
Sbjct: 210 QKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVM 269

Query: 180 NQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDL 239
            QSSKNLIPTTYLFINRLGPDY             MKTISESCGKSMSQIKLKYKE+GDL
Sbjct: 270 KQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDL 329

Query: 240 GEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEA 299
           GEIAMGARNVQPTMFKPK LTVGEVFKNLRTIAKTQGKDSQLRK+KLIKRMLTACQGVEA
Sbjct: 330 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEA 389

Query: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFC 359
           KFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN+ENS DK+IPMDVLESAQQ+IRDAFC
Sbjct: 390 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFC 449

Query: 360 QVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 419
           QVPNYEIVINSCL HGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK
Sbjct: 450 QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 509

Query: 420 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKE 479
           YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDL+ TKNLILDCEAVAWDK+
Sbjct: 510 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKD 569

Query: 480 QKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKV 539
           Q KILPFQ+LSTRKRKDVEL+DVKV+VCLFAFDILC+NDERLIN SLRERRE+L KVTKV
Sbjct: 570 QAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKV 629

Query: 540 VPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKK 599
           VPGEFQYATQIITNNLDELQKFLDESVN+SCEGLMVKMLDG ESHYEPSKRSRNWLKLKK
Sbjct: 630 VPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKK 689

Query: 600 DYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 659
           DYLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLQL
Sbjct: 690 DYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 749

Query: 660 LHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVS 719
           LH RLTPTIIDGPKAT+VFD+SAEPDVWFEPTTLFEVLTADLSLSPIYKAGS TFDKGVS
Sbjct: 750 LHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVS 809

Query: 720 LRFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755
           LRFPRFLRIREDKGVEDATSSDQI+ELYENQSHVQN
Sbjct: 810 LRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN 845

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 1014 bits (2621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/737 (68%), Positives = 589/737 (79%), Gaps = 26/737 (3%)

Query: 34  KKPKQATLARFFSSMKNE-------PSGSSSSPEKAP---------KHKLENNIDNNSSE 77
           KK KQATLA+FFSSMKNE       P  S+++  + P         K   E  ++  +S 
Sbjct: 27  KKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASN 86

Query: 78  GADATKKLKQVSTVQTLVAPSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSN 137
            A +++ +  +++  ++   ST                 ++ S+E     P +E     +
Sbjct: 87  LASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKE-----PTIENVTQDS 141

Query: 138 DNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRL 197
              ++SS IPY EVC +F +IE+ SSRL II++CSDFFIKIM ++ +NLIP TYLFIN+L
Sbjct: 142 TKPYFSS-IPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKL 200

Query: 198 GPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPK 257
           GPDY             MKTISESCGKS++Q++ KY+E+GDLG+IAM ARNVQPTMFKPK
Sbjct: 201 GPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPK 260

Query: 258 ALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEK 317
            LTVGEVF+NLR IAK++GKDSQ RK+KLIKRMLTAC+G EAKFLIRSLESKLRIGLAEK
Sbjct: 261 PLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEK 320

Query: 318 TVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIM 377
           TVLISLSKALL+H E K+N   K+  M++LE+A+Q+IRDAFCQVPNYEIVINSCL +GIM
Sbjct: 321 TVLISLSKALLVH-ECKDN---KDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIM 376

Query: 378 NLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRI 437
            L+ +C+LRPGIPLKPMLAKPTKAINE+LDRFQGE FTSEYKYDGERAQVHLL+DGTMRI
Sbjct: 377 ELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRI 436

Query: 438 YSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDV 497
           YSRNGENMTERYPEI I DFI D   T  LILDCEAVAWD EQ KILPFQ+LSTRKRKDV
Sbjct: 437 YSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDV 496

Query: 498 ELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDE 557
           +L DVKVKVCLFAFDILC+NDE+LINKSLRERR+ L +VTK V GEFQYAT++ ++NLDE
Sbjct: 497 DLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDE 556

Query: 558 LQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXX 617
           LQKFLD+SV++SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCV+   
Sbjct: 557 LQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAY 616

Query: 618 XXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFV 677
                       FLLGCYNQDTGEFETCCKIGTGFSDEMLQ L+ RLTPT++DGPKATFV
Sbjct: 617 YGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFV 676

Query: 678 FDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDA 737
           +D+SAEPDVWFEPT LFEVLTADLSLSPIYKAGS+T+DKG+SLRFPRF+R REDKGVEDA
Sbjct: 677 YDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDA 736

Query: 738 TSSDQIIELYENQSHVQ 754
           TSS+QIIELYENQ+H Q
Sbjct: 737 TSSEQIIELYENQAHTQ 753

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/720 (68%), Positives = 572/720 (79%), Gaps = 25/720 (3%)

Query: 37  KQATLARFFSSMKNEPSGSSSSPEKAPKHKLENNIDNNSSEGADATKK-LKQVSTVQTLV 95
           +QATLARFFSS+K +  G     +   K      +D NS E  DA K  LK++    T  
Sbjct: 29  RQATLARFFSSVKKDADGDKKGEQADVKTAA---VDLNSHE-VDANKSPLKKMKLESTGS 84

Query: 96  APSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVF 155
             +T                  +  +E  E TP +   P   D+  +   +PYS++C +F
Sbjct: 85  LTATKNG---------------NQGKEEHEGTP-IASTPRQVDSKFFC-KVPYSDLCNLF 127

Query: 156 NKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXM 215
            +IE  SSRL II++CSDFFIKIM +  +NLIP TYLFIN+LGPDY             M
Sbjct: 128 EEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLM 187

Query: 216 KTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQ 275
           KTISESCGKSM QIK +Y+E+GDLG+IA+ ARNVQPTMFKPK L VGEVF+NL+TIAK+Q
Sbjct: 188 KTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQ 247

Query: 276 GKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENKE 335
           GKDSQ +KMKLIKRMLTACQG EAKFLIRSLESKLRIGLAEKTVLI+LSKALL+HDE   
Sbjct: 248 GKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYS 307

Query: 336 NSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPML 395
           N   KE  MDV+E A+Q+IRDAFCQVPNYE+VIN+CL++GIM LD++CT++PGIPLKPML
Sbjct: 308 N---KEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPML 364

Query: 396 AKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKIT 455
           AKPTKAINEVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI+I 
Sbjct: 365 AKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIK 424

Query: 456 DFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILC 515
           DF+ D  ST +LILDCEAVAWDKEQ KILPFQ+L+TRKRKDV +++VKV+VCLFAFDIL 
Sbjct: 425 DFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILL 484

Query: 516 YNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMV 575
           +ND RLIN+ L +RRE L +VTK V GEFQYATQ+ T+NLDELQKFLDESV NSCEGLMV
Sbjct: 485 HNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMV 544

Query: 576 KMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCY 635
           KM+DG ES+YEPSKRSRNWLKLKKDYLEGVGDSLDLCVL               FLLGCY
Sbjct: 545 KMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCY 604

Query: 636 NQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFE 695
           N D+ +FETCCKIGTGFS+EMLQ L+E+L+PT+IDGPK T+VFD+SAEPDVWFEPT LFE
Sbjct: 605 NADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFE 664

Query: 696 VLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755
           VLTADLSLSPIYKAGS+ +DKG+SLRFPRFLRIR+DK VEDATSS+QIIE+Y+NQSHV N
Sbjct: 665 VLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVAN 724

