Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.897.350ON38538519820.0
YDL168W (SFA1)7.350ON38638418520.0
Smik_4.707.350ON38638418380.0
Suva_4.787.350ON38538518260.0
Kpol_530.317.350ON38038016600.0
CAGL0L01111g7.350ON38138016090.0
Kwal_56.246427.350ON38137415980.0
KLTH0H01254g7.350ON38137815950.0
KLLA0D12342g7.350ON38438015900.0
NCAS0A141607.350ON45137915850.0
ZYRO0F11704g7.350ON38238115680.0
TPHA0F029707.350ON38137715620.0
TDEL0C019807.350ON38538215590.0
Ecym_47237.350ON38138115510.0
SAKL0F11374g7.350ON38338315500.0
ACL148C7.350ON38138115470.0
TBLA0E00390singletonON38338315440.0
KAFR0B008807.350ON38138114960.0
KNAG0C037907.350ON38238313340.0
NDAI0A018907.350ON42238013200.0
SAKL0A00880gsingletonON38837511121e-151
YBR145W (ADH5)3.118ON3512792681e-25
KLLA0D19929gsingletonON3863422551e-23
Suva_4.3943.118ON3512792495e-23
KLLA0B00451gsingletonON3863732471e-22
SAKL0C10164g3.118ON3512792443e-22
KLTH0G18986g8.16ON3543712391e-21
CAGL0D00198g7.3ON3832942401e-21
Smik_2.2843.118ON3512792381e-21
NCAS0I023503.118ON3512722372e-21
KLTH0D00616g7.3ON3823092349e-21
Skud_2.2723.118ON3512792302e-20
SAKL0F06270gna 1ON3512792292e-20
TBLA0I011402.480ON3772642302e-20
TDEL0C003908.16ON3532882293e-20
CAGL0J01441g2.480ON3722712293e-20
Kpol_1058.118.16ON3532612283e-20
Ecym_53313.118ON3482592274e-20
KNAG0K020003.118ON3502692258e-20
KLLA0F18260gsingletonON3482572259e-20
Smik_13.520na 2ON3482772241e-19
Skud_13.2402.480ON3752712241e-19
Skud_13.477na 2ON3482802232e-19
YOL086C (ADH1)3.118ON3482772222e-19
KLLA0F21010g3.118ON3502572222e-19
SAKL0B00814g8.16ON3543862213e-19
AER032W3.118ON3512592203e-19
KAFR0G014203.118ON3512572195e-19
NCAS0I01720singletonON3512722187e-19
Suva_13.2612.480ON3752712197e-19
Suva_13.494na 2ON3482772179e-19
Smik_15.713.118ON3482772179e-19
YMR083W (ADH3)2.480ON3752712189e-19
SAKL0B08184gna 3ON3732692162e-18
YMR303C (ADH2)na 2ON3482792152e-18
Skud_15.683.118ON3482772152e-18
Suva_15.813.118ON3482772152e-18
NDAI0A069303.118ON3512712152e-18
KLTH0G15686g3.118ON3512572152e-18
Smik_13.2662.480ON3752712152e-18
KLLA0F00506g7.3ON3852942152e-18
KLTH0A00418gsingletonON3562612134e-18
TPHA0G032102.480ON3772572134e-18
CAGL0I07843g3.118ON3522572125e-18
TDEL0D050503.118ON3512572091e-17
Kpol_431.82.480ON3802492101e-17
KLLA0B09064gna 3ON3742572091e-17
YAL060W (BDH1)7.3ON3822392091e-17
SAKL0E02838g2.480ON3772642082e-17
TDEL0H044607.3ON3823032082e-17
Kwal_55.19574singletonON3563652072e-17
TBLA0E03430singletonON3512792063e-17
KLTH0E05588gna 1ON3482492053e-17
ZYRO0B05940g3.118ON3792492064e-17
KAFR0L02010singletonON3512492054e-17
Smik_1.67.3ON3823072055e-17
Skud_1.37.3ON3823062039e-17
Suva_10.1548.16ON3563732029e-17
KLTH0D05588g2.480ON3892572031e-16
TBLA0E034403.118ON3512592011e-16
KAFR0A007902.480ON3772712021e-16
NDAI0H021602.480ON3812592021e-16
AAR084WsingletonON3852492011e-16
ZYRO0G03388g2.480ON3702902012e-16
KLLA0F13530g2.480ON3752572012e-16
ZYRO0C12562gna 1ON3482491974e-16
TPHA0M007303.118ON3502771974e-16
SAKL0D14894g7.2ON3853061975e-16
NCAS0A077802.480ON3732731966e-16
ABR229C8.16ON3533601966e-16
YLR070C (XYL2)8.16ON3563781941e-15
Ecym_73912.480ON3752661941e-15
Kwal_56.231983.118ON3512591941e-15
SAKL0D14872g7.3ON3833061941e-15
Kwal_55.20564singletonON2162151853e-15
Skud_20.2singletonON3573651913e-15
Skud_4.2singletonON3573651913e-15
KAFR0L02000singletonON3612491903e-15
NCAS0J003008.16ON3572631904e-15
Suva_1.77.3ON3823081905e-15
TDEL0A025602.480ON3732571896e-15
Kwal_26.67397.3ON3822861896e-15
Kwal_26.77992.480ON3872711897e-15
Kpol_1049.187.2ON3863131887e-15
Smik_48.1singletonON3573691878e-15
KNAG0K01040singletonON3913061888e-15
TBLA0A042907.3ON3952811871e-14
ZYRO0G03410gsingletonON3733561862e-14
TDEL0F03190na 1ON3512501842e-14
Kpol_1036.193.118ON3532771833e-14
Kwal_26.6684singletonON3562521833e-14
Suva_12.260singletonON3573751833e-14
ABL033C2.480ON3732851833e-14
YJR159W (SOR1)na 4ON3573621833e-14
KNAG0E025902.480ON3742711824e-14
NDAI0H020507.3ON3852991824e-14
KAFR0I001607.2ON3853061825e-14
YDL246C (SOR2)singletonON3573621807e-14
ZYRO0F02552g8.16ON3512621781e-13
YAL061W (BDH2)7.2ON4172941683e-12
KNAG0D00110singletonON3623421639e-12
NCAS0A076607.3ON3862431631e-11
NCAS0A076707.2ON4393051622e-11
Suva_1.67.2ON4172941603e-11
Smik_1.57.2ON4172981603e-11
KNAG0I00120singletonON3812311594e-11
Skud_1.27.2ON4172771594e-11
KLLA0D05511g8.16ON3542881584e-11
KLLA0F00528g7.2ON3812951532e-10
KAFR0I001707.3ON3813001532e-10
NDAI0H02950singletonON3633401496e-10
NCAS0C03020singletonON3623981488e-10
TPHA0H03100singletonON3922401452e-09
Kwal_47.17532na 5ON3732441424e-09
NDAI0G04880singletonON3613581391e-08
CAGL0M14047gna 6ON3593861372e-08
KLLA0F00638gna 7ON3822261372e-08
KAFR0C005803.253ON3342471335e-08
CAGL0H06853gsingletonON3603941311e-07
TDEL0D037203.253ON3352531301e-07
NDAI0H020607.2ON3993061311e-07
NCAS0D01220na 8ON3622521301e-07
Smik_2.1703.253ON3342681301e-07
NDAI0A08470singletonON3633961292e-07
NDAI0H02940na 8ON3612241292e-07
KAFR0A08730singletonON3602171282e-07
Kwal_56.229853.253ON3463511273e-07
KLTH0E07964gna 5ON3742951265e-07
KNAG0E042007.2ON3853061247e-07
KLLA0A10549g3.253ON3531901231e-06
KNAG0K02680singletonON3592551221e-06
TPHA0J00170singletonON3613431221e-06
YBR046C (ZTA1)3.253ON3342621212e-06
Suva_13.513na 6ON3603571194e-06
KLLA0E19889gna 9ON3662711184e-06
NCAS0I017303.253ON3493691167e-06
SAKL0H22088gna 5ON3762721168e-06
KLTH0C07854g3.253ON3583501168e-06
Skud_2.1623.253ON3342491141e-05
KLTH0B04972gna 9ON3603551141e-05
NDAI0A063203.253ON3492631095e-05
Suva_4.2793.253ON3342501086e-05
SAKL0D03872g3.253ON3483601087e-05
Ecym_1093singletonON3832441079e-05
Skud_13.494na 6ON3603451061e-04
Kpol_526.18singletonON3612161062e-04
SAKL0D14938gsingletonON3782321052e-04
SAKL0C00264gsingletonON3593811052e-04
ABL090W3.253ON3342641033e-04
Kwal_26.9050singletonON3642391033e-04
Smik_13.535na 6ON3601611024e-04
KNAG0B06990singletonON3583431016e-04
YMR318C (ADH6)na 6ON3603521016e-04
CAGL0H09944g3.253ON333341990.001
ZYRO0G10318gna 5ON376280980.001
TPHA0A00140singletonON362380980.001
Kwal_8.605singletonON379234970.002
YCR105W (ADH7)na 10ON361366970.002
KAFR0H03770singletonON365226960.002
Kwal_27.12835singletonON364225920.007
TDEL0A00140singletonON405263920.007
KAFR0C01550singletonON359248920.008
TDEL0F02300na 5ON379226910.011
SAKL0H00374gsingletonON42897890.016
Skud_3.175singletonON361229880.023
ZYRO0A03366g3.253ON349351870.025
KLTH0B00506gna 7ON398291870.026
KLTH0C10538gsingletonON273145860.035
Smik_26.3singletonON125108820.036
Smik_3.203singletonON120104800.064
Suva_6.13singletonON6859740.14
KLTH0F08382g8.402ON65738770.56
TBLA0C014901.400ON86287760.86
Skud_86.1singletonON8959671.9
TPHA0E007307.413ON97860732.0
TBLA0B079305.66ON64698722.0
YNL223W (ATG4)2.18ON49489722.4
KNAG0I013001.400ON80674712.9
Suva_7.3434.207ON1358102713.0
SAKL0A10560gsingletonON409163703.3
ZYRO0E04642g1.400ON80760713.4
Kpol_1018.1077.413ON112733713.4
Ecym_73018.67ON78460679.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.89
         (385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   768   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   717   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   712   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   707   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   644   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   624   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   620   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   619   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   617   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   615   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   608   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   606   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   605   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   602   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   601   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   600   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      599   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   580   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   518   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    513   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   432   e-151
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...   107   1e-25
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   102   1e-23
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...   100   5e-23
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   100   1e-22
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    99   3e-22
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    97   1e-21
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    97   1e-21
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    96   1e-21
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     96   2e-21
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    95   9e-21
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    93   2e-20
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    93   2e-20
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    93   2e-20
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    93   3e-20
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    93   3e-20
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    92   3e-20
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    92   4e-20
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    91   8e-20
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    91   9e-20
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    91   1e-19
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    91   1e-19
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    91   2e-19
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    90   2e-19
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    90   2e-19
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    90   3e-19
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    89   3e-19
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    89   5e-19
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               89   7e-19
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    89   7e-19
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    88   9e-19
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    88   9e-19
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    89   9e-19
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    88   2e-18
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    87   2e-18
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    87   2e-18
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    87   2e-18
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    87   2e-18
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    87   2e-18
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    87   2e-18
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    87   2e-18
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    87   4e-18
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    87   4e-18
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    86   5e-18
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    85   1e-17
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    86   1e-17
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    85   1e-17
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    85   1e-17
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    85   2e-17
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    85   2e-17
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    84   2e-17
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               84   3e-17
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    84   3e-17
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    84   4e-17
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              84   4e-17
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     84   5e-17
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     83   9e-17
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    82   9e-17
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    83   1e-16
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    82   1e-16
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    82   1e-16
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     82   1e-16
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    82   1e-16
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    82   2e-16
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    82   2e-16
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    80   4e-16
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    80   4e-16
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    80   5e-16
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    80   6e-16
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    80   6e-16
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    79   1e-15
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    79   1e-15
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    79   1e-15
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    79   1e-15
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    76   3e-15
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     78   3e-15
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    78   3e-15
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              78   3e-15
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       78   4e-15
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     78   5e-15
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    77   6e-15
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    77   6e-15
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    77   7e-15
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    77   7e-15
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    77   8e-15
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    77   8e-15
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    77   1e-14
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    76   2e-14
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    75   2e-14
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    75   3e-14
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    75   3e-14
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    75   3e-14
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    75   3e-14
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    75   3e-14
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    75   4e-14
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    75   4e-14
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    75   5e-14
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    74   7e-14
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    73   1e-13
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    69   3e-12
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   67   9e-12
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    67   1e-11
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    67   2e-11
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     66   3e-11
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     66   3e-11
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  66   4e-11
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      66   4e-11
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    65   4e-11
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    64   2e-10
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    64   2e-10
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    62   6e-10
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    62   8e-10
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    60   2e-09
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    59   4e-09
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    58   1e-08
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    57   2e-08
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    57   2e-08
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    56   5e-08
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    55   1e-07
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    55   1e-07
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    55   1e-07
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               55   1e-07
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    55   1e-07
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             54   2e-07
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    54   2e-07
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    54   2e-07
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    54   3e-07
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    53   5e-07
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    52   7e-07
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    52   1e-06
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    52   1e-06
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                52   1e-06
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    51   2e-06
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    50   4e-06
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    50   4e-06
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     49   7e-06
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    49   8e-06
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    49   8e-06
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    49   1e-05
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    49   1e-05
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    47   5e-05
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    46   6e-05
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    46   7e-05
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    46   9e-05
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    45   1e-04
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    45   2e-04
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    45   2e-04
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    45   2e-04
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    44   3e-04
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    44   3e-04
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    44   4e-04
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             44   6e-04
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    44   6e-04
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    43   0.001
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    42   0.001
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 42   0.001
Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W - Hy...    42   0.002
YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}  ADH7NADPH-...    42   0.002
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    42   0.002
Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]...    40   0.007
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 40   0.007
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    40   0.008
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    40   0.011
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    39   0.016
Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W ...    39   0.023
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    38   0.025
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    38   0.026
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    38   0.035
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      36   0.036
Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]...    35   0.064
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    33   0.14 
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...    34   0.56 
TBLA0C01490 Chr3 complement(343276..345864) [2589 bp, 862 aa] {O...    34   0.86 
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    30   1.9  
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    33   2.0  
TBLA0B07930 Chr2 complement(1880760..1882700) [1941 bp, 646 aa] ...    32   2.0  
YNL223W Chr14 (227370..228854) [1485 bp, 494 aa] {ON}  ATG4Conse...    32   2.4  
KNAG0I01300 Chr9 (248944..251364) [2421 bp, 806 aa] {ON} Anc_1.4...    32   2.9  
Suva_7.343 Chr7 complement(587041..591117) [4077 bp, 1358 aa] {O...    32   3.0  
SAKL0A10560g Chr1 (928213..929442) [1230 bp, 409 aa] {ON} simila...    32   3.3  
ZYRO0E04642g Chr5 complement(349593..352016) [2424 bp, 807 aa] {...    32   3.4  
Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa...    32   3.4  
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    30   9.6  

