Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.907.349ON70748723610.0
YDL167C (NRP1)7.349ON71948719900.0
Smik_4.717.349ON75948719580.0
Suva_4.797.349ON70848718900.0
TDEL0C019907.349ON60639213271e-175
ZYRO0F11682g7.349ON59739213091e-172
SAKL0F11352g7.349ON58339212311e-161
Kwal_56.246387.349ON52739012181e-160
KLTH0H01276g7.349ON55743011731e-153
NCAS0A141507.349ON57039111601e-151
KAFR0B008707.349ON54239411101e-143
ACL149W7.349ON62838811101e-142
Kpol_530.327.349ON68441510941e-139
KLLA0D12364g7.349ON63140510821e-138
TBLA0E020607.349ON56438310631e-136
KNAG0C037807.349ON53839710301e-131
TPHA0F029607.349ON65440810131e-127
NDAI0A019007.349ON5653868971e-111
CAGL0I03344g7.349ON6034066918e-81
KLLA0B08976g3.379ON30536850.11
TDEL0A009402.52ON68231780.97
Kwal_23.45972.52ON66431761.8
KLTH0B07546g2.52ON63931752.0
TBLA0B006002.52ON73431752.1
CAGL0D05236g7.188ON44335742.6
Smik_4.162.52ON65036742.9
Suva_4.202.52ON65236743.0
YDL224C (WHI4)2.52ON64936743.3
CAGL0G05511g2.52ON67436733.5
CAGL0I04840g3.223ON106494733.5
Kpol_400.12.52ON60030733.5
ZYRO0A03784g3.234ON20855713.6
KAFR0A077002.52ON57131733.8
Kwal_56.234868.229ON587122734.2
ABL158C2.52ON72931734.2
ZYRO0C10164g2.52ON74531724.6
NDAI0H038502.52ON74231724.8
Skud_4.302.52ON65136724.8
Ecym_64412.52ON68931724.9
SAKL0D05258g1.261ON71575725.2
Ecym_13021.408ON28828706.9
SAKL0H17952g8.229ON589100708.2
KAFR0E010803.234ON20254688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.90
         (707 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   914   0.0  
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   771   0.0  
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   758   0.0  
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   732   0.0  
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   515   e-175
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   508   e-172
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   478   e-161
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   473   e-160
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   456   e-153
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   451   e-151
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   432   e-143
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   432   e-142
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   426   e-139
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   421   e-138
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   414   e-136
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   401   e-131
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   394   e-127
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   350   e-111
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   270   8e-81
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    37   0.11 
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    35   0.97 
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    34   1.8  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    33   2.0  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    33   2.1  
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    33   2.6  
Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON} Y...    33   2.9  
Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON} Y...    33   3.0  
YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}  WH...    33   3.3  
CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {...    33   3.5  
CAGL0I04840g Chr9 (434911..438105) [3195 bp, 1064 aa] {ON} some ...    33   3.5  
Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)...    33   3.5  
ZYRO0A03784g Chr1 (300789..301415) [627 bp, 208 aa] {ON} highly ...    32   3.6  
KAFR0A07700 Chr1 (1550013..1551728) [1716 bp, 571 aa] {ON} Anc_2...    33   3.8  
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    33   4.2  
ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON} S...    33   4.2  
ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some s...    32   4.6  
NDAI0H03850 Chr8 (943316..945544) [2229 bp, 742 aa] {ON} Anc_2.5...    32   4.8  
Skud_4.30 Chr4 complement(50997..52952) [1956 bp, 651 aa] {ON} Y...    32   4.8  
Ecym_6441 Chr6 (856251..858320) [2070 bp, 689 aa] {ON} similar t...    32   4.9  
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...    32   5.2  
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    32   6.9  
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    32   8.2  
KAFR0E01080 Chr5 complement(221208..221816) [609 bp, 202 aa] {ON...    31   8.7  

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/487 (91%), Positives = 446/487 (91%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD
Sbjct: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120

Query: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180
           RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE
Sbjct: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180

Query: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240
           EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT
Sbjct: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240

Query: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHEE 300
           QSELESWFTQYGVRPVGFWTVKNIVEDT            PYVEEQDSISGFVVFQTHEE
Sbjct: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTHEE 300

Query: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360
           ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD
Sbjct: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360

Query: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNIQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           WNCPSCGFSNFQRRTACFRCSFPAPSNIQMH                             
Sbjct: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNIQMHNVISNNNANSNSNILNNRMSSGSSNNNNS 420

Query: 421 AIVNHPYINTEFNMMGNTTPTALAYNRAQFSAITPLSRQNSLNLTPSSSGSPIIMADHFA 480
           AIVNHPYINTEFNMMGNTTPTALAYNRAQFSAITPLSRQNSLNLTPSSSGSPIIMADHFA
Sbjct: 421 AIVNHPYINTEFNMMGNTTPTALAYNRAQFSAITPLSRQNSLNLTPSSSGSPIIMADHFA 480

Query: 481 GTNNIVP 487
           GTNNIVP
Sbjct: 481 GTNNIVP 487

 Score =  276 bits (706), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 128/128 (100%), Positives = 128/128 (100%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDNG 639
           IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDNG
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDNG 639

Query: 640 SNRTDGKDNKGRDISLMEYVSPPLSIVKEGDGNGSSFNEFKGDKVNIDYSNGNDSSSFTN 699
           SNRTDGKDNKGRDISLMEYVSPPLSIVKEGDGNGSSFNEFKGDKVNIDYSNGNDSSSFTN
Sbjct: 640 SNRTDGKDNKGRDISLMEYVSPPLSIVKEGDGNGSSFNEFKGDKVNIDYSNGNDSSSFTN 699

Query: 700 GFNGSVRW 707
           GFNGSVRW
Sbjct: 700 GFNGSVRW 707

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387
           R GDW C +C + NF +   C RC  P   N
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 613

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 613
           R GDW C +C + NF +   C RC  P   N
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/487 (75%), Positives = 405/487 (83%), Gaps = 2/487 (0%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           MHYVVLELQVA+LPD+PKDQCRI +IA+QIV+AETL+CHY  +SLP IEV+G  KSLESA
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           M+QLDKDIHDVIGND+FVLVSL STWHIRVTL RQARDDGFILTSYLQHP++FDLWKEFD
Sbjct: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120

Query: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180
           RWCVNHPE+L Q+KA SNNN NTK+   N A  KNTKD +E++RILEVS P+E A  +PE
Sbjct: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAA--KNTKDLDEIVRILEVSIPTEEAGSVPE 178