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/720 (67%), Positives = 564/720 (78%), Gaps = 41/720 (5%)

Query: 37  KQATLARFFSSMKNEPSGSSSSPEKAPKHKLENN---IDNNSSEGADATKKLKQVSTVQT 93
           KQATLARFFS+++ + +          K K+  +   I++  ++    TKK K  S V+ 
Sbjct: 23  KQATLARFFSAVQKDDT----------KEKVNGDVKIIESRDNQDEPVTKKFKSSSPVK- 71

Query: 94  LVAPSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYSEVCE 153
                                  +  S  S   +  VE        D Y S +PYS+VC 
Sbjct: 72  -----------------------LQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCN 108

Query: 154 VFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXX 213
           VF +IE  SSRL II+ICS+FF +IM  + +NLIPTTYLFINRLGPDY            
Sbjct: 109 VFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGL 168

Query: 214 XMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAK 273
            MKTISE+CGKS+ Q+K +Y+EMGDLG+IA+ ARNVQPTMFKPK LTVGEVF+NLR IA 
Sbjct: 169 LMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAH 228

Query: 274 TQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN 333
           +QGKDSQ RK+KLIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL +   
Sbjct: 229 SQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTN--- 285

Query: 334 KENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKP 393
            E    KE  M+++E A+ +IRDAFCQVPNYEIVIN+CL++GIM LDK+C LRPGIPLKP
Sbjct: 286 -EGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKP 344

Query: 394 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIK 453
           MLAKPTK+I EVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI 
Sbjct: 345 MLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIS 404

Query: 454 ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDI 513
           I DF+ DL  TK LILDCEAVAWDK Q+KILPFQ+LSTRKRKDVE  DVKV+VCLFAFDI
Sbjct: 405 IRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDI 464

Query: 514 LCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGL 573
           +C+N ER INKSLRERRE LA+VTK V GEFQYA ++ T++++ELQKFLD+SV +SCEGL
Sbjct: 465 ICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGL 524

Query: 574 MVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 633
           MVKMLDGPESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLG
Sbjct: 525 MVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 584

Query: 634 CYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTL 693
           CYNQD+GEFETCCKIGTGFSDEMLQ L+ER + T +DGPKAT+VFD+SAEPDVWFEPTTL
Sbjct: 585 CYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTL 644

Query: 694 FEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHV 753
           FEVLTADLSLSP+YKAG++T+DKGVSLRFPRF+R+R+DK VEDATSS QI+ELY++QSHV
Sbjct: 645 FEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/722 (67%), Positives = 569/722 (78%), Gaps = 8/722 (1%)

Query: 33  GKKPKQATLARFFSSMKNE-PSGSSSSPEKAPKHKLENNIDNNSSEGADATKKLKQVSTV 91
           G+K +QATL RFFSS+ ++ P+  ++   ++ +   E N D++ S      + L   S+ 
Sbjct: 47  GRK-QQATLGRFFSSINHKKPTKDTALKNESKEETKEENKDDSDSIPRKKIR-LSTSSSS 104

Query: 92  QTLVAPSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYSEV 151
            +++A S                     S            +P +  +  +   IPY EV
Sbjct: 105 PSIMAESKPKSPIKLNTERSSSPASASASTTPTPIVADHTLDPKTAVSKPFLCAIPYKEV 164

Query: 152 CEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXXXXXXX 211
           C++F +IE  SSRL II++CSDF IKIM Q  +NLIP TYLFIN+LGPDY          
Sbjct: 165 CQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGLELGLGE 224

Query: 212 XXXMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTI 271
              MKTISESCGKS++QI+ +Y+E+GDLG+IA+ ARNVQPTMFKPK LTVGEVF NL+ I
Sbjct: 225 GLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLKMI 284

Query: 272 AKTQGKDSQLRKMKLIKRMLTACQ-GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLH 330
           AK  GKDSQ +K+KLIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL+ 
Sbjct: 285 AKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLV- 343

Query: 331 DENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIP 390
              KE   +K+  M++LE+A+ +IRDAFCQVPNYEIVINSCL +GIMNL+++C+LRPGIP
Sbjct: 344 ---KEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIP 400

Query: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYP 450
           LKPMLAKPTKAINE+LDRFQGETFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYP
Sbjct: 401 LKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYP 460

Query: 451 EIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFA 510
           EI I DF++D N TK LILDCEAVAWDKEQ+KILPFQ+LSTRKRKDV   DVKV+VCLFA
Sbjct: 461 EIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFA 520

Query: 511 FDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSC 570
           FDILC+N  +LIN SL+ERRE L +VT   PGEFQYAT++ T+NLDELQKFLD+SVN+SC
Sbjct: 521 FDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSC 580

Query: 571 EGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXF 630
           EGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCVL               F
Sbjct: 581 EGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGF 640

Query: 631 LLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEP 690
           LLGCYN +TGEFETCCKIGTGFSDEMLQ LHE+L  T+IDGPKAT+++D+SAEPDVWFEP
Sbjct: 641 LLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEP 700

Query: 691 TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQ 750
           + LFEVLTADLSLSPIYKAGS+ +DKGVSLRFPRF+RIREDKGVEDATSS+QIIELYENQ
Sbjct: 701 SLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQ 760

Query: 751 SH 752
           SH
Sbjct: 761 SH 762

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/632 (71%), Positives = 532/632 (84%), Gaps = 7/632 (1%)

Query: 127 TPQVEK----EPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQS 182
           TP V K    +  +ND   + S +PY+++C +F +IE ISSRL II++CS F I +M   
Sbjct: 98  TPVVSKKIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLD 157

Query: 183 SKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLGEI 242
            +NLIP TYLFIN+LGPDY             +KTI+ESCG+S+ QIK KY E+GDLG+I
Sbjct: 158 PRNLIPMTYLFINKLGPDYMPGLELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQI 217

Query: 243 AMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFL 302
           A+ AR VQPTMFKPK LTVGEVF+NL++IA +QGKDSQ +K+KLIKRMLT+CQGVEAKFL
Sbjct: 218 ALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFL 277

Query: 303 IRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVP 362
           IRSLESKLRIGLAEKTVLISLSKALL+++  +    DK+I M+ +E+A+Q+IRDAFCQVP
Sbjct: 278 IRSLESKLRIGLAEKTVLISLSKALLVYEYGES---DKDIDMETVENAEQKIRDAFCQVP 334

Query: 363 NYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDG 422
           NYE+VI+SCL HGIMNLD++C+LRP IPLKPMLAKPTK+I+E+ DRFQ + FT EYKYDG
Sbjct: 335 NYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDG 394

Query: 423 ERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKK 482
           ERAQVHLL DGTMRIYSRNGENMTERYPEI I DF+ DL+ TK+LILDCEAVAWDKEQ K
Sbjct: 395 ERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNK 454

Query: 483 ILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPG 542
           ILPFQ+LSTRKRKDV+++++KV+VCLFAFDIL +NDE+LINKSL+ERR+ L  +TK V G
Sbjct: 455 ILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTG 514

Query: 543 EFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYL 602
           EFQ+AT++ T NL+ELQ FLD+SV NSCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL
Sbjct: 515 EFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYL 574

Query: 603 EGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHE 662
            GVGDSLDLCVL               FLLGCYNQDTGEFET CKIGTGFSDE+LQ LHE
Sbjct: 575 AGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHE 634