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/385 (96%), Positives = 373/385 (96%)

Query: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60
           MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD
Sbjct: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240
           VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF
Sbjct: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240

Query: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXX 300
           GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLRFQEE 385
           KEINQAFEDLHNGDCLRTVLRFQEE
Sbjct: 361 KEINQAFEDLHNGDCLRTVLRFQEE 385

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/384 (89%), Positives = 361/384 (94%)

Query: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60
           M AATVGKPI+C+AAVAY+AKK LSVEEITVD PKAHEVRIKIE+TAVCHTDAYTLSGSD
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPC+LGHEGAGIVESVGDDV+TVKPGDHVIALYTAECGKCKFCTSGKTNLC AVRA
Sbjct: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240
           VTTG+GAA+KTANVQ+GDTVAVFGCGTVGLSV+QGAK RGASKIIA+DINNKK+QY S F
Sbjct: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQF 240

Query: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXX 300
           GATDF+NPKEDLA+DQTIVEKLI+MTDGGLDFTFDCTGNT IMRDALEACHKGWGQS   
Sbjct: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ GALKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLRFQE 384
           KEINQAFEDLHNGDCLRTVL+  E
Sbjct: 361 KEINQAFEDLHNGDCLRTVLKSDE 384

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/384 (89%), Positives = 359/384 (93%)

Query: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60
           M AATVGKPI+C+AAVAY+AKK  SVEEITVD PKAHEVRIKIE+TAVCHTDAYTLSGSD
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPCILGHEGAGIVESVGD V+TVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFHNAKG+DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDA+CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180

Query: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240
           VTTGYGAA+KTANVQ+GDTVAVFGCGTVGLSV+QGAK RGASKIIAVDINN K++Y S F
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240

Query: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXX 300
           GATDFINPKEDLA+DQTIVEKL++MTDGGLDFTFDCTGNT IMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSG LKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLRFQE 384
           KEIN AFEDLHNGDCLRTVL+F E
Sbjct: 361 KEINHAFEDLHNGDCLRTVLKFDE 384

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/385 (88%), Positives = 359/385 (93%)

Query: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60
           M A+TVGKPIQC+AA+AY+AKK LSVEEITVDPPKAHEVRIKIE+TAVCHTDAYTLSGSD
Sbjct: 1   MSASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPCILGHEGAGIVESVGDDV TVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQG+G+MPD TTRFHN KGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAA LLGCG
Sbjct: 121 TQGRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCG 180

Query: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240
           VTTGYGAA+KTANVQ+GDTVAVFGCGTVGLSV+QGAK+RGASKII +DINNKK+QY  +F
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDF 240

Query: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXX 300
           GATDFINPKEDLA+ QTIVEKLI+ TDGGLDFTFDCTGNT IMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+GALKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLRFQEE 385
           KEINQAFEDLH GDCLRTVL+F ++
Sbjct: 361 KEINQAFEDLHQGDCLRTVLKFDKK 385

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/380 (81%), Positives = 336/380 (88%), Gaps = 1/380 (0%)

Query: 4   ATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEG 63
           +TVGKPI C AAVAY A K L VEEI VDPPKAHEVRIKI  TAVCHTDAYTLSG DPEG
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 64  LFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123
           LFPC+LGHEG+GIVESVGD+V TVKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183
           KGVMPDGT RFHN KGE +YHFMGCSTFSEYTVVADVSVVAIDP APLD+ CLLGCGVTT
Sbjct: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181

Query: 184 GYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243
           GYGAAIKTANVQ+GDTVAVFG GTVGLSV+QGAKSRGASKII VDINN K+++S+ FGAT
Sbjct: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241

Query: 244 DFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXX 303
           DF+NP E L E Q IV KL++MTDGGLDFTFDCTGN N+MRDALEACHKGWGQS      
Sbjct: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEI 363
                 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G+LKV+EFIT+RRPF EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 364 NQAFEDLHNGDCLRTVLRFQ 383
           N AFE+LH+G+CLRTVL F+
Sbjct: 361 NDAFEELHHGNCLRTVLSFK 380

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/380 (77%), Positives = 327/380 (86%)

Query: 5   TVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL 64
           T GKPI+C+AAVAY A K   VE+I VDPPKAHEVRIKI  TAVCHTDAYTLSG+DPEGL
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 65  FPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
           FPC+LGHEGAGIVESVGD V  VKPGDHVIALYTAEC KCKFC SGKTNLC AVRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
           GVMPDGT+RFHN KGE +YHFMGCSTFSEYTVVADVSVVAID  APL++ CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 185 YGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATD 244
           YGAA+KTANVQ+GDTVAVFGCGTVGLSV+QGA  RGAS+IIA+D N++K+ + + FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 245 FINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXX 304
           FINP +DL E++TIV KLI+MTDGGLD TFDCTGN N+MR ALEACHKGWGQS       
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 305 XXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEIN 364
                STRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKV+EFITHRR F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 365 QAFEDLHNGDCLRTVLRFQE 384
           +AF+DLHNG CLRTVL F +
Sbjct: 362 EAFDDLHNGLCLRTVLSFSK 381

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/374 (78%), Positives = 327/374 (87%)

Query: 7   GKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFP 66
           GKPI C+AAVAY A K L++EEI VDPPKAHEVR+KI +TAVCHTDAYTLSG DPEG FP
Sbjct: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63

Query: 67  CILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
            ILGHEGAGIVES+G+ V  VKPGDHVIALYTAEC +CKFC SGKTNLC +VRATQGKGV
Sbjct: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYG 186
           MPDGTTRFHN KGEDI HFMGCSTFS+YTV+ADVSVVAIDPKAPLD  CLLGCGVTTGYG
Sbjct: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 187 AAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFI 246
           AA+KTANVQ+GDTVAVFG GTVGLSV+QGAK RGAS+II VDIN++K+Q+++ FGATDF+
Sbjct: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243

Query: 247 NPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXX 306
           NP +DL + +TIV+ L++MTDGGLD+TFDCTGNT++MR ALEACHKGWG+S         
Sbjct: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQA 366
              STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKV+EFITHRR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 367 FEDLHNGDCLRTVL 380
           FEDLH+GDCLRTVL
Sbjct: 364 FEDLHHGDCLRTVL 377

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/378 (77%), Positives = 326/378 (86%)

Query: 7   GKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFP 66
           GKPI C AAVAY A K L+VEEI VDPPKAHEVRIK+E+TAVCHTDAYTLSG DPEG FP
Sbjct: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63

Query: 67  CILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
            ILGHEGAG+VESVG+ V  VK GDHVIALYTAEC +CKFC SGKTNLC +VRATQGKGV
Sbjct: 64  SILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYG 186
           MPDGT+RFHN KGED+ HFMGCSTFS+YTVVADVSVVAIDPKAPLD  CLLGCGVTTGYG
Sbjct: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 187 AAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFI 246
           AA+KTA+VQ+GDTVA+FG GTVGLSV+QGA  RGASKII VDIN++K+Q+S +FGATDF+
Sbjct: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243

Query: 247 NPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXX 306
           NP + L + QTIV+KL++MTDGGLDFTFDCTGNT++MR ALEACHKGWGQS         
Sbjct: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQA 366
              STRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 367 FEDLHNGDCLRTVLRFQE 384
           FEDLH+GDCLRTVL   +
Sbjct: 364 FEDLHHGDCLRTVLDLSK 381

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/380 (77%), Positives = 324/380 (85%)