Query: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240
             SLL+RTTDIL+QLHKKC+SPEDM+SVLT+PYDS+TDIR FLQE+SK+LYMNNLPPDTT
Sbjct: 179 IYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTT 238

Query: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHEE 300
           QSELESWFTQYGVRPVGFWTVKNIVEDT            PYVE+QDSISGFVVFQTHEE
Sbjct: 239 QSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEE 298

Query: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360
           ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD
Sbjct: 299 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 358

Query: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNIQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           WNCPSCGFSNFQRRTACFRCSFPAPSN Q+H                             
Sbjct: 359 WNCPSCGFSNFQRRTACFRCSFPAPSNSQIHTANSNNNVNSSRNNLNNRVNSGSSSNISN 418

Query: 421 AIVNHPYINTEFNMMGNTTPTALAYNRAQFSAITPLSRQNSLNLTPSSSGSPIIMADHFA 480
              NHPY   EFNM+ N TP AL YNRA F AITPLSRQNSLN+ PS+SGSPII+ADHF+
Sbjct: 419 TAANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQNSLNMAPSNSGSPIIIADHFS 478

Query: 481 GTNNIVP 487
           G NNI P
Sbjct: 479 GNNNIAP 485

 Score =  201 bits (510), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 113/142 (79%), Gaps = 14/142 (9%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDN- 638
           +PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS++ DA+ETNHYI+  T GP S   S+N 
Sbjct: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNN 637

Query: 639 -------GSN--RTDGKDNKGRDISLMEYVSPPLSI----VKEGDGNGSSFNEFKGDKVN 685
                  GSN  RTDG DNKGRDISLME++SPPLS+    +KEGDGNGSSFNEFK DK N
Sbjct: 638 ISVNTNGGSNAGRTDGNDNKGRDISLMEFMSPPLSMATKSMKEGDGNGSSFNEFKSDKAN 697

Query: 686 IDYSNGNDSSSFTNGFNGSVRW 707
           +++SN  D+S+F NGFN S+RW
Sbjct: 698 VNFSNVGDNSAFGNGFNSSIRW 719

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNA 614
           R GDW C +C + NF +   C RC  P   N+
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNS 386

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383
           R GDW C +C + NF +   C RC  P
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/487 (76%), Positives = 403/487 (82%), Gaps = 2/487 (0%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           MHYVVLELQVA+LP+SPKDQCRI +IAYQ VDAETL CHY+ +SLP IEVD E +SLE+A
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           MIQLDK I D++GNDEFVLVSL STWHIRVTL RQARDDGFILTSYLQHP+LFDLWKEFD
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180
           RWCVNHPE+LEQ K  SNNN N+   G++G LAKN KD +EMIRILE+S+ +E A  +PE
Sbjct: 121 RWCVNHPEILEQMKTASNNN-NSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVPE 179

Query: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240
           E SLLRRTTDIL+ LH+KC S EDMK VLTQPYDS+TDIRTFLQERSKVLYMNNLPPDTT
Sbjct: 180 EYSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDTT 239

Query: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHEE 300
           QSELESWFTQYGVRPVGFWTVKNIVEDT            PYVE+QDSISGFVVFQTHEE
Sbjct: 240 QSELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHEE 299

Query: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360
           ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD
Sbjct: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359

Query: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNIQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           WNCPSCGFSNFQRRTACFRCSFPAPSNIQ H                             
Sbjct: 360 WNCPSCGFSNFQRRTACFRCSFPAPSNIQTHVTSSNNVNNSWNNLNNRMNSGSSNNNNNA 419

Query: 421 AIVNHPYINTEFNMMGNTTPTALAYNRAQFSAITPLSRQNSLNLTPSSSGSPIIMADHFA 480
           + VNHPY  +E+NM+ N TP+A  YNRA +SAITPLSRQNSLN+ PS+SGSPII+ADHF 
Sbjct: 420 S-VNHPYGTSEYNMVANATPSAFTYNRAHYSAITPLSRQNSLNMVPSNSGSPIIIADHFG 478

Query: 481 GTNNIVP 487
           G NN VP
Sbjct: 479 GNNNKVP 485

 Score =  182 bits (461), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 104/142 (73%), Gaps = 14/142 (9%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDNG 639
           IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSV+ DANETNHYIE  TV   SH  S+  
Sbjct: 618 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANETNHYIEASTVVSASHTPSNKN 677

Query: 640 S----------NRTDGKDNKGRDISLMEYVSPPLSIVK----EGDGNGSSFNEFKGDKVN 685
           +          + TDGKDNK  DISLME+VS PLS+      EGDGN +SFNEFK   VN
Sbjct: 678 TVVNNNGGNNIDHTDGKDNKYHDISLMEFVSSPLSMAAKSTMEGDGNLTSFNEFKSGNVN 737

Query: 686 IDYSNGNDSSSFTNGFNGSVRW 707
           +  SNG+DS++F NGF+ SVRW
Sbjct: 738 VSLSNGDDSNAFGNGFSRSVRW 759

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 18/37 (48%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANET 619
           R GDW C +C + NF +   C RC  P   N   + T
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQTHVT 392

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383
           R GDW C +C + NF +   C RC  P
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGP 647

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/487 (75%), Positives = 395/487 (81%), Gaps = 1/487 (0%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           MHYVVLELQVA+LPDSPKDQCRI ++AYQIVDAETL  HY+  S P I+VDGE KSLESA
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           M QLDKDI  +IGND+FVLVSLCSTWHIRVTL RQARDDGFILTSYLQHPRLFDLWKEF+
Sbjct: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120

Query: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180
           RWC+NHPE++  RK   NNNSNTK+    G L KNTKD NEM+RILE+    E  DF  +
Sbjct: 121 RWCINHPEIMGLRKNILNNNSNTKSSSI-GTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179

Query: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240
             SLL+RT D+LLQLHKKCSS EDMKSVLTQPYDS+TDIR+FLQERSKVLYMNNLPPDTT
Sbjct: 180 NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTT 239

Query: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHEE 300
           QSELESWFTQYG RPVGFWTVKNIVEDT            PYVE+QDSISGFVVFQTHEE
Sbjct: 240 QSELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEE 299

Query: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360
           ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD
Sbjct: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359

Query: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNIQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           WNCPSCGFSNFQRRTACFRCSFPAPSN QMH                             
Sbjct: 360 WNCPSCGFSNFQRRTACFRCSFPAPSNSQMHNAITNNNANSNKSSLNNRANSGALNNNNN 419