Query: 663 RLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRF 722
           RL  T+ID PKAT+VFD SAEPDVWFEPT LFEVLTADLSLSP+YKAGS+T+DKGVSLRF
Sbjct: 635 RLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRF 694

Query: 723 PRFLRIREDKGVEDATSSDQIIELYENQSHVQ 754
           PRFLR+REDKGVEDATSS+QI+E+YENQ+++Q
Sbjct: 695 PRFLRLREDKGVEDATSSEQIVEMYENQANLQ 726

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/612 (72%), Positives = 527/612 (86%), Gaps = 4/612 (0%)

Query: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDY 201
           +  +IPY++VC +F +IE ISSRL+II++CS+FF K M Q++ NLIP TYLFIN+LGPDY
Sbjct: 101 FVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDY 160

Query: 202 XXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTV 261
                        MKTISESCGKS+ Q+KL YK++GDLG IAM ARNVQPTMFKPK LTV
Sbjct: 161 EMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTV 220

Query: 262 GEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321
           G VF+NL+ IAK+ GKDSQL+K++LIK++LTAC+G+EAK+LIRSLESKLRIGLAEK+VLI
Sbjct: 221 GYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACKGIEAKYLIRSLESKLRIGLAEKSVLI 280

Query: 322 SLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDK 381
           SLSKALL+++ N    PD    M+++E A+Q+IRDAFCQ+PNYEIVINSCL +GIMNLD+
Sbjct: 281 SLSKALLINEYNNTLDPD----MELIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDE 336

Query: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441
           +C+LRPGIPLKPMLAKPTK I EV DRFQ   FTSEYKYDGERAQVHL+NDG+MRIYSRN
Sbjct: 337 HCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRN 396

Query: 442 GENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHD 501
           GENMTERYPEI +TDFI+DLN TK+LI+DCEAVAWD+E+KKILPFQ+LSTRKRKDV++ D
Sbjct: 397 GENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKD 456

Query: 502 VKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKF 561
           +KV++CLFAFDILC+NDE+LINKSLRERRE L  VT+ V GEF YA ++ TNNLDELQ F
Sbjct: 457 IKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLF 516

Query: 562 LDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 621
           LD+SV +SCEGLMVK+LDG +SHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL       
Sbjct: 517 LDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGRG 576

Query: 622 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDAS 681
                   FLLGCYNQDTGEFET CKIGTGFSDE+LQ L++RL  T IDGPKAT+++D+S
Sbjct: 577 KRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSS 636

Query: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741
           A+PDVWFEPT LFEVLTADLS+SPIYKAG++T+ KG+SLRFPRF+R+REDK VE+ATSS+
Sbjct: 637 AQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSE 696

Query: 742 QIIELYENQSHV 753
           QIIELYENQSHV
Sbjct: 697 QIIELYENQSHV 708

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/724 (64%), Positives = 561/724 (77%), Gaps = 24/724 (3%)

Query: 34  KKPKQATLARFFSSMK--NEPSGSSSSPE--KAPKHKLENNIDNNSSEGADATKKLKQVS 89
           K+ KQATLA+FFSS+K  N P+  +++P        K E+ + +NS+E  +++      +
Sbjct: 27  KQAKQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRSNSNE-KESSPMFDDSN 85

Query: 90  TVQTLVAPSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYS 149
              +  A S+ G                D +  S+           +N +DH+S+ +PY+
Sbjct: 86  GRSS--ACSSAGLEMESAPAPKKLKMESDSNSTSK-----------NNQDDHFST-VPYA 131

Query: 150 EVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXXXXX 209
           +VC +F +IE+ SSRL II+ICSDFF +I+ + S+NL+PTTYLFIN+LGPDY        
Sbjct: 132 DVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGMELGL 191

Query: 210 XXXXXMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLR 269
                MKTISESCGKS++Q+K +Y+EMGDLG+IAM ARNVQPTMFKPK LTVGEVF NLR
Sbjct: 192 GEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLR 251

Query: 270 TIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLL 329
            IA  QGKDSQ +K+KLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLS ALL 
Sbjct: 252 NIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLR 311

Query: 330 HDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGI 389
           H++  +  P  E     ++ A+Q IRDAFCQVPNYEIVIN+CL HGI  L K+C L PGI
Sbjct: 312 HEQGLDVEPSDE----AVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGI 367

Query: 390 PLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERY 449
           PLKPMLAKPTKAI EVLDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERY
Sbjct: 368 PLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERY 427

Query: 450 PEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLF 509
           PEI I DF+ D  ST++LILDCEAVAWDKEQ KILPFQ+LSTRKRKDV+  DVKV+VCLF
Sbjct: 428 PEIDIRDFLSD-PSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLF 486

Query: 510 AFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNS 569
           AFD+LC+N E LINKSLRER++ L KVTK V GEF+YA ++IT N++ELQ FLD+SV +S
Sbjct: 487 AFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDS 546

Query: 570 CEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXX 629
           CEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               
Sbjct: 547 CEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGG 606

Query: 630 FLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFE 689
           FLLGCYNQDTGE+ETCCKIGTGFS+E+LQ L++RL PT ++ P A +V+D++ +PDVWFE
Sbjct: 607 FLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFE 666

Query: 690 PTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYEN 749
           PT LFEVL ADLSLSP+YKAGSA +DKG+SLRFPRFLRIR+DK VE+ATSS+Q+++LYE 
Sbjct: 667 PTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEA 726

Query: 750 QSHV 753
           Q+H+
Sbjct: 727 QAHL 730

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/733 (64%), Positives = 553/733 (75%), Gaps = 38/733 (5%)

Query: 32  AGKKPKQATLARFFSSMKNEPSGSSSSPEKAPKHKLENNIDN-----NSSEGADATKKLK 86
            G   KQATLARFFSSM              PK K++++        N  + +D +KK+K
Sbjct: 23  GGGAKKQATLARFFSSM--------------PKRKIDDDSSTDSTTINKDDDSDTSKKIK 68

Query: 87  QVSTVQTLVAPSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSNDNDHYSSNI 146
               + +   P+T                 +  S +    TP   K PS+     + S +
Sbjct: 69  ----LNSDETPTT-----SAGSVTSKDEPSLTSSPQKPIVTPA--KVPSNTKPVKFFSTV 117

Query: 147 PYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXX 206
           PY+++CEVF ++E+ SSRL II+ICSDF IK+M Q  +NL+P TYLFIN+LGPDY     
Sbjct: 118 PYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLE 177

Query: 207 XXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFK 266
                   MKTISESCGKSM Q+K +Y+E+GDLG+IA  ARNVQPTMFKPK LTVGEVF+
Sbjct: 178 LGLGEGLLMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQ 237

Query: 267 NLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKA 326
           NL+ IA++QGKDSQ RKM+LIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLSKA
Sbjct: 238 NLKDIAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKA 297

Query: 327 LLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLR 386
           LLL++      P     M+++E+A+++IRDAFCQVPNYEI+I SCLN GIM LD  C LR
Sbjct: 298 LLLNEYETSKDPS----MELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLR 353

Query: 387 PGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMT 446
           PGIPLKPMLAKPTKAINEVLD FQGE FT EYKYDGER QVHLL++G MRIYSRNGENMT
Sbjct: 354 PGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMT 413

Query: 447 ERYPEIKITDF-IQDLNSTK---NLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDV 502
           ERYPE+ I DF ++D ++T    +LILDCE VAWD EQ KILPFQ+LSTRKRK VEL DV
Sbjct: 414 ERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDV 473