Query: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60
           M +AT GKPI+CVAAVAY A K L+VE+I VD PKAHEVR+++  TAVCHTDAYTLSG D
Sbjct: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEG FP ILGHEGAGIVESVGD V  VK GDHV+ LYTAECGKCKFC S KTNLC +VRA
Sbjct: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFHN KGE + HFMGCSTFS+YTVVADVS+V IDP APL + CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180

Query: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240
           VTTGYGAA+KTANVQEGDTVAVFG GTVGLSV+QGAKSRGASKII VD+N++K+Q+S +F
Sbjct: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240

Query: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXX 300
           GAT F+NP +DL E +TIV KLIDMTDGGLDFTFDCTGN  +MRDALEACHKGWGQS   
Sbjct: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360
                    STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKV++FITH+RPF
Sbjct: 301 GVAAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVL 380
            EIN AFEDLH+GDCLRTVL
Sbjct: 361 TEINNAFEDLHHGDCLRTVL 380

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/379 (80%), Positives = 335/379 (88%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           +++T GKPI C AAVAY A K L+VE+I VDPPKAHEVRIKIE+TAVCHTDAYTLSG DP
Sbjct: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128

Query: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121
           EG FP ILGHEG+GIVESVG+ V  VK GDHVIALYTAECGKCKFC SGKTNLC +VRAT
Sbjct: 129 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
           QGKGVMPDGT+RFHN KGE + HFMGCSTFS+YTVVADVSVVA+DPKAPLD+  LLGCGV
Sbjct: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGV 248

Query: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241
           TTGYGAAIKTANVQ+GDTVAVFG GTVGLSV+QGAKSRGASKII VDINN K+Q+S +FG
Sbjct: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXX 301
           ATDF+NPKEDL E +TIV+KLI+MTDGGL++TFDCTGN  +MRDALEACHKGWG+S    
Sbjct: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIG 368

Query: 302 XXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361
                   STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQ+G LKV+EFITHRRPF 
Sbjct: 369 VAGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428

Query: 362 EINQAFEDLHNGDCLRTVL 380
           EIN AFEDLH+GDCLRTVL
Sbjct: 429 EINDAFEDLHHGDCLRTVL 447

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/381 (78%), Positives = 332/381 (87%)

Query: 4   ATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEG 63
           +T GKP+  +AAVAY A K LSVEEITVDPPKAHEVRI+++ TAVCHTDAYTLSG+DPEG
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 64  LFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123
            FP ILGHEGAGIVESVG+ V +VKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183
           KGVMPDGT+RF N KGE + HFMGCSTFSEYTVVADVSVVA+DPKAPL++ACLLGCGVTT
Sbjct: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTT 181

Query: 184 GYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243
           GYGAA+KTANVQ+GDTVA+FG GTVGLSV QGAK+RGAS+II VDIN+ K++Y   FGAT
Sbjct: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241

Query: 244 DFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXX 303
           DFINP  DL   QTIVEKLI+MTDGGLDFTFDCTGN  +MRDALEACHKGWG S      
Sbjct: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVA 301

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEI 363
                 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ GALKV+EFIT+RRPFK+I
Sbjct: 302 ASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361

Query: 364 NQAFEDLHNGDCLRTVLRFQE 384
           N+AFEDLH GD LRTVL + +
Sbjct: 362 NEAFEDLHAGDSLRTVLNYTD 382

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/377 (77%), Positives = 319/377 (84%), Gaps = 1/377 (0%)

Query: 4   ATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEG 63
           + VGKPI C AA+AY A K L+V EI VDPPKAHEVRIKI  TAVCHTDAY+LSG DPEG
Sbjct: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61

Query: 64  LFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123
           LFPC+LGHEG+GIVES+G DV  VK GDHVIALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183
           KGVMPDGTTRFH+  G+ IYHFMGCSTFS+YTVVADVS+VA D     +   LLGCGVTT
Sbjct: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181

Query: 184 GYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243
           GYGAAIKTAN+Q+GDTVAVFG GTVGLSV+QGAKSRGASKII VD+NN K+ +S  FGAT
Sbjct: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241

Query: 244 DFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXX 303
           DF+NPKE L + + IV KLI+MTDGGLDFTFDCTGN N+MR+ALEACHKGWGQS      
Sbjct: 242 DFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEI 363
                 +TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQSG LKV+EFIT RRPF EI
Sbjct: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360

Query: 364 NQAFEDLHNGDCLRTVL 380
           N AFEDLHNG CLRTVL
Sbjct: 361 NAAFEDLHNGSCLRTVL 377

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/382 (78%), Positives = 332/382 (86%)

Query: 3   AATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPE 62
           AAT GK I CVAAVAY A K L+VEEITV+ P+AHEVRIKIE+TAVCHTDAYTLSG DPE
Sbjct: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63

Query: 63  GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122
           G FP ILGHEGAGIVESVG+ V  VKPGDHVIALYTAEC KCKFC SGKTNLCS+VRATQ
Sbjct: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
           GKGVMPDGT+RF N KGE++ HFMGCSTFS+YTVVADVSVVA+DP APL++ CLLGCGVT
Sbjct: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVT 183

Query: 183 TGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGA 242
           TGYGAA KTANVQ+GDTVAVFG GTVGLSV+QGAK RGAS+II VDIN++KR+Y + FGA
Sbjct: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243

Query: 243 TDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXX 302
           TDFINPK DL + QTIVEKLI+MTDGGLD+TFDCTGNT +MRDALEACHKGWG S     
Sbjct: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKV+EFIT+ RPF E
Sbjct: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363

Query: 363 INQAFEDLHNGDCLRTVLRFQE 384
           IN+AFEDLH GDCLRTVL  ++
Sbjct: 364 INKAFEDLHAGDCLRTVLDLKK 385

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/381 (76%), Positives = 320/381 (83%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           ++ T GK IQC AA+AY A   L +E ITVDPPKAHEVRIKI  TA+CHTDAYTLSG DP
Sbjct: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60

Query: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121
           EG+FP ILGHEG+GIVESVG  V  VK GDHVI LYTAEC +CKFC SGKTNLC +VRAT
Sbjct: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
           QGKG+MPDGT+RF N+KGE IYHFMGCSTFSEYTVVADVSVVAID KAPLD  CLLGCGV
Sbjct: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180

Query: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241
           TTGYGAA+KTA+VQ+GDTVAVFG GTVGLSV+QGA+SRGASKII VDIN+ K+++S +FG
Sbjct: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXX 301
           ATDFINP +DL + +TIV KLIDMTDGGLD TFDCTGNT +MRDALEACHKGWGQS    
Sbjct: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 302 XXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361
                   STRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY +G LKV+EF+TH RPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360

Query: 362 EINQAFEDLHNGDCLRTVLRF 382
           EIN    DLH+GDCLRTVL F
Sbjct: 361 EINDGLTDLHHGDCLRTVLNF 381

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/383 (77%), Positives = 330/383 (86%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           ++ TVGKPI C+AAVAY A K L+VEEI V+PPKAHEVRI+I +TAVCHTDAYTLSG DP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121
           EG FP ILGHEGAG+VESVG  V  VKPGDHV+ALYTAEC KCKFCTSGKTNLC +VRAT
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
           QGKGVMPDGT+RF    GE I HFMGCSTFS+YTVVADVSVVA+D +APLD  CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241
           TTGYGAAIKTANVQ+GDTVAVFG GTVGLSV+QGAK+RGAS+II VDIN++K+Q++S+FG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXX 301
           ATDF+NP +DL E +TIV KLI++TDGGLDFTFDCTGNT +MRDALEACHKGWGQS    
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 302 XXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361
                   STRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRRPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 362 EINQAFEDLHNGDCLRTVLRFQE 384
           EIN AF+DLH+GDCLRTVL   +
Sbjct: 361 EINAAFDDLHHGDCLRTVLDLSK 383

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/381 (76%), Positives = 330/381 (86%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           ++ T GKPIQC AAVAY A + L +E++TVDPPKAHEVRIKI  +A+CHTDAYTLSGSDP
Sbjct: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60

Query: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121
           EGLFPCILGHEG+GIVESVG+ V  VKPGDHV+ LYTAEC +CKFC SGKTNLC AVRAT
Sbjct: 61  EGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
           QGKGVMPDGT+RF N KGE +YHFMGCSTFSEYTVVADVSVVA+D +APL+  CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGV 180

Query: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241
           TTGYGAA+KTA+VQEGDTVAVFG GTVGLSV+QGAK+R AS+II VDIN+ KR+++S FG
Sbjct: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXX 301
           ATDFINPK DL E +TIV +LI+MTDGGLD TFDCTGNT +MRDALEACHKGWGQS    
Sbjct: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 302 XXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361
                   STRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY +G LKV+EF+TH+RPF+
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360

Query: 362 EINQAFEDLHNGDCLRTVLRF 382
           EIN  FEDLH+GDCLRTVL  
Sbjct: 361 EINSGFEDLHHGDCLRTVLSL 381

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/383 (74%), Positives = 322/383 (84%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           ++ T GKPI+C+AAVAY A + L+VEEI V+PP+AHEVRIKI  TAVCHTDAYTLSG DP
Sbjct: 1   MSETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDP 60

Query: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121
           EG FPC+LGHEG+GIVESVG+ V +VK GDHVIALYTAECG CKFC SGKTNLC +VR T
Sbjct: 61  EGAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRET 120

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
           QGKGVMPDGT+RF N KGE + HFMGCSTFS+YTVVADVSVVAI+  APL + CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGV 180

Query: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241
           TTGYGAAIKTANVQ+ DTVAVFG GTVGLSV+QGA++RGASKII VD+N+KK  YS  FG
Sbjct: 181 TTGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFG 240

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXX 301
           ATDFINP  DL   +TIV KL++MTDGGLD TFDCTGN  +MRDALE CHKGWGQS    
Sbjct: 241 ATDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIG 300

Query: 302 XXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361
                   STRPFQLVTGRVWKGSAFGG+KGRSEMGGLI+ YQ G LKV++FIT++RPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFT 360

Query: 362 EINQAFEDLHNGDCLRTVLRFQE 384
           EIN AFEDLH+GDCLRTVL  ++
Sbjct: 361 EINAAFEDLHHGDCLRTVLDLEK 383

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/381 (72%), Positives = 318/381 (83%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           +++T GK IQC AAVAY AKK L V+++ VD PKAHEVRIKI  TA+CHTDAYTLSG DP
Sbjct: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60

Query: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121
           EGLFPCILGHEG+GIVES+G+ V +VK GDHVI LYTAEC KCKFC SGKTNLC AVR T
Sbjct: 61  EGLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
           QGKGVMPDGT+RFH  +G+DI+HFMGCSTFSEYTVVADVSVVAID K  L+ A LLGCGV
Sbjct: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180

Query: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241
           TTG+GAA+K ANVQ+GDTVAVFG GTVGLSV+QGA+ RG SK+I VDIN++K+Q+S +FG
Sbjct: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXX 301
           ATDF+NP  DL + +TIV KLI MTDGGLD+TFDCTGN ++MR+ALEACHKGWGQS    
Sbjct: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300

Query: 302 XXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361
                   STRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK++EFITHRR F 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360

Query: 362 EINQAFEDLHNGDCLRTVLRF 382
           EIN  FEDLH G CLRTVL+F
Sbjct: 361 EINDGFEDLHMGTCLRTVLKF 381

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/383 (67%), Positives = 305/383 (79%), Gaps = 3/383 (0%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPK-AHEVRIKIEFTAVCHTDAYTLS-GS 59
           +A T G+ I C AAVAY A K L+VE+ITV+ P  A       +   + H   +++  GS
Sbjct: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60