Query: 421 AIVNHPYINTEFNMMGNTTPTALAYNRAQFSAITPLSRQNSLNLTPSSSGSPIIMADHFA 480
             V+HPY   E NMMG+ TPTALAYNR+QFSA+TPLSRQNSLNLTPSSSGSP+   + FA
Sbjct: 420 ITVSHPYGTPELNMMGSITPTALAYNRSQFSAMTPLSRQNSLNLTPSSSGSPVNTPNSFA 479

Query: 481 GTNNIVP 487
            +NN VP
Sbjct: 480 TSNNAVP 486

 Score =  187 bits (476), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 111/149 (74%), Gaps = 21/149 (14%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPG-------- 631
           IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNAD +ETNHYI+  T+ PG        
Sbjct: 560 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIAPGPHNHNNNS 619

Query: 632 ---------SHIHSDNGSNRTDGKDNKGRDISLMEYVSPPLSI----VKEGDGNGSSFNE 678
                    ++   +NG+N  DGKDNK  DISLME+VS PLS+    +KEGDGN +SFNE
Sbjct: 620 NNNSTVTNTNNNGGNNGNNGVDGKDNKVHDISLMEFVSTPLSMAEKSIKEGDGNANSFNE 679

Query: 679 FKGDKVNIDYSNGNDSSSFTNGFNGSVRW 707
           +K DK N+++SNGNDS++F NGFNGS RW
Sbjct: 680 YKSDKANVNFSNGNDSTAFGNGFNGSARW 708

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNA 614
           R GDW C +C + NF +   C RC  P   N+
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNS 387

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387
           R GDW C +C + NF +   C RC  P   N
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 593

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  515 bits (1327), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 243/392 (61%), Positives = 301/392 (76%), Gaps = 20/392 (5%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAK-SLES 59
           MHYVVLE++  +  ++PKD  R+  ++YQ +DAE++  +Y  D +P I +D +   S + 
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 60  AMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEF 119
           ++ + D+D+  ++G DEFVL SL STWHIRVT+ RQARD+GF+L SYLQHPR+FDLWKE+
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 120 DRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIP 179
           DRWC NHPE+L  RK+        + G       K  KD  E++++LE+ST         
Sbjct: 121 DRWCANHPEVLTLRKSC-------RTG------IKRVKDQTEILKVLEMSTEE------I 161

Query: 180 EEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDT 239
            E+ +L  T DILLQL ++C++ ED+  VL++PYDS+ DIR FLQE+SKVLY+NNLPPDT
Sbjct: 162 TEKPVLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDT 221

Query: 240 TQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHE 299
           TQSELESWFTQ+G RPVGFWTVKNIVE+T            PYVEEQDSISGFVVFQTHE
Sbjct: 222 TQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHE 281

Query: 300 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 359
           EATEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPG
Sbjct: 282 EATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPG 341

Query: 360 DWNCPSCGFSNFQRRTACFRCSFPAPSNIQMH 391
           DWNCPSCGFSNFQRRTACFRCSFPA S +Q++
Sbjct: 342 DWNCPSCGFSNFQRRTACFRCSFPAASAVQVN 373

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 28/37 (75%), Positives = 31/37 (83%)

Query: 581 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADAN 617
           PFRAGDWKC TCTYHNFAKN+VCLRCG  K   +D+N
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVSISDSN 512

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRC 380
           R GDW CP+C + NF +   C RC
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADAN 617
           R GDW C +C + NF +   C RC  P +     N
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVN 373

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  508 bits (1309), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 247/392 (63%), Positives = 301/392 (76%), Gaps = 24/392 (6%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLP-KIEVDGEAKSLES 59
           M+YVVLE++ A+L + PKDQCRI  I+YQ V+AETL  HY  +  P  I  + ++ +L  
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 60  AMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEF 119
           A+  L+++I+ + G++ FVL SL STWH+RVTLSRQARD  F L SYLQHP++FDLWKE+
Sbjct: 61  AVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKEY 120

Query: 120 DRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIP 179
           +RWCVNHPE++  RK              NG   +  KD  E+ R+L+++    G +F  
Sbjct: 121 ERWCVNHPEVMPLRK--------------NGG--RRMKDVAELARVLDIN----GLNF-- 158

Query: 180 EEQSL-LRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPD 238
            + S  L R+ +ILL+LH++CS+PEDM  VLT PYDS+ D+R FLQE SKVLY+NNLPPD
Sbjct: 159 NDSSFDLSRSVEILLRLHQRCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPD 218

Query: 239 TTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTH 298
           TTQSELESWFTQ+G RPVGFWTVKNIVE+T            PYVEEQDSISGFVVFQTH
Sbjct: 219 TTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTH 278

Query: 299 EEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRP 358
           EEATEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRP
Sbjct: 279 EEATEVLTLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRP 338

Query: 359 GDWNCPSCGFSNFQRRTACFRCSFPAPSNIQM 390
           GDWNCPSCGFSNFQRRTACFRCSFPA + +Q+
Sbjct: 339 GDWNCPSCGFSNFQRRTACFRCSFPATTAVQV 370

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 30/36 (83%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNAD 615
           +PFRAGDWKC +C YHNFAKNVVCLRCGGPK    D
Sbjct: 485 VPFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVD 520

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIH 635
           R GDW C +C + NF +   C RC  P +     N T  YI G   GP +++ 
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATTAVQVN-TKQYISG---GPAANLQ 385

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQM 390
           R GDW CPSC + NF +   C RC  P  + + +
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVDL 521

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  478 bits (1231), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 243/392 (61%), Positives = 280/392 (71%), Gaps = 30/392 (7%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           M+YVVLE +  +  + PKD  R+  I YQ + ++TL   ++      I V+     L   
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFE----QPIIVEVGPGQLREQ 56

Query: 61  MIQLDKDIHDVIGND--EFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKE 118
           + QLD+ +   I +D  EF LVSL STWHIRVT+ RQARD+GFIL  YLQHP++FDLWKE
Sbjct: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116

Query: 119 FDRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFI 178
           +DRWCVNHPE L  RK     NSN         L K ++D  E+ R+LE           
Sbjct: 117 YDRWCVNHPETLPLRK-----NSN---------LGKKSRDLPELSRVLEA---------- 152

Query: 179 PEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPD 238
           P +   L +T  IL QLHKKC  PED   VLT PYDSY D+RTFLQERSKVLYMNNLPPD
Sbjct: 153 PLQTFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPD 212