Query: 503 KVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFL 562
           KV+VCLFAFDIL YN E LI K+LRERR+ L +VTK VPGEFQYAT +IT  LDE+QKFL
Sbjct: 474 KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFL 533

Query: 563 DESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXX 622
           D+++ +SCEGLMVK+LDG ES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+        
Sbjct: 534 DQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGK 593

Query: 623 XXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASA 682
                  FLLGCYNQD+GE+ETCCKIGTGFSDEML  L+E      I+ PK+ + FD+SA
Sbjct: 594 RTGTYGGFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSA 653

Query: 683 EPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQ 742
           EPD+WFEP  LFEVLTADLSLSPIYKAGSAT+DKG+SLRFPRFLRIR+DK VEDATSSDQ
Sbjct: 654 EPDIWFEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQ 713

Query: 743 IIELYENQSHVQN 755
           IIE+YENQSH+Q+
Sbjct: 714 IIEMYENQSHIQS 726

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/613 (69%), Positives = 512/613 (83%), Gaps = 5/613 (0%)

Query: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDY 201
           + S IPYS+VC +F++IE+ SSRL I++ICS+FF  ++ Q+  NL+P TYLFINRLGPDY
Sbjct: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144

Query: 202 XXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTV 261
                        MKTI+ESCGKS+ Q++ KY+E+GDLGE+A  AR VQPTMFKPK LTV
Sbjct: 145 EPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204

Query: 262 GEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321
           GEVF NL++IAK+QGKDSQ RK++LIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264

Query: 322 SLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDK 381
           SLSKALL ++ + E  P  E+    +E+A+QR+RDAFCQVPNYEIVIN+CL HGIM ++K
Sbjct: 265 SLSKALLSYEHDGEE-PSSEL----VENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNK 319

Query: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441
           +C L+PGIPLKPMLAKP+K+I EVLDRF GE FT EYKYDGERAQVHLL DG+M IYSRN
Sbjct: 320 HCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRN 379

Query: 442 GENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHD 501
           GENMTERYPE+ I D++ D  +T +LILDCEAVAWD EQ KILPFQILSTRKRK VE  D
Sbjct: 380 GENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKD 439

Query: 502 VKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKF 561
           VKV+VCLFAFD+LCYN + LIN SL ERRE+L +V K V G+FQ+A ++ ++NL+++QK+
Sbjct: 440 VKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKY 499

Query: 562 LDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 621
           L++SV ++CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL       
Sbjct: 500 LEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRG 559

Query: 622 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDAS 681
                   FLLGCYNQDTGEFETCCKIGTGFSDEML  L+E+L P+ ++ PKA +V+D+S
Sbjct: 560 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSS 619

Query: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741
           AEPDVWFEPT LFEVLTADLSLSPIYKAG++ + KG+SLRFPRF+RIR+DK VEDATSS+
Sbjct: 620 AEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSE 679

Query: 742 QIIELYENQSHVQ 754
           QI+ELYE+Q ++Q
Sbjct: 680 QIVELYESQVNLQ 692

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/717 (61%), Positives = 535/717 (74%), Gaps = 16/717 (2%)

Query: 37  KQATLARFFSSMKNEPSGSSSSPEKAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVA 96
           KQATLA+FFSS K          E A K +L N ID        +   + + +  +TL  
Sbjct: 14  KQATLAKFFSSKKRSNDEKEGPQESAKKSQL-NAIDAKPESSKGSQPNVDETNH-ETLQK 71

Query: 97  PSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFN 156
           P                   V+ S         V K   S   D   SN+ YSE+C VFN
Sbjct: 72  PQLSAAEPKTEFAMNPAKLAVEKSHGD------VAKIGISAPKD---SNVMYSEMCSVFN 122

Query: 157 KIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMK 216
           +IE  SSRL+I+++CSDF   ++ ++ K+L+P TYL IN+LGPDY             MK
Sbjct: 123 EIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLLMK 182

Query: 217 TISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQG 276
           TISESCGKS+ Q+K +Y+E+GDLG IA  AR+VQPTMFKPK LT G VF NL+ IA+ QG
Sbjct: 183 TISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQG 242

Query: 277 KDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENKEN 336
           KDSQLRK++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L H+     
Sbjct: 243 KDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHG--- 299

Query: 337 SPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLA 396
              KE   D++++A+Q+IRDAFCQVPNYEIVIN+ L HGIM L+K+C L PGIPLKPMLA
Sbjct: 300 --GKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLA 357

Query: 397 KPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITD 456
           KP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI I+D
Sbjct: 358 KPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISD 417

Query: 457 FIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCY 516
           F+   + T  LILDCEAVAWDK++  ILPFQ+LSTRKRK V   DVKV+VCLFAFDILCY
Sbjct: 418 FVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCY 477

Query: 517 NDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVK 576
           NDE LINKSL ERR +L ++ K VPGE Q A+++ T +LDE+Q +LD+SV + CEGLMVK
Sbjct: 478 NDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVK 537

Query: 577 MLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYN 636
           +LDG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYN
Sbjct: 538 VLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYN 597

Query: 637 QDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEV 696
           QDTGEFETCCKIGTGFSDEMLQ L+E+L+PT I  PKA +V+  SA+PDVW EP+ LFEV
Sbjct: 598 QDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEV 657

Query: 697 LTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHV 753
           LTADLSLSP+YKAG +++ KG+SLRFPRF+RIR+DK VEDATSS+Q+IE YE+QSH+
Sbjct: 658 LTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/720 (60%), Positives = 532/720 (73%), Gaps = 14/720 (1%)

Query: 37  KQATLARFFSSMKNEPSGSSSSPEKA--PKHKLENNIDNNSSEGADATKKLKQVSTVQTL 94
           KQATLA+FFSS K      S   EK+  P  KL ++     S    ++  L   S+    
Sbjct: 14  KQATLAKFFSSKKR-----SVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLATGSSDAGS 68

Query: 95  VAPSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSS-NDNDHYSSNIPYSEVCE 153
           V   T                  D  + ++      + +P+    +    S I Y+E+C 
Sbjct: 69  VKVETSATSTGENTKAGTPTLP-DSDEPAKRAVAATKGDPAKLGASAPKDSKILYAEMCN 127

Query: 154 VFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXX 213
           VFN+IE  SSRL+I+++C DF   ++ ++ K+++P TYL IN+LGPDY            
Sbjct: 128 VFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPGLELGLGEGL 187

Query: 214 XMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAK 273
            MKTISESCGKS+ QIK +Y+E+GDLG IA  AR VQPTMFKPK LT GEVF NL+ IA+
Sbjct: 188 LMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIAR 247

Query: 274 TQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN 333
           +QGKDSQLRK++LIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL++LSKALL ++ N
Sbjct: 248 SQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEHN 307

Query: 334 KENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKP 393
                 KE   +++++A+Q+IRDAFCQVPNY+IVI + L HGIM LDK+C L PGIPLKP
Sbjct: 308 -----GKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKP 362

Query: 394 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIK 453
           MLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI+
Sbjct: 363 MLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIR 422

Query: 454 ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDI 513
           I+DFI D   T  LILDCEAVAWDKE+  ILPFQ+LSTRKRK V + DVKV+VCLFAFDI
Sbjct: 423 ISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDI 482

Query: 514 LCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGL 573
           LCYNDE LI + L ERR  L +    VPGE Q A+++ T +LDELQ +LD++V + CEGL
Sbjct: 483 LCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGL 542