Query: 60  DPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVR 119
           +   +  C  G  GAG+VESVG DV +VK GDHVIALYTAEC +CK C SGKTNLCSAVR
Sbjct: 61  EVRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVR 119

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
           ATQGKGVMPDGT+RF N+KGE + HFMGCSTF+EYTVVADVSVVAID  APL+  CLLGC
Sbjct: 120 ATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGC 179

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSN 239
           GVTTGYGAA+KTANVQ+GDTVAVFG GT+GLSV+QGAK+R ASKII VDIN+ K++++ +
Sbjct: 180 GVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFD 239

Query: 240 FGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXX 299
           FGATDF+NPK DL + QTIVEKL++MTDGGLDFTFD TGN  +MRDALEACHKGWGQS  
Sbjct: 240 FGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSII 299

Query: 300 XXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRP 359
                     STRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G LK++EFIT++RP
Sbjct: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359

Query: 360 FKEINQAFEDLHNGDCLRTVLRF 382
           FKEIN+ FEDLH+GDCLRTVL +
Sbjct: 360 FKEINEGFEDLHHGDCLRTVLNY 382

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  513 bits (1320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/380 (66%), Positives = 285/380 (75%), Gaps = 46/380 (12%)

Query: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60
           +++ T GKPI C AAVAY A K L+VE+I VDPPKAHEVRIKI++TAVCHTDAYTLSG D
Sbjct: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144

Query: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEG FP ILGHEG+GIVESVG+ V  VK GDHVIALYTAECG+CKFC SG          
Sbjct: 145 PEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX------- 197

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
                                                      A+D  AP+D+ CLLGCG
Sbjct: 198 ---------------------------------------XXXXAVDKNAPMDSICLLGCG 218

Query: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240
           VTTGYGAAIKTANVQ+GDTVAVFG GTVGLSV+QGAK+RGASKII VD+N++K+Q+S +F
Sbjct: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278

Query: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXX 300
           GATDFINPK DL E +TIV KLI+MTDGGL++TFDCTGNT +MRDALEACHKGWG+S   
Sbjct: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIII 338

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G LKV+EFITHRRPF
Sbjct: 339 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398

Query: 361 KEINQAFEDLHNGDCLRTVL 380
            EIN AFEDLH+GDCLRTVL
Sbjct: 399 TEINNAFEDLHHGDCLRTVL 418

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  432 bits (1112), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 202/375 (53%), Positives = 274/375 (73%), Gaps = 3/375 (0%)

Query: 7   GKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFP 66
           G+PI+C AAVAY+  K L +E+I VDPP+ HEVR+K+  TA+C TD +TL G +PEG FP
Sbjct: 6   GEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKFP 65

Query: 67  CILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           C+LGHEG+GIVES G  V TVK GDHV+ LY  ECG C  C S K+NLCS ++ATQ +GV
Sbjct: 66  CVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQGV 125

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYG 186
           MP G++R HN + + ++HFMGCS+FS+Y VV+D+S V I   APLD  CLLGCGVTTG+G
Sbjct: 126 MPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGFG 185

Query: 187 AAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFI 246
           A I    V+ GD VAVFG GTVGLSV+Q        ++I VD+ + KR+++  FGATDFI
Sbjct: 186 API-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDFI 244

Query: 247 NPKEDLAEDQTIVEKLIDMTDG-GLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXX 305
           NP++ + +++++++ LID + G G DFTFDCTG+T++MR ALE+C KGWG S        
Sbjct: 245 NPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAGA 303

Query: 306 XXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQ 365
               ST P+ L+ GR W+G AFGG+KGRSE+  L++ Y +  +K++E+IT++RP KEIN+
Sbjct: 304 GEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEINE 363

Query: 366 AFEDLHNGDCLRTVL 380
           A ++L +G  L+TVL
Sbjct: 364 ALKELEDGLVLKTVL 378

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score =  107 bits (268), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 123/279 (44%), Gaps = 35/279 (12%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHE 72
           A V Y     L  +++TV  PK +E+ + ++++ VCH+D +   G  P  L FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V  +G +V   K GD   I      C  C++C  G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL----------DGT 121

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
              H+             TF EY     V    I P   L     + C   T Y  A+K 
Sbjct: 122 GFTHDG------------TFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY-KALKR 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           ANV  G  V + G CG +G   +Q A + G  ++I +D  N KR+     G   FI    
Sbjct: 169 ANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFI---- 223

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           D  E++ IV  +I  T+GG         N ++   A+EA
Sbjct: 224 DFTEEKDIVGAIIKATNGGSHGVI----NVSVSEAAIEA 258

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  102 bits (255), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 95/342 (27%), Positives = 147/342 (42%), Gaps = 48/342 (14%)

Query: 41  IKIEFTAVCHTDAYTLSGSDPE---------GLFPC-ILGHEGAGIVESVGDDVMTVKPG 90
           IK+  T++C TD     G +PE         G F   ILGHEG GI++ VGD V   K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 91  DHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST 150
           D VI    + CG C+ C     + C     T G G                I  +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 151 FSEY--TVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTV 208
            +EY  T  AD S+ ++      +AA +L   + T +   ++  NV+ GDTVA+ G G V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 209 GLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG 268
           G+  +  ++    S +I VDI++ +   +   G+T  IN  ++ A     V K+++ T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAKEDA-----VSKILEYTNG 274

Query: 269 -GLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW--KGS 325
            G+D   +  G      D  +   K  G                +P      ++W    +
Sbjct: 275 RGVDCVMEAVG-AQATWDICQRVIKEGGH-------LANVGVHGKPVNFEIDKLWIKNLT 326

Query: 326 AFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAF 367
              G+   +  G L+K   SG LK E  +TH   F E++  +
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNY 368

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score =  100 bits (249), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/279 (29%), Positives = 121/279 (43%), Gaps = 35/279 (12%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHE 72
           A V Y     L  ++I V  PKA+E+ + ++++ VCH+D +   G  P  L FP I GHE
Sbjct: 12  AIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQLKFPLIGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V  +G +V   K GD   I      C  C++C  G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
              H+             TF EY     V    +     L     + C   T Y  A+K 
Sbjct: 122 GFTHDG------------TFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVY-KALKR 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           AN+  G  V + G CG +G   +Q A + G  ++I +D    K+Q     G   FI    
Sbjct: 169 ANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLGGEVFI---- 223

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           D  +++ IV  +I  TDGG         N ++   A+EA
Sbjct: 224 DFTKEKDIVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 154/373 (41%), Gaps = 51/373 (13%)

Query: 13  VAAVAYNAKKSLSVEEITVDPPKAHEVR---IKIEFTAVCHTDAYTLSGSDPE------- 62
           + A+ Y     L  E+  +  PK  + R   IK+  T++C TD     G  PE       
Sbjct: 31  MKAMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVK 88

Query: 63  --GLFPC-ILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVR 119
             G F   +LGHEG GIV  VGD V  +K GD VI      CG C+ C  G    C    
Sbjct: 89  NEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC---- 144

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                  M DG            Y   G       T  AD S+ A+      + A LL  
Sbjct: 145 -------MNDGGWALG-------YSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLLSD 190

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSN 239
            + T +   ++  NV+ GD+VA+ G G VG+  +  ++    S +I VD+++ + + +  
Sbjct: 191 ALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKE 250

Query: 240 FGATDFINP-KEDLAEDQTIVEKLIDMTDG-GLDFTFDCTGNTNIMRDALEACHKGWGQS 297
            GAT  IN  KED       V K++++T+G G+D   +  G     +   + C     Q 
Sbjct: 251 MGATHTINSGKEDA------VAKILEITNGRGVDCAMEAVG----AQPTWDICQ----QI 296

Query: 298 XXXXXXXXXXXXSTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLIKDYQSGALKVEEFIT 355
                         +P      ++W    +   G+   +    L+K+  SG L+ ++ ++
Sbjct: 297 IKEGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVS 356

Query: 356 HRRPFKEINQAFE 368
           H   FK++   + 
Sbjct: 357 HHCNFKDMANNYN 369

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 126/279 (45%), Gaps = 35/279 (12%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y     L  ++I V  PK++E+ I I+++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAGIV  +G++V   K GD+  I      C  C++C     + C            PD  
Sbjct: 72  GAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC------------PDA- 118

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F +Y     V    I P   L     + C   T Y  A+K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY-KALKS 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           AN++ G+ VA+ G CG +G   +Q AK+ G  +++ +D  ++K       G   FI    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVFI---- 223

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           D  + + +V+ ++D T+GG         N ++   A+EA
Sbjct: 224 DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 103/371 (27%), Positives = 166/371 (44%), Gaps = 47/371 (12%)

Query: 20  AKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGI 76
           A +S  V EIT DP   H V+++I+ T +C +D  Y ++G+  + +   P ILGHE +G+
Sbjct: 17  AVESKPVPEIT-DP---HYVKLQIKKTGICGSDVHYYVAGAIGDFVVKKPMILGHESSGL 72

Query: 77  VESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFH 135
           V  VG +V  V+ GD V               +G+ NLC  ++      +  DGT  +++
Sbjct: 73  VVEVGSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTLVKYY 130

Query: 136 NAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQ 195
            A  + +       ++ E  +V  +SV                 GV      A K A V 
Sbjct: 131 LAPEDFLVKLPDHVSYEEGALVEPLSV-----------------GVH-----ANKLAGVA 168

Query: 196 EGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAED 255
               VAVFG G VGL     A++ GAS+++ +D+   K   SSNFG T F+N      ED
Sbjct: 169 FNQRVAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVNSANIKDED 228

Query: 256 QTIVEKLIDMTDGGL--DFTFDCTGNTNIMRDALEACHKG--WGQSXXXXXXXXXXXXST 311
             + E  I+   GG   D  FDCTG    +R  ++ C+ G  + Q             + 
Sbjct: 229 DLVKE--IERVLGGARPDVVFDCTGAEICIRTGIKVCNSGGTYVQVGMGHDDVNFPIGAI 286

Query: 312 RPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFE--D 369
              +L     ++  AFG  +   ++        SG + V+  +THR  F++   A+E   
Sbjct: 287 GAKELKVLGCFR-YAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNI 339

Query: 370 LHNGDCLRTVL 380
            H  + ++T++
Sbjct: 340 KHGSEVIKTII 350

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 125/294 (42%), Gaps = 65/294 (22%)

Query: 31  VDPPKA---HEVRIKIEFTAVCHTD----------------AYTLSGSDPEGLFPCILGH 71
           +D PK    HE+ I + +  +C TD                 + LSG D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 72  EGAGIVESVGDDVMTVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCSA 117
           E +GIV+ VG  V   KPGD V+   T  CG               C  C  G  N C+ 
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCCTH 133

Query: 118 VRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLL 177
             + QG G +  G                    F+E  VV +  VV I  K PLD A L+
Sbjct: 134 -GSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 178 GCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYS 237
              ++  + AA + A  +EG    V G G +GL+++   K   A KI+  +    +R+ +
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 238 SNFGATDFINPKEDLAEDQTIVEKLIDMT--DGGLDFTFDCTGNTNIMRDALEA 289
                  F NP    A  Q  +EKL +++  D G D+TFDC+G  +    A++A
Sbjct: 231 EKLNVVVF-NPTHTRA--QNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKA 281