Query: 239 TTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTH 298
           TTQSELESWFTQ+G RPVGFWTVKN+VE+T             YVEEQDSISGFVVFQTH
Sbjct: 213 TTQSELESWFTQFGARPVGFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTH 272

Query: 299 EEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRP 358
           EEATE L+LNGRSILSN+ANTKQPRVVEHV+ELQPSST VLD+A E+LSPFPQSKNKPRP
Sbjct: 273 EEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRP 332

Query: 359 GDWNCPSCGFSNFQRRTACFRCSFPAPSNIQM 390
           GDWNCPSCGFSNFQRRTACFRCSFPA S + +
Sbjct: 333 GDWNCPSCGFSNFQRRTACFRCSFPATSAVNV 364

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNAD--ANETN 620
           +PFRAGDWKC +CTYHNFAKNVVCLRCGGPK+V     AN+ N
Sbjct: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQAN 539

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANET 619
           R GDW C +C + NF +   C RC  P +   + N++
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVNKS 367

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383
           R GDW C SC + NF +   C RC  P
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  473 bits (1218), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 234/390 (60%), Positives = 281/390 (72%), Gaps = 18/390 (4%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           MHYVVLE+ +A+  DSPKD  +I +  YQ +D E L   +  +    +E      SL+ A
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVLE---NGCSLQEA 57

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           + QL+KDI + +  D+FVL SL STWH RVT+ RQARD+ FIL  +LQHPR+FDLWKE+D
Sbjct: 58  VSQLEKDIGEHL-KDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEYD 116

Query: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180
           RWCVNHPE L  R++ S              + K  KD  E+  +LE+ + ++ +     
Sbjct: 117 RWCVNHPETLALRRSNS--------------MGKKVKDVAELRSVLELDSATQDSTPGAA 162

Query: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240
           E   L +T  I+ QLHKKC + ED   VLT PYDSY D+R FLQERSKVLYMNNLPPDTT
Sbjct: 163 EPDALEQTIAIIRQLHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTT 222

Query: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHEE 300
           QSELESWFTQ+G RPVGFWTVKNIVE+T             YVE QDSISGFVVFQ+HEE
Sbjct: 223 QSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEE 282

Query: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360
           ATE L+LNGRSILSN+ANTKQPRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGD
Sbjct: 283 ATEALSLNGRSILSNIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGD 342

Query: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNIQM 390
           WNCPSCGFSNFQRRT+CFRCSFP+  +  M
Sbjct: 343 WNCPSCGFSNFQRRTSCFRCSFPSTGSAPM 372

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 40/55 (72%), Gaps = 3/55 (5%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSV---NADANETNHYIEGLTVGPG 631
           +PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS       +   N Y EG  +G G
Sbjct: 452 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKGSAAVNSYAEGQDIGNG 506

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNH 621
           R GDW C +C + NF +   C RC  P + +A  N T +
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFPSTGSAPMNNTGY 377

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 389
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 487

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  456 bits (1173), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 236/430 (54%), Positives = 281/430 (65%), Gaps = 59/430 (13%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           MHYVVLE+++A+  DSPKD  +I    YQ +D ETL   ++ +   ++   G   +L+ A
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVEL---GNGCTLQDA 57

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           + QL+KDI +    D+FVL SL STWH RVT+ RQARD+ FIL  +LQHP++FDLWKE+D
Sbjct: 58  VAQLEKDISE-HAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYD 116

Query: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGA----- 175
           RWC+NHPE    R+                 L K TKD  EM  +L +    EGA     
Sbjct: 117 RWCMNHPETSAMRQ---------------NPLGKRTKDLAEMRSVLGLDGTEEGAHPDAN 161

Query: 176 ----------------------------------DFIPEEQ-SLLRRTTDILLQLHKKCS 200
                                             +  P EQ   + +   I+ QLHKKC 
Sbjct: 162 QNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCV 221

Query: 201 SPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWT 260
           + +D   VLT PYDSY D+R FLQERSKVLYMNNLPPDTTQSELESWFTQ+G RPVGFWT
Sbjct: 222 TADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWT 281

Query: 261 VKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHEEATEVLALNGRSILSNLANTK 320
           VKNIVE+T             YVE QDSISGFVVFQ+HEEATE L+LNGRSILSN+ANTK
Sbjct: 282 VKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTK 341

Query: 321 QPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRC 380
           QPRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRC
Sbjct: 342 QPRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRC 401

Query: 381 SFPAPSNIQM 390
           SFPA S   M
Sbjct: 402 SFPAASGAGM 411

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (68%), Gaps = 3/58 (5%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANE---TNHYIEGLTVGPGSHI 634
           +PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS      E    N Y +   +G G  I
Sbjct: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIGNGMGI 545

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIE 624
           R GDW C +C + NF +   C RC  P +  A  N  N Y++
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMN-NNGYMK 418

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 389
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 523

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  451 bits (1160), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 222/391 (56%), Positives = 284/391 (72%), Gaps = 18/391 (4%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPK-IEVDGEAKSLES 59
           M YVVLEL+ ++  ++PKD  RI   +YQ +++ETL   ++    PK I++   A + + 
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFE---EPKSIDIPDMANAFKD 57

Query: 60  AMIQLDKDIH-DVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKE 118
            + QL+ DI  +++   +FVL SL S W IRVTL RQA D GFIL SYL+HPR+F+LWKE
Sbjct: 58  TISQLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKE 117

Query: 119 FDRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFI 178
           FD+WC NHPE++  RK+     S   AG           D ++++ ILE+ T  +     
Sbjct: 118 FDKWCGNHPEVIPMRKSNLRVKSPKTAG-----------DISDIVNILEIDTSLQVPLST 166

Query: 179 PEEQSLL--RRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLP 236
              Q+LL  + +T+IL +L KKC++ +D++ VLT+PYDSY DI+TFLQERS+VLYMNNLP
Sbjct: 167 SNPQTLLSIQDSTNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLP 226

Query: 237 PDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQ 296
            DTTQSELESWFTQ+G RP+GFWT KN +E+T            P V+EQD ++GFVVFQ
Sbjct: 227 SDTTQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQ 286

Query: 297 THEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKP 356
           +HEEATE L LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD  Q+ILS FPQSKNKP
Sbjct: 287 SHEEATEALVLNGRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKP 346

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387
           RPGDW+CPSCGFSNFQRRTACFRCSFPAP+N
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFPAPNN 377