Query: 574 MVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 633
           MVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLG
Sbjct: 543 MVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 602

Query: 634 CYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTL 693
           CYNQD+GE+ETCCKIGTGFS+EMLQ L +RL+PT I  PKA +V   SA PDVWFEPT L
Sbjct: 603 CYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLL 662

Query: 694 FEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHV 753
           FEVLTADLSLSP+YKAG++++ KG+SLRFPRF+R+R+DK  E+ATSS+Q++E YE+QSHV
Sbjct: 663 FEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/739 (59%), Positives = 530/739 (71%), Gaps = 68/739 (9%)

Query: 37  KQATLARFFSSM--KNEPSGSSSSPEKAPKHKLENNIDNNSSEGADATKKLKQVSTVQTL 94
           KQATLARFF+SM  K  P+   ++ +++P    EN++D          K+  +V   Q++
Sbjct: 46  KQATLARFFTSMGKKTPPAVEVATKQESP----ENHVDK---------KRKVEVHPSQSV 92

Query: 95  VAPSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEV 154
            A                                    E + +  D   S + YSEVC +
Sbjct: 93  GA-----------------------------------SEKAESPPDQTKSTVLYSEVCNL 117

Query: 155 FNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXX 214
           F +IE  SSRL II++CS+FFI+++  +  ++I   YLFINRLGPDY             
Sbjct: 118 FQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLL 177

Query: 215 MKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKT 274
           +KTISE+ GKS+ QIKL+ KE GDLG IA  ARN+QPTMFKPK LT+ +VF NL+ IA  
Sbjct: 178 IKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASA 237

Query: 275 QGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENK 334
            GKDSQLRK+KLIK+ML+A +G+EAKFLIRSLESKLRIGLAEKTVLISLSKALLLH+  K
Sbjct: 238 TGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWK 297

Query: 335 ENSPDK-----EIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGI 389
           E    K        MD++E A+ ++R+A CQVPNYEIVIN CL  GI+N+DK CTLRPGI
Sbjct: 298 EKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGI 357

Query: 390 PLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERY 449
           PLKPMLAKPTKAI EVL+ FQG+ F SEYKYDGERAQVHLL  G MRIYSRNGENMTERY
Sbjct: 358 PLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERY 417

Query: 450 PEIKITDFI-------------QDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKD 496
           PE+ + DF+               +   K++ILDCE VAWD EQKKILPFQ+L+TRKRK+
Sbjct: 418 PELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKN 477

Query: 497 VELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLD 556
           V+L DVKV+VCLFAFD+L  N+E +INKSLRER+E L KVT +VPGEFQYAT +IT+++D
Sbjct: 478 VDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMD 537

Query: 557 ELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXX 616
           ELQ FLD++V NSCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDL V+  
Sbjct: 538 ELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGA 597

Query: 617 XXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATF 676
                        FLLGCYN+DT EFETCCKIGTGFSDEML  LH  L PT ID P  T+
Sbjct: 598 YFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTY 657

Query: 677 VFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVED 736
           ++D+SAEPDVWF+   LFEVLTADLSLSP+YKAG++ +DKG+SLRFPRFLRIREDK V D
Sbjct: 658 IYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTD 717

Query: 737 ATSSDQIIELYENQSHVQN 755
            T+S+ IIE YE+QSH+QN
Sbjct: 718 GTTSEDIIEFYESQSHIQN 736

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/613 (65%), Positives = 481/613 (78%), Gaps = 5/613 (0%)

Query: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDY 201
           + SNIP++E+C+ F  IE  SSRL I  ICS F   ++ +  ++L+P TYLFI++LGPDY
Sbjct: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDY 152

Query: 202 XXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTV 261
                        +KTISE+CGKS+ QI+ KY+E+GDLGEIAM ARNVQPTMFKPK LTV
Sbjct: 153 EPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212

Query: 262 GEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321
           GEVF NL +IAK+ GKDSQ RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLI 272

Query: 322 SLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDK 381
           S+SKA+L H+ N +     E   +++E A+  IRDAFCQVPNYE++IN  L +GIMNL++
Sbjct: 273 SVSKAILTHEHNGQ-----EPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327

Query: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441
           +  LRPGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRN
Sbjct: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387

Query: 442 GENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHD 501
           GE+MTERYPEI +  +++DL +TK+ I+D EAVAWD+EQ KILPFQ+LSTRKRK VEL D
Sbjct: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447

Query: 502 VKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKF 561
           VKV+VCL+AFDILC NDE LINKS  ERR+ L        G+F +A ++ T N DELQK+
Sbjct: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507

Query: 562 LDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 621
           LD+SV +SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRG 567

Query: 622 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDAS 681
                   FLLGCYN D+ EFETCCKIGTGFSDEMLQ L+ +L  T ++ P    ++D+S
Sbjct: 568 KRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627

Query: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741
           A  DVWFEP+ LFEVLTADLSLSP+YKAG   F KG+SLRFPRF+RIR+DK V DATSSD
Sbjct: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687

Query: 742 QIIELYENQSHVQ 754
           Q+IE YE+Q+H++
Sbjct: 688 QVIEFYESQAHMK 700

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/717 (56%), Positives = 505/717 (70%), Gaps = 29/717 (4%)

Query: 37  KQATLARFFSSMKNEPSGSSSSPEKAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVA 96
           KQATL RFF+++K    G++                      A AT K  +V   + L A
Sbjct: 6   KQATLGRFFTALKRPQDGAT----------------------AAATVKKSKVEAAECLAA 43

Query: 97  PSTMGXXXXXXXXXXXXXXGVDVSQESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFN 156
           P+                          +    V +  SS      S+++ Y+++C VF 
Sbjct: 44  PAGHEQDAEVKNSLPELADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFE 103

Query: 157 KIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMK 216
            +EA SSRL I ++C+DF   ++     +LIP TYLFINRLGPDY             +K
Sbjct: 104 AVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIK 163

Query: 217 TISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQG 276
           TIS++CGKS +Q++  Y+E GDLG +A  AR VQPTMFKPK LTV +VF  L+ IA+ +G
Sbjct: 164 TISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEG 223

Query: 277 KDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHD-ENKE 335
           KDSQ +K++LIK+MLTACQG+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L H+ + KE
Sbjct: 224 KDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKE 283

Query: 336 NSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPML 395
            SP++      +++A+  +RD FCQVPNYE++IN+ L +GIMNL ++C L PGIPLKPML
Sbjct: 284 PSPEQ------VDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPML 337

Query: 396 AKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKIT 455
           AKPTK+I EVLDRFQG+ FT EYKYDGERAQVHL+ DGT+RIYSRN ENMTERYPEI+  
Sbjct: 338 AKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFH 397

Query: 456 DFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILC 515
            F+ +  +T++LI+DCEAVAWD E++KILPFQ+LSTRKRK VEL DVKV+VCLFAFD+L 
Sbjct: 398 QFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLY 457

Query: 516 YNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMV 575
            N E L+  SL +RR+HL  V KVVPGE Q+A +I T  L ELQ +L++SV+ SCEGLMV
Sbjct: 458 LNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMV 517

Query: 576 KMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCY 635
           KMLDG ES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL               FLLGCY
Sbjct: 518 KMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCY 577

Query: 636 NQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFE 695
           N D  EFETCCKIGTGFS+E+LQ LH +L  T+I  P+    +D S+ PDVWFEP  LFE
Sbjct: 578 NPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFE 637