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 120/279 (43%), Gaps = 35/279 (12%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHE 72
           A V Y     L  +++TV  PK +E+ + ++++ VCH+D +   G  P  L FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V  +G +V   K GD   I      C  C++C  G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
              H+             TF EY     V    I     L     + C   T Y  A+K 
Sbjct: 122 GFTHDG------------TFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVY-KALKR 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           AN+  G  V + G CG +G   +Q A + G  ++I +D    KR+     G   FI    
Sbjct: 169 ANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKLGGEIFI---- 223

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           D  +++ +   +I  T+GG         N ++   A+EA
Sbjct: 224 DFTKERDVAGAVIKATNGGSHGII----NVSVSEAAIEA 258

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 124/272 (45%), Gaps = 35/272 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L  ++I V  PK++E+ I ++++ VCHTD +   G  P     P + GHEGAG+V ++GD
Sbjct: 22  LEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGD 81

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
            V   K GD+  I      C  C++C  G  + C                         D
Sbjct: 82  AVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHA----------------------D 119

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I P + L     + C   T Y  A+K+AN++ G+ VA
Sbjct: 120 LSGYTHDGSFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY-KALKSANLRAGEWVA 178

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G CG +G   +Q AK+ G  +++ +D  ++K +   + G   FI    D  + + IV 
Sbjct: 179 ISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVFI----DFTKTKDIVG 233

Query: 261 KLIDMTDGGLDFTFDCTGNTNIMRDALEACHK 292
            +I  T+GG         N ++   A++A  K
Sbjct: 234 DIIKATNGGAHGVI----NVSVSEQAIDASVK 261

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 94.7 bits (234), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 131/309 (42%), Gaps = 69/309 (22%)

Query: 15  AVAYNAKKSLSVEEITVDPPKAHE--VRIKIEFTAVCHTD----------------AYTL 56
           A+AY  +K +   +    P  +HE  V I + +  VC +D                 + +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 57  SGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAEC--------------G 102
           SG   +GL P  +GHE +GIV  VG DV  VK GDHV+      C              G
Sbjct: 63  SG---QGL-PQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 103 KCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST--FSEYTVVADV 160
            C  C +G  N C+ +                        +  +GC +  F+E  V+++ 
Sbjct: 119 LCIACKTGNPNCCTDLG-----------------------FCGLGCQSGGFAEKIVLSER 155

Query: 161 SVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRG 220
           +VV I    PLD A L+     + +  A++ + +Q G T  V G G +GL+ +   +S G
Sbjct: 156 NVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQSHG 213

Query: 221 ASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTG 278
           A  II  +  + +RQ +   GA  F NP E       ++E L  +  G  G +F++DC G
Sbjct: 214 AGTIIVSEPADTRRQKAEALGAQTF-NPTE---HGDNVIEALRKLAPGGEGFNFSYDCCG 269

Query: 279 NTNIMRDAL 287
            +      L
Sbjct: 270 TSETFSAGL 278

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 119/279 (42%), Gaps = 35/279 (12%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHE 72
           A V Y     L  +++ V  PK +E+ + ++++ VCH+D +   G  P  L FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V  +G +V   K GD   I      C  C++C  G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
              H+             TF EY     V    I     L     + C   T Y  A+K 
Sbjct: 122 GFTHDG------------TFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVY-KALKR 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           AN+  G  V + G CG +G   +Q A + G  ++I +D    K++         FI    
Sbjct: 169 ANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELHGEIFI---- 223

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           D  +++ +V  +I  TDGG         N ++   A+EA
Sbjct: 224 DFTKEKDVVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 35/279 (12%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y     L  ++I V  PK++E+ I ++++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V ++G++V   K GD+  I      C  C++C     + C            P+  
Sbjct: 72  GAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC------------PEA- 118

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY-KALKS 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           AN++ G+ VA+ G CG +G   +Q AK+ G  +++ +D   +K       G   FI    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVFI---- 223

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           D  + + +V+ ++D T+GG         N ++   A+EA
Sbjct: 224 DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 116/264 (43%), Gaps = 31/264 (11%)

Query: 9   PIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPC 67
           P    A V Y     L    I V  PK +E+ I ++++ VCHTD +   G  P  +  P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 68  ILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           + GHEGAG+V + G +V   + GD+  I      C  C+ C  G  + C           
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQA-------- 144

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYG 186
                         D+  +    +F +Y     V    I     L     + C   T Y 
Sbjct: 145 --------------DLSGYTHDGSFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 187 AAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDF 245
            A+KTA+V+ G  VA+ G CG +G   +Q AK+ G  +++ +D  ++K++   + G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 246 INPKEDLAEDQTIVEKLIDMTDGG 269
           +    D  +  +IV+ + D+T+GG
Sbjct: 249 V----DFTKTHSIVKDIQDVTNGG 268

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 128/288 (44%), Gaps = 37/288 (12%)

Query: 15  AVAYNAKKSLSVEEITVDPPK-AHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILG 70
           AV    K+ + +E   +   K  H+V+I+I+ T +C +D  Y   GS  + +   P +LG
Sbjct: 6   AVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFTQGSIGDFVVKSPLVLG 65

Query: 71  HEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCS--AVRATQGKGVMP 128
           HE AG+V  VGD V +VK GD V           K   SG  NLC   A  AT       
Sbjct: 66  HESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY---- 121

Query: 129 DGTTRFHNAKGED-IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGA 187
           DGT   +    ED +Y      +F E  VV  +SV                         
Sbjct: 122 DGTLVKYYLSPEDFVYKLADHISFEEGAVVEPLSVAV----------------------H 159

Query: 188 AIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN 247
           A + AN   G  V V G G VGL     AK+ GA+ ++ VDI   K + +  FGAT  + 
Sbjct: 160 ANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVL 219

Query: 248 PKEDLAEDQTIVEKLIDMTDGGL--DFTFDCTGNTNIMRDALEACHKG 293
            K D  E+  +   L+  + GGL  D  F+C+G    +R A+++  +G
Sbjct: 220 FKPDSDENDLV--SLVTKSLGGLHPDVVFECSGAEKCIRAAVKSVKRG 265

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 119/271 (43%), Gaps = 31/271 (11%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L +T+  P      + Y     L  +++ V  PK +E+ I + ++ VCHTD +   G  P
Sbjct: 21  LQSTLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWP 80

Query: 62  EGL-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
            G   P + GHEGAG+V + G  V   + GD+  I      C  C+FC  G  + C+   
Sbjct: 81  LGAKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKA- 139

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                                D+  +    +F +Y     +    I     L     + C
Sbjct: 140 ---------------------DLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILC 178

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
              T Y  A+K ++V+ G  VA+ G  G +G   +Q AK+ G  +++ +D  ++KR+   
Sbjct: 179 AGVTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFE 236

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
           + G   F+    D  + + +V ++ ++T+GG
Sbjct: 237 SLGGNHFV----DFTKTKDLVSEIQEITEGG 263

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/261 (29%), Positives = 117/261 (44%), Gaps = 29/261 (11%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLF---PCILGHEGAGIVESVGDDVMTVKPGDHV 93
           H V+++I+ T +C +D +  +           P +LGHE +GIV  VG +V  V  GD V
Sbjct: 31  HFVKVQIKATGICGSDVHFCTHGAIGSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED-IYHFMGCSTFS 152
                      +   SG  NLC  ++      V  DGT   +    ED +Y      TF 
Sbjct: 91  AIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGTLLKYFQVPEDFVYKLPDDVTFE 148

Query: 153 EYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSV 212
           E  +V  ++V                         A+K A V+ GD V VFG G VGL V
Sbjct: 149 EGALVEPLAVAV----------------------HAVKLAGVKFGDKVVVFGAGPVGLLV 186

Query: 213 MQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDF 272
               K+ GA++++++D+ +KK   S   G+T  IN K D+AE+   +E   D+     + 
Sbjct: 187 GSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAINSK-DMAEEALALEIQNDLNGQHPNK 245

Query: 273 TFDCTGNTNIMRDALEACHKG 293
             DCTG    +R ++ AC  G
Sbjct: 246 VIDCTGAEPCLRSSILACKPG 266

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 115/259 (44%), Gaps = 31/259 (11%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y     L   +I V  PK  E+ I ++++ VCHTD +   G  P     P + GHE
Sbjct: 9   AVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V ++G++V   K GD   I      C  C++C     + C            PD  
Sbjct: 69  GAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC------------PDA- 115

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K+
Sbjct: 116 ---------DLSGYTHDGSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALKS 165

Query: 192 ANVQEGDTVAVFGC-GTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           A +Q G+ VA+ G  G +G   +Q AK+ G  +I+ +D   +K++     G   FI    
Sbjct: 166 ARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYFI---- 220

Query: 251 DLAEDQTIVEKLIDMTDGG 269
           D AE + +V ++I +T+GG
Sbjct: 221 DFAESKDVVAEVIKVTNGG 239

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 91.3 bits (225), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 120/269 (44%), Gaps = 35/269 (13%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGD 82
           L  +EI V  PKA+E+ I ++++ VCHTD +   G  P  +  P + GHEGAGIV ++GD
Sbjct: 21  LEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVAMGD 80

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
            V     GD+  I      C  C+ C     + C     +   G   DG           
Sbjct: 81  SVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS---GYTHDG----------- 126

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
                   +F +Y     V    I     L     + C   T Y  A+K+AN++ GD VA
Sbjct: 127 --------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KALKSANLKAGDWVA 177

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G CG +G   +Q A + G  +++ +D   +K +     G   FI    D  + + ++ 
Sbjct: 178 ISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYFI----DFTKCKDVIA 232

Query: 261 KLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           +++++TDGG         N ++   A+EA
Sbjct: 233 EILEVTDGGAHGVI----NVSVSEAAIEA 257

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 91.3 bits (225), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 117/257 (45%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y     L  ++I V  PKA+E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD   I      C  C++C     + C            PD    
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA--- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+A+
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSAD 167

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ GD VA+ G CG +G   +Q AK+ G  +++ +D   +K +     G   F+    D 
Sbjct: 168 LKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYFV----DY 222

Query: 253 AEDQTIVEKLIDMTDGG 269
           A  + ++++++D T+GG
Sbjct: 223 AVSKDLIKEIVDATNGG 239

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 122/277 (44%), Gaps = 35/277 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y +   L  ++I V  PK +E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++GD+V   K GD   I    + C  C++C  G  + C                  
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ G  VA+ G  G +G   +Q AK+ G  +++ +D    K +  ++ G   FI    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVFI----DF 222

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
            +++ IV  ++  TDGG         N ++   A+EA
Sbjct: 223 TKEKDIVSAVVKATDGGAHGIV----NVSVSEAAIEA 255

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 116/271 (42%), Gaps = 31/271 (11%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L +T   P      + Y     L  ++I V  PK +E+ I ++++ VCHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 62  EGL-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
             +  P + GHEGAG+V  +G +V   K GD   I      C  C+FC SG  + C    
Sbjct: 84  LAVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                   P+           D+  +    +F ++     +    I P   L     + C
Sbjct: 140 --------PEA----------DLSGYTHDGSFQQFATADAIQAAKIQPGTDLAEVAPILC 181

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
              T Y  A+K AN++ GD VA+ G  G +G   +Q A + G  +++ +D   +K +   
Sbjct: 182 AGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFK 239