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 26/31 (83%), Positives = 28/31 (90%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 610
           +PFRAGDWKC +CTYHNFAKNVVCLRC  PK
Sbjct: 473 VPFRAGDWKCPSCTYHNFAKNVVCLRCRIPK 503

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383
           R GDW CPSC + NF +   C RC  P
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIP 502

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 9/56 (16%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDN 638
           R GDW C +C + NF +   C RC  P   N          +GL +   S+I S N
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFPAPNNN---------KGLNISGTSNIASTN 393

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  432 bits (1110), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 218/394 (55%), Positives = 275/394 (69%), Gaps = 16/394 (4%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLP----KIEVDGEAKS 56
           M YV+LEL   +  ++PKD  RI  + +Q+V+A  L        +P    +I +D +A+S
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL------GEVPTKVDQIVIDEQAES 54

Query: 57  LESAMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLW 116
            ++A  +L++ I  +  +  F+L SL STW IRVTL+RQARD G  +  +LQ+P++FDL 
Sbjct: 55  FKAAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLM 114

Query: 117 KEFDRWCVNHPELLEQR-KATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGA 175
           KE+ RWC+NHPE++  + K  S+   N                  +M    E    ++GA
Sbjct: 115 KEYQRWCLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKE---ENDGA 171

Query: 176 --DFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMN 233
             D + + +  +  +T +LLQL  +C++ +D K+VLT PYDS TD+R+FLQERS+VLYMN
Sbjct: 172 IDDKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMN 231

Query: 234 NLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFV 293
           NLP DTTQSELESWFTQ+G RPVGFWT KN+V DT            PYVEE DSI GFV
Sbjct: 232 NLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFV 291

Query: 294 VFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSK 353
           VFQTHEEA EVLALNGR+ILSN+ANTKQPRVVEHV+E+QPSST VLDKA EILS FPQSK
Sbjct: 292 VFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSK 351

Query: 354 NKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387
           NKPRPGDW+CPSCGFSNFQRRTACFRCSFPAPSN
Sbjct: 352 NKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPSN 385

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 48/81 (59%), Gaps = 8/81 (9%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDNG 639
           IPFRAGDW C++CTYHNFAKNV+CLRCGGPK+      + N++  G      + I     
Sbjct: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTIYQQQNNNHNHGNNNNNINVIEK--- 511

Query: 640 SNRTDGKDNKGRDISLMEYVS 660
                 KD   R + L+E+VS
Sbjct: 512 -----PKDESTRKVDLLEFVS 527

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNI 388
           R GDWNC SC + NF +   C RC  P  S I
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 3/69 (4%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADAN---ETNHYIEGLTVGPGSHIHSDNG 639
           R GDW C +C + NF +   C RC  P   N   N   + N +   +T    +     N 
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQNNSHHPEITSEHNTEGSQQNN 414

Query: 640 SNRTDGKDN 648
           +NR +   N
Sbjct: 415 TNRANASFN 423

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  432 bits (1110), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 217/388 (55%), Positives = 263/388 (67%), Gaps = 30/388 (7%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           M+YV+ E  VA+  D+PKD  R+  I YQ++    L+  Y      +IEV G    ++ A
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYA--DAREIEVGG--GGVQMA 56

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
             QL+  + +   ++ FVL SL STWH+RVTL RQA D+G +L  +L H ++FDLWKE D
Sbjct: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116

Query: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180
           RWC NH          S    N  A G          D  E+ R+L++       D    
Sbjct: 117 RWCANH---------VSERACNAGAKG----------DVAELFRVLDL-------DEQLV 150

Query: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240
             + +++ T +LLQLH KC++ ED   VLT PYDSY D+ +F+QERS+VLYMNNLPPDTT
Sbjct: 151 SHAYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTT 210

Query: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHEE 300
           QSELESWFTQ+G RPVGFWTVKN+VEDT             YVEE DSISGFVVFQ+HE 
Sbjct: 211 QSELESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEA 270

Query: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360
           A+E L LNGRSILSN+ANTKQPRVVEHV+EL+PSS+ VLD AQEILSPFPQSKNKPRPGD
Sbjct: 271 ASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGD 330

Query: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNI 388
           WNCPSCGFSNFQRR ACFRCSFPA S +
Sbjct: 331 WNCPSCGFSNFQRRIACFRCSFPATSAV 358

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 2/52 (3%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPG 631
           +PFRAGDWKC  C+YHNFAKN+VCLRCG PK+ N D  ET   ++GL    G
Sbjct: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANED--ETQASLQGLHSSSG 550

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 352 SKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387
           S N P R GDW C +C + NF +   C RC  P  +N
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611
           R GDW C +C + NF + + C RC  P +
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  426 bits (1094), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 210/415 (50%), Positives = 268/415 (64%), Gaps = 31/415 (7%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGE-AKSLES 59
           M+Y+V+E    +  ++PKD  RI  ++YQ VDAE+L C+Y  D +  I +D E A S + 
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 60  AMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEF 119
            + QLD+DI  V+G+DEFV  SL S W +RVT+ RQARD+   L  YLQ  ++FDLWKEF
Sbjct: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120

Query: 120 DRWCVNHPELL---------------------------EQRKATSNNNSNTKAGGSNGAL 152
           +RW  NH + +                           E ++   N++   +   + GA 
Sbjct: 121 NRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGAE 180

Query: 153 AKNTKDFNEMIRILEVSTPSEGADFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQP 212
                              S+     P E   + R T+IL  +HKKC++ ED+  VLT+P
Sbjct: 181 ESGNATITTAADDDNNEDDSKEMKETPLE---INRVTEILTTIHKKCTTEEDITLVLTKP 237

Query: 213 YDSYTDIRTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXX 272
           YDS +D + F +E SK+LYMNNLPPDTTQSELESWF Q+G +PV FWTVKNIVE+T    
Sbjct: 238 YDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVN 297

Query: 273 XXXXXXXXPYVEEQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQ 332
                   PYVEEQDSISGFV FQ+H+EAT+ L LNGRSILSN+ANTKQPRVVEH++E+Q
Sbjct: 298 NNWSMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQ 357

Query: 333 PSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387
           PSS  VL++ Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+PA SN
Sbjct: 358 PSSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611
           +PFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 613
           R GDW C +C + NF +   C RC  P + N
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383
           R GDW C +C + NF +   C RC  P
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  421 bits (1082), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 210/405 (51%), Positives = 268/405 (66%), Gaps = 22/405 (5%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           M YV+ E +  Y  ++PKD   I SIAYQI+  ETL   ++      I+      SL++ 
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA---THSLKNT 57