Query: 696 VLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSH 752
           VLTADLSLSP+YKAG   + KG+SLRFPRFLRIREDK V DATSSDQI+E Y+ Q++
Sbjct: 638 VLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/615 (61%), Positives = 477/615 (77%), Gaps = 8/615 (1%)

Query: 143 SSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYX 202
           +S++PY+++C++F  IE+ SSRL I  +C+ FF + +      L+P TYL IN+LGPDY 
Sbjct: 112 TSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLGPDYS 171

Query: 203 XXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPT--MFKPKALT 260
                       +K I  +CG S  Q+KL+Y+++GDLG++AM  R +QPT  MFK + LT
Sbjct: 172 GVELGLGEGLL-LKAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKLEPLT 230

Query: 261 VGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVL 320
           + +VF  L  IA +QGKDSQ +K+ +IKR+LT+CQGVEAKFLIRSLESKLRIGLAEKTVL
Sbjct: 231 ITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAEKTVL 290

Query: 321 ISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLD 380
            SL++AL++H++  +N  D     D   +A+Q I+D+FCQ+PNYEI+I + L +G+  L 
Sbjct: 291 TSLARALVIHEKGNDNIQD-----DDYSNAEQIIKDSFCQIPNYEIIITTSLQYGVSQLA 345

Query: 381 KYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSR 440
            +  L PGIPLKPMLAKPTK+I+EVLD FQ   FTSEYKYDGERAQVHLL DG+MRIYSR
Sbjct: 346 SHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGSMRIYSR 405

Query: 441 NGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELH 500
           NGE+MT+RYPE+ I D++ D  +T  LILDCEAVAWD E +KILPFQ+LSTRKRK V+L 
Sbjct: 406 NGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLK 465

Query: 501 DVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQK 560
           D+KV+VCLFAFDIL +N++ LIN +LRERR+ L  +TK  PG+FQ+AT++ T+NLDELQ 
Sbjct: 466 DIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQT 525

Query: 561 FLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXX 620
           FLD+++ +SCEGLMVK LDG +SHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL      
Sbjct: 526 FLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGR 585

Query: 621 XXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDA 680
                    FLL CYNQDT EFETCCKIGTGFSDEMLQ L+  L  T I+ P+A FVFD+
Sbjct: 586 GKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDS 645

Query: 681 SAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSS 740
           SAEPDVWF PT +FEVLTADLSLSPIYKAGS  + KG+SLRFPRF+RIR DK V DATSS
Sbjct: 646 SAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSS 705

Query: 741 DQIIELYENQSHVQN 755
           +Q+I+ YENQSH+Q+
Sbjct: 706 EQVIDFYENQSHLQS 720

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  106 bits (264), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 120/232 (51%), Gaps = 11/232 (4%)

Query: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 449
            +P LAK      EVL R     FT E K DGER Q+H ++ G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 450 PEIK----ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVK 505
            + K    I+ ++Q     K  ILD E V++DK +  ILPF ++ +     +++  ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 506 VC---LFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFL 562
           +C      FD+L  N   L N  L +R+E+L+ +        +     I ++ + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 563 DESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
             +++   EG+++K  D   S Y    R+ +W+K+K +YLE  G++LDL V+
Sbjct: 444 QAAISVGSEGIVLKKYD---SLYSVGDRNNDWIKVKPEYLEQFGENLDLIVI 492

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 104/405 (25%), Positives = 169/405 (41%), Gaps = 66/405 (16%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
           ++R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 443 ENMTERYPE----IKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVE 498
            N T  Y E      I++ ++ +   K  ILD E V++DKE + ILPF +  +     V 
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 499 L----HDVKVKVCLFA-FDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITN 553
                H       L+A FD+L  N + L N+ + +R+E+L K+           +    +
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 554 NLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613
           + + +   L  +V +  EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523

Query: 614 LXXXXXXXXXXXXXXXFLLGCYNQDTGE----------------------------FETC 645
           +               F+      D  E                            F + 
Sbjct: 524 I------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISF 577

Query: 646 CKIGTGFSDEMLQLLHERLT-----PTIIDGPKATFVFDASAEPDVWFEP--TTLFEVLT 698
           C I  G S+E  + + +RLT     P     P   +V   +  P  W +P  + + EV  
Sbjct: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636

Query: 699 ADL----SLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATS 739
             +    S S +YK GS  ++           RIR DK    A++
Sbjct: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 119/244 (48%), Gaps = 21/244 (8%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
           T++ G    P LAK      E + R     F  E K DGER QVH +N G ++R YSR G
Sbjct: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306

Query: 443 ENMTERY----PEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQI--------LS 490
            + T  Y        I+  +   ++ +  +LD E V +D  +K ILPF +        LS
Sbjct: 307 IDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALS 366

Query: 491 TRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQI 550
                +V+ H + V      FD+L  N   L    L +R+E+L  +   V    +     
Sbjct: 367 FNSINNVDFHPLYV-----VFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTS 421

Query: 551 ITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLD 610
              N++ ++K L+ +++   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LD
Sbjct: 422 RCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLD 478

Query: 611 LCVL 614
           L ++
Sbjct: 479 LVII 482

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 121/240 (50%), Gaps = 13/240 (5%)

Query: 384 TLRPGIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRN 441
           +++ G    P LAK    + + + +R   + F  E K DGER Q+H +N G T++ +SR+
Sbjct: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326

Query: 442 GENMTERYPEIK----ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDV 497
           G + T  Y   K    I  F++   + K  +LD E V +D   KK+LPF ++ +     +
Sbjct: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386

Query: 498 ELHDV---KVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNN 554
              D+           FDIL  N   LI+  L +R+E L  V        +  + I   +
Sbjct: 387 NKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTD 446

Query: 555 LDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
             +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL V+
Sbjct: 447 SIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 122/239 (51%), Gaps = 11/239 (4%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNG 442
           TL+ G    P LAK      E + +  G  F+ E K DGER Q+H ++ G  ++  SR G
Sbjct: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307

Query: 443 ENMTERY----PEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVE 498
            + T  Y        I  +++   + K  ILD E V +D+E++ ILPF ++ +  +  + 
Sbjct: 308 TDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLS 367

Query: 499 LHDVK---VKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNL 555
              +          AFD++  N   L++  L +R+++L+K+     G     +    NNL
Sbjct: 368 KESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNL 427

Query: 556 DELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           + + K L  +++   EG+++K L+   S Y  + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 428 ESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDLIII 483

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 135/288 (46%), Gaps = 31/288 (10%)

Query: 338 PDKEIPMDV---LESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPM 394
           PD +  + V   LE+  +R+ D   ++ N ++ IN                  G+   P 
Sbjct: 230 PDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKINI-----------------GLAFAPQ 272

Query: 395 LAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPEI- 452
           LA       + +    G  F  E K DGER Q+H  N G+ ++ YSR   + T  Y    
Sbjct: 273 LATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYTYLYGNNL 332

Query: 453 ---KITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVK---V 506
               + +FI    + K+ +LDCE V +D   K +LPF ++ +  +  +    +  +    
Sbjct: 333 KTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGIDTQGFHP 392

Query: 507 CLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESV 566
            L  FD+L  N   L++    +RRE+L ++        +    I  N+   ++K L++++
Sbjct: 393 LLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIKKSLEKAL 452