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
             G   FI    D  + + +V  + + T GG
Sbjct: 240 QLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 124/280 (44%), Gaps = 35/280 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y +   L  + I V  PK +E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++GD+V   K GD   +    + C  C++C  G  + C                  
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ G+ VA+ G  G +G   +Q AK+ G  +++ +D    K++  ++ G   FI    D 
Sbjct: 168 LRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVFI----DF 222

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHK 292
            +++ I+  ++  TDGG         N ++   A+EA  K
Sbjct: 223 TKEKDIIGAVVKATDGGAHGII----NVSVSEAAIEASTK 258

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 121/277 (43%), Gaps = 35/277 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y +   L  ++I V  PKA+E+ I ++++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G++V   K GD+  I      C  C++C  G  + C                  
Sbjct: 71  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           +  G  VA+ G  G +G   +Q AK+ G  +++ +D    K +   + G   FI    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
            +++ IV  ++  TDGG         N ++   A+EA
Sbjct: 223 TKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEA 255

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 116/257 (45%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y     L  ++I V  PKA+E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 13  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 72

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V   K GD   I      C  C++C     + C            P+    
Sbjct: 73  GVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNC------------PEA--- 117

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 118 -------DLSGYTHDGSFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY-KALKSAN 169

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q AK+ G  +++ +D   +K +   + G   FI    D 
Sbjct: 170 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYFI----DF 224

Query: 253 AEDQTIVEKLIDMTDGG 269
            + + I E++I+ T GG
Sbjct: 225 TKSKNIPEEVIEATKGG 241

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 108/386 (27%), Positives = 164/386 (42%), Gaps = 62/386 (16%)

Query: 15  AVAYNAKKSLSVEEITV----DPPKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF---- 65
           AV    +  ++ E+I V    DP   H V++ I+ T +C +D  Y  +G+   G F    
Sbjct: 7   AVVLQKQGLITFEDIPVPQIEDP---HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKD 61

Query: 66  PCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKG 125
           P +LGHE +G+V  VG  V +VK GD V           K   SG  NLC ++       
Sbjct: 62  PMVLGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPP 121

Query: 126 VMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTT 183
           +  DGT   +    ED    +  S   E                  + AC+  L  GV  
Sbjct: 122 I--DGTLLKYYLSPEDFLVKLPDSVSFE------------------EGACVEPLSVGVH- 160

Query: 184 GYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSR--GASKIIAVDINNKKRQYSSNFG 241
               A K A+V+ G  V VFG G VGL  + GA SR  GA+ ++ VD+ + K + ++ FG
Sbjct: 161 ----ANKLADVRFGSKVVVFGAGPVGL--LAGAVSRAFGATDVVFVDVFDHKLERTNEFG 214

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKG-----WGQ 296
           AT  +N  +  +ED  + E    ++    +  F+C+G    +R  ++AC  G      G 
Sbjct: 215 ATQTVNSSKFKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAGGRYVQVGM 274

Query: 297 SXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITH 356
                        S     L T R   G     +K  SE          G + V+  ITH
Sbjct: 275 GKDNVNFPISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNVKPLITH 324

Query: 357 RRPFKEINQAFE--DLHNGDCLRTVL 380
           R  F++  +A+E    H  D ++T++
Sbjct: 325 RFKFQDAIKAYEFNIEHGEDVVKTII 350

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 89.4 bits (220), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 113/259 (43%), Gaps = 31/259 (11%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y     L   +I V  PKA E+ I ++++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V ++G++V   K GD   I      C  C++C     + C            P+  
Sbjct: 72  GAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC------------PEA- 118

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKS 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           AN++ GD VA+ G CG +G   +Q A + G  +++ +D   +K Q     G   FI    
Sbjct: 169 ANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVFI---- 223

Query: 251 DLAEDQTIVEKLIDMTDGG 269
           D  + + IV  ++  T+GG
Sbjct: 224 DFRKSKDIVADVVKATNGG 242

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 116/257 (45%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y     L  ++I V  PKA+E+ I ++++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 14  IFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGHEGA 73

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V   K GD+  I      C  C++C     + C            P+    
Sbjct: 74  GVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC------------PEA--- 118

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 119 -------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSAN 170

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           +  G+ VA+ G CG +G   +Q AK+ G  +I+ +D  ++K       G   FI    D 
Sbjct: 171 LSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVFI----DF 225

Query: 253 AEDQTIVEKLIDMTDGG 269
            + + I   +I+ T+GG
Sbjct: 226 TKTKDIEAAVIEATNGG 242

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 123/272 (45%), Gaps = 35/272 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L  ++I V  PK++E+ + I+++ VCHTD +   G  P +   P + GHEGAGIV ++GD
Sbjct: 22  LEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGAGIVVAIGD 81

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD+  +      C  C++C  G  + C                    NA   D
Sbjct: 82  NVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCP-------------------NA---D 119

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I     L     + C   T Y  A+K+AN++ G+ VA
Sbjct: 120 LSGYTHDGSFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALKSANLRAGEWVA 178

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G CG +G   +Q A + G  +++ +D  + K +         FI    D  + + ++ 
Sbjct: 179 ISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFI----DFTKTKDVIS 233

Query: 261 KLIDMTDGGLDFTFDCTGNTNIMRDALEACHK 292
           ++  +T+GG         N ++   A+EA  K
Sbjct: 234 EVNKVTNGGAHGVI----NVSVSEAAIEASTK 261

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 89.0 bits (219), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 116/271 (42%), Gaps = 31/271 (11%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L +T+  P      + Y     L  ++I V  PK +E+ I ++++ VCHTD +   G  P
Sbjct: 24  LQSTIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 62  EGL-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
             +  P + GHEGAG+V  +G +V   K GD   I      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                   PD           D+  +    +F ++     +    I     L     + C
Sbjct: 140 --------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
              T Y  A+K AN++ GD VA+ G  G +G   +Q A + G  +++ +D   +K +   
Sbjct: 182 AGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFK 239

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
             G   FI    D  + + +V  + + T GG
Sbjct: 240 QLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 122/277 (44%), Gaps = 35/277 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y +   L  ++I V  PK +E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 70

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V   K GD   I    + C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ G  VA+ G  G +G   +Q AK+ G  +++ +D    K +  ++ G   FI    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVFI----DF 222

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
            +++ IV  +I  TDGG         N ++   A+EA
Sbjct: 223 TKEKDIVGAVIKATDGGAHGIV----NVSVSEAAIEA 255

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 120/277 (43%), Gaps = 35/277 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y +   L  ++I V  PKA+E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD+  I      C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           +  G  VA+ G  G +G   +Q AK+ G  +++ +D    K +   + G   FI    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
            +++ IV  ++  TDGG         N ++   A+EA
Sbjct: 223 TKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEA 255

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 88.6 bits (218), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 116/271 (42%), Gaps = 31/271 (11%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L +T   P      + Y  K  L  ++I V  PK +E+ I ++++ VCHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 62  EGL-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
             +  P + GHEGAG+V  +G +V   K GD   I      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                   PD           D+  +    +F ++     +    I     L     + C
Sbjct: 140 --------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
              T Y  A+K A+++ GD VA+ G  G +G   +Q A + G  +++ +D   +K +   
Sbjct: 182 AGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFK 239

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
             G   FI    D  + + +V  + + T GG
Sbjct: 240 KLGGEVFI----DFTKTKNMVSDIQEATKGG 266

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 116/269 (43%), Gaps = 31/269 (11%)

Query: 4   ATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-E 62
           AT   P +    + Y     L  E+I V  PK +E+ I ++++ VCHTD +   G  P  
Sbjct: 24  ATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLP 83

Query: 63  GLFPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRAT 121
              P + GHEGAG+V ++G++V   K GD   I      C  C++C     + C      
Sbjct: 84  TKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHA--- 140

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
                              D+  +    +F +Y     V    I     L     + C  
Sbjct: 141 -------------------DLSGYTHDGSFQQYATADYVQAARIPEGTDLAEVSPILCAG 181

Query: 182 TTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240
            T Y  A+K+AN++ GD VA+ G  G +G   +Q AK+ G  +++ +D   +K +     
Sbjct: 182 VTVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKKL 239

Query: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGG 269
           G   FI    D  + + +VE + + T+GG
Sbjct: 240 GGEVFI----DFTKHKNLVEAVQEATNGG 264

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 121/279 (43%), Gaps = 35/279 (12%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y +   L  ++I V  PK +E+ I ++++ VCHTD +   G  P     P + GHE
Sbjct: 9   AIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V  +G++V   K GD+  I      C  C++C  G  + C                
Sbjct: 69  GAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHA------------- 115

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F EY     V    I     L     + C   T Y  A+K+
Sbjct: 116 ---------DLSGYTHDGSFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY-KALKS 165

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           AN++ G   A+ G  G +G   +Q AK+ G  +++ +D    K +  ++ G   FI    
Sbjct: 166 ANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVFI---- 220

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           D  +++ IV  ++  T+GG         N ++   A+EA
Sbjct: 221 DFTKEKDIVSAVVKATNGGAHGII----NVSVSEAAIEA 255

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 120/277 (43%), Gaps = 35/277 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y +   L  ++I V  PKA+E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD   I      C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    + P   L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           +  G  VA+ G  G +G   +Q AK+ G  ++I +D    K +   + G   F+    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVFV----DF 222

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
            +++ IV  ++  T+GG         N ++   A+EA
Sbjct: 223 TKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEA 255

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 119/277 (42%), Gaps = 35/277 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y +   L  ++I V  PKA+E+ I ++++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD   I      C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY-KALKSAN 167

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           +  G  VA+ G  G +G   +Q AK+ G  +++ +D    K +   + G   FI    D 
Sbjct: 168 LSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
             ++ IV  +I  TDGG         N ++   A+EA
Sbjct: 223 TTEKDIVGAVIKATDGGAHGII----NVSVSEAAIEA 255

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 118/271 (43%), Gaps = 31/271 (11%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGD 82
           L  ++I V  PK+ E+ I ++++ VCHTD +   G  P     P + GHEGAGIV  VG+
Sbjct: 22  LEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGIVVQVGE 81

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   I      C  C++C  G  + C                    NA   D
Sbjct: 82  NVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCP-------------------NA---D 119

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I     L     + C   T Y  A+K+AN++ G+ VA
Sbjct: 120 LSGYTHDGSFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY-KALKSANLRAGEWVA 178

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G  G +G   +Q AK+ G  +I+ +D   +K +     G   FI    D  + + IV 
Sbjct: 179 ISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIFI----DFTKTKDIVG 233

Query: 261 KLIDMTDGGLDFTFDCTGNTNIMRDALEACH 291
            +I  T+GG     + + +   +  + E C 
Sbjct: 234 DIIKATNGGAHGVINVSVSEAAIGASTEYCR 264

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 115/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y     L  ++I V  PKA+E+ + ++++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 14  IFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPLVGGHEGA 73

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V   K GD   I      C  C+ C  G  + C            P+    
Sbjct: 74  GVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC------------PEA--- 118

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I   A L     + C   T Y  A+K+AN
Sbjct: 119 -------DLSGYTHDGSFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY-KALKSAN 170

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           +Q GD VA+ G  G +G   +Q AK+ G  +++ +D   +K Q     G   FI    D 
Sbjct: 171 LQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVFI----DF 225