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           +  ++  + + +  +EFVL SL STW +RVTLSRQARD+ ++L S+LQHP++FDLW+E D
Sbjct: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117

Query: 121 RWCVNHPELLEQ---RKATSNNNSNTKAGGSNGALAKNTKDFNEMI------------RI 165
           RW  NHPE  E+   R   +  N+NT    +   L K+       +            R+
Sbjct: 118 RWYRNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRM 177

Query: 166 LEVSTPSEGADFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQE 225
            +V+      + +P     +++   +L +LH+ C+S  D   VLT P+DSY DI+ FL E
Sbjct: 178 EQVNIDKNSFETLPS----IQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLE 233

Query: 226 RSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEE 285
           +S VLYMNNLPPDTTQSELESWF Q+G RPVGFWTVKN+VEDT             YV+E
Sbjct: 234 KSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDE 293

Query: 286 QDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEI 345
           QDSISGFVV+Q HEEA + L LNGRSILSN++NTKQPRVVEHV+E+QPSS  VLD+AQEI
Sbjct: 294 QDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEI 353

Query: 346 LSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQM 390
           L+ FPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP  S +QM
Sbjct: 354 LTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQM 398

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 37/48 (77%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLT 627
           +PFRAGDWKC+ CTYHNFAKNVVCLRCGGPK+ N  AN  N  +   T
Sbjct: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSANSNNATVTNAT 552

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 348 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNI 388
           P     N P R GDW C +C + NF +   C RC  P  +N+
Sbjct: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANV 539

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHY 622
           R GDW C +C++ NF +   C RC  P S     +  N+Y
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNY 404

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  414 bits (1063), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 265/383 (69%), Gaps = 27/383 (7%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           M+Y ++ELQ A+  ++PKD  +I +I+YQ ++  TL   +  D +P I+      S   A
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           ++Q D +++   G D FVL SL STW +RVT+SRQA+D+ + L ++ ++PR+FDLWKEFD
Sbjct: 61  LLQKDLELNLPNGED-FVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFD 119

Query: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180
           RWCVNH EL++ R                    +  KD  ++  +L +  PS       E
Sbjct: 120 RWCVNHKELVQTRDP------------------RKLKDLKQLATLLHI--PSV------E 153

Query: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240
             S +   + +L+QLH+KC++ +D + VLT PYDS  D   F++  S VLYMNNLPPDTT
Sbjct: 154 TLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTT 213

Query: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHEE 300
           QSELE+WFTQ+GVRP+GFWTVKNI+EDT            PYVEE DSISGF+VF TH+E
Sbjct: 214 QSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKE 273

Query: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360
           A +VL LNG SILSN+ANTKQPRVVEHV+E+QPSS  V+++ Q IL+PFPQSKNKPRPGD
Sbjct: 274 AIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGD 333

Query: 361 WNCPSCGFSNFQRRTACFRCSFP 383
           WNCPSCGFSNFQRRTACFRCSFP
Sbjct: 334 WNCPSCGFSNFQRRTACFRCSFP 356

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (90%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611
           +PFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383
           R GDW C +CG+ NF +   C RCS P
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPK 610
           R GDW C +C + NF +   C RC  P+
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  401 bits (1030), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 204/397 (51%), Positives = 261/397 (65%), Gaps = 32/397 (8%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDG-------- 52
           M YV++ELQ     DS KDQ ++  + YQI+DA         DSL K +++G        
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDA---------DSLEKRKINGNEIRQLAV 51

Query: 53  EAKSLESAMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRL 112
           E  +L+  ++  +K+I+ VI  +EFVL S+ STW +RV L R+A D+   L + L++P +
Sbjct: 52  EGSNLQDTVLLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIV 111

Query: 113 FDLWKEFDRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPS 172
            DLWKEFDRWC NHP+ L+  K  +                KN    ++++ + +    S
Sbjct: 112 LDLWKEFDRWCTNHPDALQSVKGYNRK-------------CKNLPMVHQVLGVEQRLNES 158

Query: 173 EGADFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYM 232
             A+    ++  +  T+DILLQLHKKCSS +D  +VLTQPY+S  D  TF +E+S VLY+
Sbjct: 159 VNANGYTRKEVGI--TSDILLQLHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYL 216

Query: 233 NNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGF 292
           NNLPPDTTQ ELE+WF Q+G RPV FWT KNIVEDT             YVEEQDS+SGF
Sbjct: 217 NNLPPDTTQGELETWFGQFGSRPVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGF 276

Query: 293 VVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQS 352
             FQT EEA   L L+GRSILSN+ANTKQPR+VEHV+E+ PSS  +L  ++EILS FPQS
Sbjct: 277 ATFQTFEEAFNALKLSGRSILSNVANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQS 336

Query: 353 KNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 389
           KNKPRPGDWNCPSCGFSNFQRRTACFRCSFP PS +Q
Sbjct: 337 KNKPRPGDWNCPSCGFSNFQRRTACFRCSFPVPSAVQ 373

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (90%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611
           IPFRAGDWKC+ C YHNFAKN++CLRC GPK+
Sbjct: 442 IPFRAGDWKCAACAYHNFAKNIICLRCSGPKT 473

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPA---PSNIQMH 391
           R GDW C +C + NF +   C RCS P    P N++ H
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGPKTSHPHNLRSH 482

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGP 609
           R GDW C +C + NF +   C RC  P
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFP 367

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  394 bits (1013), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/408 (47%), Positives = 263/408 (64%), Gaps = 40/408 (9%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAE-TLICHYDID-------SLPKIEVDG 52
           M+Y+ +E +  +  ++PKD  +I S++YQ+++ E      YD+        SL     +G
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 53  EAKSLESAMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRL 112
           +  + +  + Q  +++   IGN+E VL SL STW +RVT+ RQ+ D+G IL S+L+ P +
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 113 FDLWKEFDRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPS 172
           FDLWKE+ RWC  H   +   K                   K  KD +E+ +ILE++  S
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMKT------------------KKYKDSSELYKILEINQNS 162

Query: 173 EGADFIPE--------------EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTD 218
           +      +              +++ +R T D+ + +  KCS+PED +SVLT PY+S  D
Sbjct: 163 DAKTNNEKLNDRSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVD 222