Query: 567 NNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           +   EG+++K  D   S Y  + RS +W+K+K +YLE  G+++DL ++
Sbjct: 453 SVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLM 497

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 132/268 (49%), Gaps = 11/268 (4%)

Query: 355 RDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414
           +D    + + ++V +   +  +   D   +++ G    P LAK      E + R   + F
Sbjct: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277

Query: 415 TSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY----PEIKITDFIQDLNSTKNLIL 469
             E K DGER QVH +N G +++ +SR G + T  Y        I+  ++  +S K  +L
Sbjct: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337

Query: 470 DCEAVAWDKEQKKILPFQILSTRKRKDVE---LHDVKVKVCLFAFDILCYNDERLINKSL 526
           D E V +D +++ ILPF ++    ++ +    +++V        FD+L  N   L    L
Sbjct: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397

Query: 527 RERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYE 586
            +R+++L  +   +    +         ++ ++K L+ +++   EG+++K  +   S Y 
Sbjct: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454

Query: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            + R+ NW+K+K +YLE  G++LDL V+
Sbjct: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI 482

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/277 (28%), Positives = 129/277 (46%), Gaps = 30/277 (10%)

Query: 347 LESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVL 406
           L +   R+ D   ++ N ++VIN                 PG    P LAK      E +
Sbjct: 235 LRTVTTRLWDPEIRLQNNDLVIN-----------------PGFAFAPQLAKKLSISYEKI 277

Query: 407 DRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERYPEIKITDFIQD---LN 462
                  F  E K DGER Q+H  + G  ++ +SR G + T  Y E     FI     LN
Sbjct: 278 CMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLN 337

Query: 463 -STKNLILDCEAVAWDKEQKKILPFQILSTRKR----KDVELHDVKVKVCLFAFDILCYN 517
              K+ ILD E + +DK Q  ILPF ++ +  R    KD  +++   +     FD++  N
Sbjct: 338 KDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMNE-GYQPLFMVFDLIFMN 396

Query: 518 DERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKM 577
              L N  L  R+E+L  +    P   +  +     N D ++K L+ +++   EG+++K 
Sbjct: 397 GTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKR 456

Query: 578 LDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            D   S Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 457 YD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 118/239 (49%), Gaps = 11/239 (4%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
           +++ G    P LAK      E + R     F  E K DGER QVH +N G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 443 ENMTERY----PEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVE 498
            + T  Y        I+ +++  N+ K  +LD E V +D  +K ILPF ++    +  + 
Sbjct: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366

Query: 499 LHDVK---VKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNL 555
             D+     +     FD+L  N+  L    L +R+++L+ +        +        ++
Sbjct: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426

Query: 556 DELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
             ++  L+ +++   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 427 QSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII 482

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 107/435 (24%), Positives = 183/435 (42%), Gaps = 53/435 (12%)

Query: 355 RDAFCQVPNYEIVINSCLN--HGIMNLDKYCTLRPGIPLKPMLAKPTK-AINEVLDRFQG 411
           RD    V + + V +   +  H + N D    L  G+P  P LAK    + ++V  R + 
Sbjct: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277

Query: 412 ETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERYPEI----KITDFIQDLNSTKN 466
           + +  E K DGER Q+H ++ G  ++ +SR G + T  Y E      +  ++Q     + 
Sbjct: 278 DFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336

Query: 467 LILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDV---KVKVCLFAFDILCYNDERLIN 523
            +LD E +++D E+  +LPF ++ +  R  +    +     +      D L  N   LIN
Sbjct: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396

Query: 524 KSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPES 583
             L  R+++L+ +    P   +    +   +   ++  L++++    EG+++K     +S
Sbjct: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHF---KS 453

Query: 584 HYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG---------- 633
            YE   R+ NW+K+K +YLE  G++LDL V+                L G          
Sbjct: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513

Query: 634 -CYNQDTGE----------FETCCKIGTGFSDEMLQLLHERLTP-----TIIDGPKATFV 677
              N D+ E          F + C I  G S E  + + ER T      T    P     
Sbjct: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQI-ERKTAGKWKNTEDHKPPKILE 572

Query: 678 FDASAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVE 735
           F  S  P+ W  P  + + EV    L  +   ++    F  G +L      RIREDK   
Sbjct: 573 F-GSKLPEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK--- 625

Query: 736 DATSSDQIIELYENQ 750
           + T    + EL++ +
Sbjct: 626 NWTECYTLYELWQER 640

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 159/372 (42%), Gaps = 35/372 (9%)

Query: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 449
            +P LAK T    E +       F  E K DGER Q+H +N G  ++  SR G + +  Y
Sbjct: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306

Query: 450 PEIK----ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDV--ELHDV- 502
            E      I+  ++   + K+ ILD E + +D E+  +LPF ++ +     +  EL  + 
Sbjct: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366

Query: 503 ---KVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQ 559
                K    AFD++  N + L N +L  R+++L K+   V    +    +   N + ++
Sbjct: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426

Query: 560 KFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
             L+++++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++     
Sbjct: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII----- 478

Query: 620 XXXXXXXXXXFLLGCYNQDTGE------FETCCKIGTGFSDEMLQLLHERLTPTII---- 669
                     F  G    D  E      F + C I  G S+E  + +  +          
Sbjct: 479 -GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSE 537

Query: 670 DGPKATFVFDASAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLR 727
           D P    +   +  P  W  P  + + EV    +      ++    +  G +L F    +
Sbjct: 538 DPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQ 594

Query: 728 IREDKGVEDATS 739
           IR DK  +   S
Sbjct: 595 IRYDKDWKTVAS 606

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/417 (24%), Positives = 177/417 (42%), Gaps = 70/417 (16%)

Query: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442
           +++ G    P LAK      E +       F  E K DGER QVH +N G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 443 ENMTERYP----EIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVE 498
            + T  Y        I+ +++  +S K  +LD E V +D  +K ILPF ++    ++ + 
Sbjct: 307 IDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALS 366

Query: 499 LHDVK---VKVCLFAFDILCYNDERLINKSLRERREHLAKV---TKVVPGEFQYATQIIT 552
            +D+           FD+L  N   L    L +R+E+L+ +   +K V    +Y+     
Sbjct: 367 FNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR---C 423

Query: 553 NNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLC 612
            + + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL 
Sbjct: 424 YDAESVKKSLEVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 613 VLXXXXXXXXXXXXXXXFLLGCY---NQDTGEFE-------------------------- 643
           ++               F+LG      Q+TG+ +                          
Sbjct: 481 II------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRK 534

Query: 644 --TCCKIGTGFSDEMLQLL------HERLTPTIIDGPKATFVFDASAEPDVWFEP--TTL 693
             + C I  G S E  + +      H + T  +   P  + +   S  P  W EP  + +
Sbjct: 535 VLSFCSIANGISQEEFKEIDRKTRGHWKKTSGL--SPPPSILEFGSKLPAEWIEPSESIV 592

Query: 694 FEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQ 750
            E+ +  L  +       AT     +L      RIR DK   D T    + ELYEN+
Sbjct: 593 LEIKSRSLDNTETNMQKYAT---NCTLYGGYCRRIRYDK---DWTECYTLDELYENR 643

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 93/409 (22%), Positives = 167/409 (40%), Gaps = 55/409 (13%)