Query: 253 AEDQTIVEKLIDMTDGG 269
              + I  ++I  T+GG
Sbjct: 226 RTCKDIEGEIIKATNGG 242

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 116/271 (42%), Gaps = 31/271 (11%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L +T   P      + Y  K  L  ++I V  PK +E+ I ++++ VCHTD +   G  P
Sbjct: 24  LQSTAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 62  EGL-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
             +  P + GHEGAG+V  +G +V   K GD   I      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                   PD           D+  +    +F ++     +    I     L     + C
Sbjct: 140 --------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
              T Y  A+K A+++ GD VA+ G  G +G   +Q A + G  +++ +D   +K +   
Sbjct: 182 AGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFK 239

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
             G   FI    D  + + +V  + + T GG
Sbjct: 240 KLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 127/294 (43%), Gaps = 57/294 (19%)

Query: 15  AVAYNAKKSL----SVEEITVDPPKAHEVRIKIEFTAVCHTDAYT-LSGS---------- 59
           A+AY  K+ +     +EE  ++      + I++ +  +C +D +  L G           
Sbjct: 3   ALAYFGKQDIRYTKDLEEPVIETDDG--IEIEVSWCGICGSDLHEYLDGPIFFPEDGKVH 60

Query: 60  DPEGL-FPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAEC--------------GKC 104
           D  GL  P  +GHE +GIV  VG  V  +K GDHV+   T  C               +C
Sbjct: 61  DVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAEC 120

Query: 105 KFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVA 164
             C  G  N C+ +    G GV   G                    F+E  VV++  VV 
Sbjct: 121 AACQRGFYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVK 159

Query: 165 IDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKI 224
           I    PLD A L+     + +  A++ + +Q+G +  V G G +GL+ +   +  GASKI
Sbjct: 160 IPNTLPLDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKI 217

Query: 225 IAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTG 278
           +  +    +R  ++  G   F +P E   +   I++KL    + G DF +DC+G
Sbjct: 218 VVSEPAEIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 115/261 (44%), Gaps = 31/261 (11%)

Query: 9   PIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPC 67
           P+   A +       L ++ I V  PKA+E+ I ++F+ VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 68  ILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           + GHEGAGIV ++G  V   K GD+  I    + C  C+ C       C+          
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYA-------- 121

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYG 186
                         DI  F    +F +Y     V    I P   L     + C   T + 
Sbjct: 122 --------------DISGFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF- 166

Query: 187 AAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDF 245
            A+KTAN+  G+ VA+ G CG +G   +Q AK+ G S ++ +D   +K    ++ G   F
Sbjct: 167 KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVF 225

Query: 246 INPKEDLAEDQTIVEKLIDMT 266
           +    D ++ + +V +++  T
Sbjct: 226 L----DFSKSENLVPEVVSAT 242

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 111/257 (43%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y     L  ++I V  PK++E+ I +E++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 40  IFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 99

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +GD+V   K GD   I      C  C+ C +G    C                  
Sbjct: 100 GVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHA--------------- 144

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+KTA+
Sbjct: 145 -------DLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY-KALKTAD 196

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q A + G  ++I +D    K++     G   FI    D 
Sbjct: 197 LKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVFI----DF 251

Query: 253 AEDQTIVEKLIDMTDGG 269
            + + IV+ + + T GG
Sbjct: 252 TKSKDIVKDIQEATHGG 268

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 114/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y     L  ++I V  PKA+E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 15  IFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 74

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G++V   K GD+  I      C  C++C     + C            P+    
Sbjct: 75  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC------------PEA--- 119

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 120 -------DLSGYTHDGSFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALKSAN 171

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           +  G+ VA+ G  G +G   +Q AK+ G  +I+ +D  ++K+      G   F+    D 
Sbjct: 172 LNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIFV----DF 226

Query: 253 AEDQTIVEKLIDMTDGG 269
            + + + + ++  T+GG
Sbjct: 227 TKSKNVEQDILVATNGG 243

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 114/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y    +L  ++I V  P  +E+ I ++++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 14  IFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 73

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G +V   K GD+  I      C  C+ C  G  + C                  
Sbjct: 74  GVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQA--------------- 118

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I P   L     + C   T Y  A+K+A 
Sbjct: 119 -------DLSGYTHDGSFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY-KALKSAE 170

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ G  VA+ G CG +G   +Q AK+ G  +++ +D  ++K +     G   FI    D 
Sbjct: 171 LEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYFI----DF 225

Query: 253 AEDQTIVEKLIDMTDGG 269
            + + I+ +++  T+GG
Sbjct: 226 TKCKDIIGEVVKATNGG 242

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 111/249 (44%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGD 82
           L   +I V  PK++E+ I ++++ VCHTD +   G  P  +  P + GHEGAG+V  +G+
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   I      C  C+ C +G    C                      +  D
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANC----------------------EHAD 148

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I   + L     + C   T Y  A+KTAN++ G+ VA
Sbjct: 149 LSGYTHDGSFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G  G +G   +Q AK+ G  +++ +D   +K +   + G   F+    D  + + IV 
Sbjct: 208 ISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVA 262

Query: 261 KLIDMTDGG 269
            + + T GG
Sbjct: 263 DIQNATKGG 271

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 114/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y     L  ++I V  PK +E+ I ++++ VCHTD +   G  P     P + GHEGA
Sbjct: 37  IFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 96

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD   I      C  C++C     + C            PD    
Sbjct: 97  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA--- 141

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 142 -------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSAN 193

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q AK+ G  +++ +D   +K +     G   F+    D 
Sbjct: 194 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAFV----DF 248

Query: 253 AEDQTIVEKLIDMTDGG 269
            + + +V ++ ++T+GG
Sbjct: 249 TKTKDMVAEIQEITNGG 265

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 102/239 (42%), Gaps = 39/239 (16%)

Query: 65  FPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG--------------KCKFCTSG 110
            P  +GHE +GIV  VG  V  VK GDHV+    + C                C  C  G
Sbjct: 67  LPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAP 170
             NLC+      G GV+  G                    F+E  VV+   ++ +  + P
Sbjct: 127 SENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHHIIPVPKEIP 165

Query: 171 LDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDIN 230
           LD A L+     T +  A+K +  ++G +  V G G +GL  +   K  GASKI+  +I 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIA 223

Query: 231 NKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
            ++ + +   G   F NP +   +   I+  L    D G D+++DC+G       +L+A
Sbjct: 224 ERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 112/264 (42%), Gaps = 31/264 (11%)

Query: 9   PIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPC 67
           P      + Y +   L  ++I V  PK +E+ I ++++ VCHTD +   G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 68  ILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           + GHEGAG+V + G++VM  + GD   I      C  C+ C  G  + C           
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC----------- 141

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYG 186
                   H     D+  +    +F +Y     V    I     L     + C   T Y 
Sbjct: 142 -------LH----ADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY- 189

Query: 187 AAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDF 245
            A+KTA+++ G  VA+ G  G +G   +Q AK+ G  +I+ +D    K +   + G   F
Sbjct: 190 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVF 248

Query: 246 INPKEDLAEDQTIVEKLIDMTDGG 269
           I    D  + + IV  + + T GG
Sbjct: 249 I----DFTKTKDIVSAIQEATKGG 268

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 123/303 (40%), Gaps = 58/303 (19%)

Query: 15  AVAYNAKKSLSVEEITVDPP--KAHEVRIKIEFTAVCHTDAYTLS----------GSDPE 62
           A+AY  K  +   +   +P      EV I++ +  +C TD +  S          GS P 
Sbjct: 3   ALAYFKKGDIHFADDLPEPTINSDEEVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPL 62

Query: 63  G--LFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAEC-------------GK-CKF 106
                P  +GHE +GIV  +G  V  VK GDHV+      C             GK C  
Sbjct: 63  SGKKLPQPMGHEMSGIVSKIGSKVTKVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSA 122

Query: 107 CTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAID 166
           C  G  N+C+    T G G    G                    F+E   V+    + I 
Sbjct: 123 CEKGLVNICAHACFT-GLGTSGGG--------------------FAERLTVSQDHCIPIP 161

Query: 167 PKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIA 226
              PLD A L+     T + A  K A  Q+G T  V G G +GL+ +   K  GASKI+ 
Sbjct: 162 KDLPLDVAALVEPLSVTWHAA--KVAGFQKGQTACVLGAGPIGLATILTLKGLGASKIVV 219

Query: 227 VDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTGNTNIMR 284
            ++   +R  +++ G   F NP    AE +  + +L  + +G  G D  FDC+G      
Sbjct: 220 SELAQIRRDMAASMGVEVF-NP----AEHKDAIAELRKIPEGATGFDAAFDCSGVKATFN 274

Query: 285 DAL 287
            AL
Sbjct: 275 TAL 277

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 154/365 (42%), Gaps = 69/365 (18%)

Query: 40  RIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVMTVKPGDHVIAL 96
           ++ ++ T +C +D  Y  SG   + +   P +LGHE +G+V  VG  V  +K GD V   
Sbjct: 33  KVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRVAIE 92

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                       +GK NLC  +       +  DGT                      Y  
Sbjct: 93  PGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGTL------------------VKYYLS 132

Query: 157 VADVSVVAIDPKAPLDAACL--LGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQ 214
            AD  V   D  +  + AC+  L  GV +      K A V+ G TV VFG G VGL    
Sbjct: 133 PADFLVKLPDHVSFEEGACIEPLSVGVHSN-----KLAKVRFGQTVVVFGAGPVGLLTGA 187

Query: 215 GAKSRGASKIIAVDINNKKRQYSSNFGATDFIN----PKEDLAEDQTIVEKLIDMTDGGL 270
            AK+ GAS ++ VD+ ++K + + NFGAT  IN    PK D       VEKL+    G L
Sbjct: 188 VAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLL---GGAL 244

Query: 271 -DFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGG 329
            D  F+C+G  + +   ++A   G                     Q+  G+ +       
Sbjct: 245 ADVVFECSGAESCIDAGVKATKNGGTM-----------------VQIGMGKNYVNFPIAE 287

Query: 330 IKGRS-EMGGLIK----DYQ-------SGALKVEEFITHRRPFKEINQA--FEDLHNGDC 375
           + G+   + G  +    DY+       +G + V++ ITHR  F++  +A  F   H G+ 
Sbjct: 288 VSGKEMTLVGCFRYSYGDYKDAVNLVSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEV 347

Query: 376 LRTVL 380
           ++T++
Sbjct: 348 VKTII 352

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 123/279 (44%), Gaps = 35/279 (12%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y +  +L  +++ V  PK +E+ I I+++ VCHTD +   G  P +   P I GHE
Sbjct: 12  AVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V  +G +V   K GD+  +      C  C+ C     + C            P+  
Sbjct: 72  GAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC------------PEA- 118

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F EY     V    I   A L     + C   T Y  A+K+
Sbjct: 119 ---------DLSGYTHDGSFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY-KALKS 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           A++  G+ VA+ G CG +G   +Q AK+ G  +++ +D   +K++     G   F+    
Sbjct: 169 ADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVFL---- 223

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           D   ++ +   +I  T+GG         N ++   A+EA
Sbjct: 224 DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEA 258

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 110/249 (44%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGD 82
           L  ++I V  P A+E+ I ++++ VCHTD +   G  P     P + GHEGAG+V  +G+
Sbjct: 19  LEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVGIGE 78

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   I      C  C+ C     + C                         D
Sbjct: 79  NVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHA----------------------D 116