Query: 219 IRTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXX 278
            +TF+QE SK++YMNNLPPDTTQSELESWF Q+G++P   WTV+NI+E T          
Sbjct: 223 FQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSN 282

Query: 279 XXPYVEEQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGV 338
             PYVEE DSISGF VFQTH+EAT+ L LNGRSILSN+ANTKQPRVVEH++ELQPSS  +
Sbjct: 283 NSPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVI 342

Query: 339 LDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPS 386
           L++ QEI S FPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA +
Sbjct: 343 LERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAAT 390

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611
           +PFRAGDWKCS C+YHNFAKN+VCLRCGGPK+
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNI 388
           R GDW C +C + NF +   C RC  P    I
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSV 612
           R GDW C +C + NF +   C RC  P + 
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAAT 390

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  350 bits (897), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 245/386 (63%), Gaps = 33/386 (8%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           MHYVVLE++  +   + KDQ RI +++YQIV+ +        + +  I +  ++++ + A
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120
           ++QLD DI   IG +EFV+ +L S  ++RVTL RQA D G  L  YL++P+LFDLW EF 
Sbjct: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120

Query: 121 RWCVNHPEL-LEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIP 179
           ++C NHPEL L +   TS                   KD   +  IL + + +       
Sbjct: 121 KFCANHPELDLNEEMVTS-------------------KDVAILTDILGLQSNNT------ 155

Query: 180 EEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDT 239
            E   +  +TD+LL L+KKCSS ED+K VLTQPYD   DI+TF +E ++V++++NLPPD 
Sbjct: 156 -ENYTIDISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDI 214

Query: 240 TQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSISGFVVFQTHE 299
           TQ+ELE+WF  +  +P+ +WT K   E +             YV  Q SI GF++FQTHE
Sbjct: 215 TQNELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHE 268

Query: 300 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 359
           EA + L LNG+SI S+  + KQ   VEH++E+ PSST VLD  Q+IL PFPQSKNKPR G
Sbjct: 269 EAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLG 328

Query: 360 DWNCPSCGFSNFQRRTACFRCSFPAP 385
           DWNCPSCGFSNFQRRTACFRCSFPAP
Sbjct: 329 DWNCPSCGFSNFQRRTACFRCSFPAP 354

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 25/31 (80%), Positives = 28/31 (90%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 610
           +PFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 19/33 (57%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 389
           R GDW CPSC + NF +  AC RC  P  S I 
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGIH 481

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 7/37 (18%)

Query: 580 IPF-------RAGDWKCSTCTYHNFAKNVVCLRCGGP 609
           IPF       R GDW C +C + NF +   C RC  P
Sbjct: 316 IPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFP 352

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  270 bits (691), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 152/406 (37%), Positives = 226/406 (55%), Gaps = 42/406 (10%)

Query: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60
           MHYVVL++Q+    DS   +  +  + YQ++D  +L      +    ++VDGE  S++  
Sbjct: 1   MHYVVLDVQI----DSSAVKPVLLRLGYQVIDPVSLEAR---NEPYVVDVDGE--SIKEF 51

Query: 61  MIQLDKDI--HDVIGN---------------DEFVLVSLCSTWHIRVTLSRQARDDGFIL 103
           + +LD+D+  H  + N                EFV  +L  +W ++V L   A D G  L
Sbjct: 52  IAKLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVEL 111

Query: 104 TSYLQHPRLFDLWKEFDRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMI 163
             YL++P  FD+WKE+  W  NH +  E  +  +N  S     G             E++
Sbjct: 112 PEYLRYPVFFDIWKEYSIWKKNHSDSSESPQTQANGESIDSFAGK----------IEELV 161

Query: 164 RILEVSTPSEGADFIPEEQSL-LRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTF 222
           R L+VST  +      ++ +  +R  T +L  LHKKC +P D  +VLT PYD   D + F
Sbjct: 162 RTLDVSTEYDELKQKNDDPTFDVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNF 221

Query: 223 LQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPY 282
           ++E+SK+LY++N+P +  Q++LE WF Q GV  VGFWT+KNI +D               
Sbjct: 222 IEEQSKILYISNIPSELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQRNHGKM--- 278

Query: 283 VEEQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKA 342
           +   DS+ GF +FQ+H +A   L L+G   +  +   K  + +E +L++QPSS  +L+K 
Sbjct: 279 LSIPDSMFGFAIFQSHNDAEYALNLHG--TVMKIVAPKGNKHIEQLLDIQPSSMRLLEKV 336

Query: 343 QEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNI 388
           Q+ L   PQ+KNKPRPGDWNCPSCGFSNFQRRTACFRC+FP P+ +
Sbjct: 337 QDNLILLPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAFPVPNGV 382

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%)

Query: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNH 621
           +PFRAGDWKC  C YHNFAKN+VCLRCGGPK+     ++ N 
Sbjct: 532 VPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTTTRDKNNQ 573

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383
           R GDW CP C + NF +   C RC  P
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGP 561

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 583 RAGDWKCSTCTYHNFAKNVVCLRCG--GPKSVNADANE------TNHYIEGLT 627
           R GDW C +C + NF +   C RC    P  V+ +A +      TN+ + G T
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVSGNAGKLPMTSVTNNMVSGYT 403

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 229 VLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNI 264
           VL + NLP D TQ ELE  F   G + V   +V+N+
Sbjct: 234 VLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGF 258
            LY+ NLPPDTT+ EL   F+ Q G R + F
Sbjct: 554 TLYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWF-TQYGVRPVGF 258
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 546 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWF-TQYGVRPVGF 258
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 522 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWF-TQYGVRPVGF 258
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 609 TLYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 230 LYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNI 264
           +Y   LP +TT ++L ++FT YG R +  +  KN+
Sbjct: 185 VYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKNV 219

>Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON}
           YDL224C (REAL)
          Length = 650

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 263
            LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 535 TLYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 570

>Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON}
           YDL224C (REAL)
          Length = 652

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 263
            LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 537 TLYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 572

>YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}
           WHI4Putative RNA binding protein and partially redundant
           Whi3p homolog that regulates the cell size requirement
           for passage through Start and commitment to cell
           division
          Length = 649

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 263
            LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 534 TLYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 569

>CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {ON}
           similar to uniprot|P34761 Saccharomyces cerevisiae
           YNL197c WHI3 involved in regulation of cell size
          Length = 674

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 263
            LY+ NLPPDT++ EL   F+ Q G R + F    N
Sbjct: 559 TLYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNN 594