Query: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446
           G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 447 ERYPE----IKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDV 502
           + Y E      + +++   ++ ++ +LD E + +D ++  +LPF ++ +  R+ +    +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 503 ---KVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQ 559
                +  L   D++  N   LI   L +R+E L +V K  P   +    +  +    ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 560 KFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
           K L++S++   EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL ++     
Sbjct: 448 KSLEKSISMGSEGIVLKSY---KARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 620 XXXXXXXXXXFLLGCYNQDTGEFE------------------------------TCCKIG 649
                        G   +D  E E                              + C I 
Sbjct: 505 KKDSLMCGLAVYEG--EEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562

Query: 650 TGFSDEMLQLLHERLTPTIIDG----PKATFVFDASAEPDVWFEP--TTLFEVLTADLSL 703
            G S +  + +  +     +      P A  +   S  P+ W +P  + + EV    L  
Sbjct: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622

Query: 704 SPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSH 752
           +   ++    F  G +L      RIR+DK   D T      EL++ + H
Sbjct: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 117/237 (49%), Gaps = 13/237 (5%)

Query: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446
           G    P LAK      E +       F  E K DGER Q+H +N G+ ++  SR G + +
Sbjct: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321

Query: 447 ERY-PEIK---ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDV 502
             Y  E+    I+ +++  +  ++ +LD E V++DK++K ILPF I+ +    ++   +V
Sbjct: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381

Query: 503 K-----VKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDE 557
                  +     FD++  N   L    L  R+E+L ++   VP   +    I   +   
Sbjct: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441

Query: 558 LQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           ++ F+  ++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V+
Sbjct: 442 IKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI 495

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 124/259 (47%), Gaps = 14/259 (5%)

Query: 367 VINSCLNHGIMNLDKY-CTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERA 425
           V++  L +  M L K   ++  G    P LAK      E +     + F  E K DGER 
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 426 QVHLLNDGT-MRIYSRNGENMTERYPEI----KITDFIQDLNSTKNLILDCEAVAWDKEQ 480
           Q+H +  G  +R  SR G + T  Y +      I+  ++  N  ++ +LD E V++DKE+
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 481 KKILPFQILSTRKRKDVELHDVKV-----KVCLFAFDILCYNDERLINKSLRERREHLAK 535
             +LPF I+ +   +++   D KV     +     FD++  N   L    L  R+ +L  
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 536 VTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWL 595
           +   V    +  + +  +  + ++  L+ ++    EG+++K    P   YE   R+ +W+
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSWI 490

Query: 596 KLKKDYLEGVGDSLDLCVL 614
           K+K +Y E +G+++DL V+
Sbjct: 491 KIKPEYFEELGETMDLVVI 509

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 113/224 (50%), Gaps = 12/224 (5%)

Query: 399 TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPEIK---- 453
           T + + +  R + + F  E K DGER Q+H +N G  ++  SR G + +  Y + +    
Sbjct: 285 TYSYDTIARRLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 454 ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVK---VKVCLFA 510
           I  ++      K  ILD E V +D  +  ILPF ++ +   + + + D++         A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 511 FDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSC 570
           FD++  N   L    L +R+ +L K+    P   +    +  N+   ++  L++++    
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 571 EGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           EG+++K  D   S Y  +KRS +W+K+K +YLE  G+++DL V+
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 127/268 (47%), Gaps = 11/268 (4%)

Query: 355 RDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414
           +D    V + + V N   +  +   +   T+  G P  P  AK      E +       F
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 415 TSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPE-IK---ITDFIQDLNSTKNLIL 469
             E K DGER Q+H  + G  +   SR G + T  Y E IK   ++ ++   N+ +N +L
Sbjct: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353

Query: 470 DCEAVAWDKEQKKILPFQILSTRKRKDVELHDVK---VKVCLFAFDILCYNDERLINKSL 526
           D E V +DKE+  +LPF ++ +  R  +    V     +  L  FD++  N   L+N  L
Sbjct: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413

Query: 527 RERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYE 586
            +R+ +L K+        +       ++   ++  L+ +++   EG+++K  +   S Y 
Sbjct: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYT 470

Query: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 471 VASRNDDWIKVKPEYLEQFGENMDLIVI 498

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 119/236 (50%), Gaps = 13/236 (5%)

Query: 388 GIPLKPMLAKP-TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENM 445
           G    P LAK  + + +++  + + + F  E K DGER Q+H ++ G  ++  SR G + 
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309

Query: 446 TERYPEI----KITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDV---E 498
           T  Y E      I  +++     K  +LD E V +D++Q  +LPF ++ +     +   E
Sbjct: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369

Query: 499 LHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDEL 558
           +        L  FD++  N   L+   L +R+++LA V +      Q       +N + +
Sbjct: 370 ISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENII 429

Query: 559 QKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           +K L+ +++   EG+++K  +   S Y    R+ +W+K+K +YLE  G+++DL V+
Sbjct: 430 RKSLEHAISVGSEGIVLKNYN---SRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

>AFR603C Chr6 complement(1525293..1528163) [2871 bp, 956 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL090W
           (MSH2)
          Length = 956

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 19/114 (16%)

Query: 484 LPFQILSTRKRKDVELHDVKVKV-CLFAFDILCYNDERLINKSLRERREHLAKVTKVVPG 542
            P +I+   KRK  EL D+K +  CL               K L+   EH+AK ++V+  
Sbjct: 855 FPSKIVKMAKRKATELDDIKEETECL---------------KKLKCSPEHIAKGSEVLKN 899

Query: 543 EFQ-YATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWL 595
             Q +A+ +   NLD  Q+  DES+   C   +  +++  +      K  ++W+
Sbjct: 900 LLQEWASILRAENLD--QQLDDESIQELCIDKLRSLVNSSDELNSCEKNFKDWV 951

>CAGL0D06622g Chr4 complement(629323..632859) [3537 bp, 1178 aa]
           {ON} weakly similar to uniprot|P23201 Saccharomyces
           cerevisiae YLL021w SPA2 involved in cell polarity
          Length = 1178

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 16/90 (17%)

Query: 359 CQVPNYE---IVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFT 415
            Q+P +    +++ + ++H I  L  Y T  P IP+  + A    +I E+L  F     +
Sbjct: 484 LQLPEFHDQNVIVKAAVSHAITTLRYYTTYGPLIPVVTLQA----SITEILFSFCTLIKS 539

Query: 416 SEYKYDGERAQVHLLNDGTMRIYSRNGENM 445
           ++ KYDG+            R+ S N  NM
Sbjct: 540 AKIKYDGKEI---------ARLNSDNTNNM 560

>AFR049W Chr6 (517312..519465) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL144C and YHR131C
          Length = 717

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 12/115 (10%)

Query: 240 GEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEA 299
           GE+  G  +   TMF  K  + GEV ++    + T+G +S + +  L        +G EA
Sbjct: 383 GELQAGFASRLRTMFWSKKASRGEVQRSRTVHSDTKGLNSSVAESLLGPSASLGARGSEA 442

Query: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMD--VLESAQQ 352
                     LR  L+E+ V  S S +LL   E +  + + ++  D   LES +Q
Sbjct: 443 ----------LRCRLSERCVYQSASSSLLQVSEQRAAAHEDQMGSDSSSLESHRQ 487

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,531,996
Number of extensions: 3189257
Number of successful extensions: 11915
Number of sequences better than 10.0: 52
Number of HSP's gapped: 12175
Number of HSP's successfully gapped: 53
Length of query: 755
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 638
Effective length of database: 40,065,477
Effective search space: 25561774326
Effective search space used: 25561774326
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)