>CAGL0I04840g Chr9 (434911..438105) [3195 bp, 1064 aa] {ON} some
           similarities with uniprot|P29465 Saccharomyces
           cerevisiae YBR023c CHS3 chitin synthase III
          Length = 1064

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 10/94 (10%)

Query: 143 TKAGGS----NGALAKNTKDFNEMIRILEVSTPSEGADFIPEEQSLLRRTTDIL--LQLH 196
            KA GS    N  + +  +D  +    +    P    +F+PE  SL+ R  DI+  + LH
Sbjct: 395 AKAQGSFKVNNKTMIRIMRDIEDWAEDINKKAPIMNVNFLPENTSLITRKRDIVEGISLH 454

Query: 197 -KKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKV 229
            K+ S+P    S+L+ P  S     T+L+   K+
Sbjct: 455 PKRMSNPT---SILSGPNSSNVKSTTYLKPNLKI 485

>Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)
           [1803 nt, 601 aa]
          Length = 600

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 230 LYMNNLPPDTTQSELESWF-TQYGVRPVGF 258
           LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 461 LYVGNLPPDATEQELRQLFSSQQGFRRLSF 490

>ZYRO0A03784g Chr1 (300789..301415) [627 bp, 208 aa] {ON} highly
           similar to uniprot|Q12488 Saccharomyces cerevisiae
           YDR013W PSF1 Subunit of the GINS complex (Sld5p Psf1p
           Psf2p Psf3p) which binds to DNA replication origins and
           facilitates assembly of the DNA replication machinery
          Length = 208

 Score = 32.0 bits (71), Expect = 3.6,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 26/55 (47%)

Query: 168 VSTPSEGADFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTF 222
           +    + +D   +EQ  L+  TD+L +L     +  D+   LT P D + D+R  
Sbjct: 114 IGAEQDTSDLSHQEQDYLKEYTDLLTELKSGDLADIDLSGSLTPPSDVFIDVRVL 168

>KAFR0A07700 Chr1 (1550013..1551728) [1716 bp, 571 aa] {ON} Anc_2.52
           YNL197C
          Length = 571

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGF 258
            LY+ NLPPD T+ EL   F+ Q G R + F
Sbjct: 443 TLYVGNLPPDATEQELRQLFSKQQGFRRLSF 473

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 44/122 (36%), Gaps = 26/122 (21%)

Query: 230 LYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEEQDSI 289
           +Y+ N+ P+T Q E E  F+QYG          N                    E +   
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN--------------------EGKLRG 262

Query: 290 SGFVVFQTHEEATEVLA------LNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQ 343
            GFV F+ H  A + +        NG+ +    A  K  R+ E   + + S    L K Q
Sbjct: 263 FGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ 322

Query: 344 EI 345
            +
Sbjct: 323 GV 324

>ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL224C
           (WHI4) and YNL197C (WHI3)
          Length = 729

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWF-TQYGVRPVGF 258
            LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 608 TLYVGNLPPDATEQELRQLFSSQKGFRRLSF 638

>ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 745

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGF 258
            LY+ NLPPD T+ EL   F+ Q G R + F
Sbjct: 618 TLYVGNLPPDATEQELRQLFSGQQGFRRLSF 648

>NDAI0H03850 Chr8 (943316..945544) [2229 bp, 742 aa] {ON} Anc_2.52
           YDL224C
          Length = 742

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGF 258
            LY+ NLPPD T++EL   F+ Q G R + F
Sbjct: 627 TLYVGNLPPDATENELRQLFSCQNGFRRLSF 657

>Skud_4.30 Chr4 complement(50997..52952) [1956 bp, 651 aa] {ON}
           YDL224C (REAL)
          Length = 651

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 229 VLYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 263
            LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 535 TLYVGNLPPDATEQELRQLFSNQPGFRRLSFRNKMN 570

>Ecym_6441 Chr6 (856251..858320) [2070 bp, 689 aa] {ON} similar to
           Ashbya gossypii ABL158C
          Length = 689

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 229 VLYMNNLPPDTTQSELESWF-TQYGVRPVGF 258
            LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 568 TLYVGNLPPDATEQELRQLFSSQKGFRRLSF 598

>SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {ON}
           similar to uniprot|P36120 Saccharomyces cerevisiae
           YKR024C DBP7 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 715

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 23  IGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESAMIQLDKDIHDVIGNDEFVLVSL 82
           + S  YQ+    T  CHY +   P + + GE K  E A  +L K  + +IG    +L  L
Sbjct: 219 LASQIYQVASTLTQCCHYIV---PCLLIGGERKKSEKA--RLRKGCNLIIGTPGRILDHL 273

Query: 83  CSTWHIRVTLSRQAR 97
            +T  IR  L R  R
Sbjct: 274 QNTKVIREQLVRTLR 288

>Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON}
           similar to Ashbya gossypii AAL018W
          Length = 288

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 225 ERSKVLYMNNLPPDTTQSELESWFTQYG 252
           ERS+++Y  N+PP T +S+L   F   G
Sbjct: 207 ERSRIIYCENMPPATVESDLYDLFETIG 234

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 18/100 (18%)

Query: 153 AKNTKDFNEMIRILEVSTPSEGADFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQP 212
           A N+K F   +   E  +  E  D I     +L    ++ +  H    S +D +S L + 
Sbjct: 164 AGNSKGFG-FVHFEEEYSAKEAVDAI---NGMLLNGQEVYVAPH---VSKKDRQSKLEEA 216

Query: 213 YDSYTDIRTFLQERSKVLYMNNLPPDTTQSELESWFTQYG 252
             ++T+I           Y+ N+  +TTQ E E+ FTQ+G
Sbjct: 217 KSNFTNI-----------YVKNIDLETTQEEFEALFTQFG 245

>KAFR0E01080 Chr5 complement(221208..221816) [609 bp, 202 aa] {ON}
           Anc_3.234 YDR013W
          Length = 202

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 169 STPSEGADFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTF 222
           S+  +  D   EEQ  LR   D++  L     S  D+   LT P D + D+R  
Sbjct: 109 SSNQDSNDLSHEEQEYLREYADLITDLKVGALSDIDISGSLTPPSDVFIDVRVL 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,804,507
Number of extensions: 2960831
Number of successful extensions: 11787
Number of sequences better than 10.0: 73
Number of HSP's gapped: 12089
Number of HSP's successfully gapped: 131
Length of query: 707
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 590
Effective length of database: 40,065,477
Effective search space: 23638631430
Effective search space used: 23638631430
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)