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I     L     + C   T Y  A+K+AN++ G+ VA
Sbjct: 117 LSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSANLRAGNWVA 175

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G  G +G   +Q AK+ G  ++I +D  ++K Q     G   F+    D  + + +V 
Sbjct: 176 ISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYFV----DFRKSKDVVA 230

Query: 261 KLIDMTDGG 269
           +++++T GG
Sbjct: 231 EILEVTGGG 239

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 107/249 (42%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L  +EI V  PK +E+ I + ++ VCHTD +   G  P     P + GHEGAG V ++G 
Sbjct: 50  LEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGEVIALGS 109

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   I      C  C+ C     + C            PD           D
Sbjct: 110 NVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC------------PDA----------D 147

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I P   L     + C   T Y  A+K+AN++ G  VA
Sbjct: 148 LSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY-KALKSANLKAGQWVA 206

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G  G +G   +Q AK+ G  +++ +D    K +     G   FI    D  ++  IV 
Sbjct: 207 ISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVFI----DFQKESDIVG 261

Query: 261 KLIDMTDGG 269
            +++ T+GG
Sbjct: 262 AVVNATNGG 270

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 111/249 (44%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCIL-GHEGAGIVESVGD 82
           L  ++I V  PK++E+ I + ++ VCH+D +   G  P  L   ++ GHEGAG+V  +G 
Sbjct: 22  LEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPLVGGHEGAGVVVGMGS 81

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD+  I      C  C+FC       C     T   G + DG           
Sbjct: 82  NVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GTVHDG----------- 127

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
                   +F +Y     V    I     L A   L C   T Y  A+K+AN++ G  VA
Sbjct: 128 --------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KALKSANMRPGQWVA 178

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G CG +G   +Q A + G  +++ +D   +K +Y    G   FI    D  + + +V 
Sbjct: 179 ISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVFI----DYKKSKDVVA 233

Query: 261 KLIDMTDGG 269
            +I  TDGG
Sbjct: 234 DVIKATDGG 242

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 129/307 (42%), Gaps = 61/307 (19%)

Query: 15  AVAYNAKKSLSVEEITVDPPKAH-----EVRIKIEFTAVCHTDAYT-LSG-----SDPE- 62
           A+AY  K  +     T D PK       EV I + +  +C +D +  L G      D E 
Sbjct: 3   ALAYFKKGDI---HFTNDIPKPEIQTDDEVLIDVSWCGICGSDLHEYLDGPIFMPKDGEC 59

Query: 63  ------GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG-------------- 102
                 GL P  +GHE +GIV  VG  V  VK GDHV+    + C               
Sbjct: 60  HALSNAGL-PLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSK 118

Query: 103 KCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
            C+ C  G  NLC+      G GV+  G                    F+E   V++  +
Sbjct: 119 PCEACKKGSENLCTH-GGFIGLGVISGG--------------------FAEQVAVSEHHI 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGAS 222
           + +  + PLD A L+     T +  A+K +  ++G +  V G G +GL  +   K  GA 
Sbjct: 158 IPVPKEIPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAG 215

Query: 223 KIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNI 282
           KI+  ++  ++ + + N G   F NP +   +   ++  L    D G D+++DC+G    
Sbjct: 216 KIVVSEVAERRIEMAKNLGVEVF-NPSKHGQKSIEVLRGLTKSHD-GFDYSYDCSGIQVT 273

Query: 283 MRDALEA 289
              +L+A
Sbjct: 274 FETSLKA 280

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 126/306 (41%), Gaps = 59/306 (19%)

Query: 15  AVAYNAKKSLSVEEITVDPPKA-----HEVRIKIEFTAVC------HTDAYTLSGSDPE- 62
           A+AY  K  +     T D PK       EV I + +  +C      +TD       D E 
Sbjct: 3   ALAYFKKGDI---HFTNDIPKPAIQADDEVIIDVSWCGICGSDLHEYTDGPIFMPKDGEC 59

Query: 63  -----GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG--------------K 103
                   P  +GHE +GI+  VG  V  VK GDHV+    + C                
Sbjct: 60  HALSNAALPLAMGHEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKP 119

Query: 104 CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVV 163
           C+ C  G  NLC A     G GV+  G                    F+E  VV++  ++
Sbjct: 120 CEACKKGSENLC-AHSGFVGLGVISGG--------------------FAEQVVVSEHHII 158

Query: 164 AIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASK 223
            +  + PLD A L+     T +  A+K +  ++G +  V G G +GL  +   K  GA K
Sbjct: 159 PVPKEIPLDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGK 216

Query: 224 IIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIM 283
           I+  ++  ++ + + +     F NP +   +   ++  L +  D G D+++DC+G     
Sbjct: 217 IVVSEVAERRLKMAKSLDVEVF-NPAQHGHKSVELLRGLTESHD-GFDYSYDCSGIQATF 274

Query: 284 RDALEA 289
             +L+A
Sbjct: 275 ETSLKA 280

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 161/373 (43%), Gaps = 58/373 (15%)

Query: 31  VDPPK---AHEVRIKIEFTAVCHTDAYTLSGSDPEGLF---PCILGHEGAGIVESVGDDV 84
           V+ PK   A++V ++I+ T +C +D +  +           P +LGHE +G+V  +GD+V
Sbjct: 23  VNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSPMVLGHESSGVVVLIGDNV 82

Query: 85  MTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGEDIY 143
            T+K GD V                G+ NL   ++         DGT T+++ A  + +Y
Sbjct: 83  KTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATPPY--DGTLTKYYRAPKDFVY 140

Query: 144 HFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVF 203
                 +F E  ++  +SV                         A + A ++ G    VF
Sbjct: 141 KIPDHVSFEEGALMEPLSVAV----------------------HANRLAKMRFGARCVVF 178

Query: 204 GCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAED---QTIVE 260
           G G VGL   + A   GA+ ++ VD++  K + +  FGAT  +N   DL +    +T++ 
Sbjct: 179 GAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN-SGDLPQGVSAETVIR 237

Query: 261 KLIDMTDGGLDFTFDCTGNTNIMRDALEAC-------HKGWGQSXXXXXXXXXXXXSTRP 313
           K I     G D  F+C+G    +R  +E C         G GQ             S  P
Sbjct: 238 KAIGKK--GADVVFECSGAQPCIRTGIEVCKAGGTYVQVGMGQEEIQFPI------SKIP 289

Query: 314 FQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFEDL--H 371
            + +T   ++GS F   +G  +    I+   SG L ++  IT R  FKE  +AF++   H
Sbjct: 290 AKEIT---FQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQFKEAIEAFDENRDH 343

Query: 372 NGDCLRTVLRFQE 384
             D ++T++   E
Sbjct: 344 PLDNVKTIIEGPE 356

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 109/257 (42%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y     L  +++ V  PK +E+ I ++++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 52  IFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGA 111

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V + G++V   + GD+  I      C  C+ C  G    C                  
Sbjct: 112 GVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHA--------------- 156

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+KTA+
Sbjct: 157 -------DLSGYTHDGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTAD 208

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           V+ G  VA+ G  G +G   +Q AK+ G  +++ +D    K++   + G   FI    D 
Sbjct: 209 VRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI----DF 263

Query: 253 AEDQTIVEKLIDMTDGG 269
              + +V  + + T GG
Sbjct: 264 RTTKDMVGAIQEATQGG 280

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 112/259 (43%), Gaps = 31/259 (11%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y     L  +++ V  PK +E+ I I+++ VCHTD +   G  P +   P I GHE
Sbjct: 12  AVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V  +G +V   K GD+  +      C  C+ C     + C            P+  
Sbjct: 72  GAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC------------PEA- 118

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F EY     V    I     L     L C   T Y  A+K+
Sbjct: 119 ---------DLSGYTHDGSFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY-KALKS 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           A++  G  VA+ G CG +G   +Q AK+ G  +++ +D   +K++     G   F+    
Sbjct: 169 ADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVFL---- 223

Query: 251 DLAEDQTIVEKLIDMTDGG 269
           D   ++ +   +I  T+GG
Sbjct: 224 DFRLEKDMEAAIIKATNGG 242

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 115/271 (42%), Gaps = 28/271 (10%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L +T+  P      + Y     L+ +++ V  PK +E+ I ++++ VCHTD +   G  P
Sbjct: 23  LQSTIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWP 82

Query: 62  EGL-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
             +  P + GHEGAGIV + G +V   + GD   I      C  C+ C  G  + C    
Sbjct: 83  LPVKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHA- 141

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                                D+  +    +F +Y          I     L     + C
Sbjct: 142 ---------------------DLSGYTHDGSFQQYATADATQAAQIPRGTDLAEVAPILC 180

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
              T Y  A+KTA +Q G+ VA+ G CG +G   +Q AK+ G  +++ +D    K +   
Sbjct: 181 AGVTVY-KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFK 238

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
             G   FI+  +    ++ +++ + + T GG
Sbjct: 239 ELGGETFIDFTK-YKNNEAMIKDIQEATKGG 268

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 110/259 (42%), Gaps = 31/259 (11%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A V Y     L  ++I V  PKA+E+ I ++++ VCHTD +   G  P     P + GHE
Sbjct: 42  AVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 101

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           G+G+V  VG++V   K GD   I      C  C+ C +G  + C                
Sbjct: 102 GSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHA------------- 148

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K 
Sbjct: 149 ---------DLSGYTHDGSFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY-KALKE 198

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           A+++ G  V + G  G +G   +Q AK+ G  ++I +D    K +   + G   FI    
Sbjct: 199 ADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVFI---- 253

Query: 251 DLAEDQTIVEKLIDMTDGG 269
           D  + + +V+ + + T GG
Sbjct: 254 DFTKSKDMVKDIQEATKGG 272

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 109/249 (43%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L   EI V  PK  E+ I ++++ VCHTD +   G  P     P + GHEGAG+V ++G+
Sbjct: 56  LEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGE 115

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   + GD   I      C  C+ C  G  + C            P+           D
Sbjct: 116 NVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC------------PEA----------D 153

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I     L     + C   T Y  A+K+AN++ G+ VA
Sbjct: 154 LSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLRAGNWVA 212

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G CG +G   +Q A++ G  +++ +D  ++K       G   F+    D  + + +V 
Sbjct: 213 ISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVFV----DFRKSKDVVA 267

Query: 261 KLIDMTDGG 269
            ++  T GG
Sbjct: 268 DVVKATGGG 276

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 123/290 (42%), Gaps = 31/290 (10%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L++T+  P      + Y +   L  +++ V  P+ +E+ + ++++ VCHTD +   G  P
Sbjct: 19  LSSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWP 78

Query: 62  -EGLFPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
            +   P + GHEGAG+V + G++V   + GD   I      C  C+ C  G  + C+   
Sbjct: 79  LDTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHA- 137

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                                D+  +    TF +Y     +    I     L     + C
Sbjct: 138 ---------------------DLSGYTHDGTFQQYATADAIQAAHIPKGTDLAGVAPILC 176

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
              T Y  A++++  + G+ VA+ G  G +G    Q A++ G  +++ +D    K +   
Sbjct: 177 AGVTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFK 234

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALE 288
           + G   FI    D  +++ I   +++ T GG     + + +   M  ++E
Sbjct: 235 SLGGEIFI----DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVE 280

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 114/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y     L  +++ V  PKA+E+ I ++++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 38  IFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 97

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           GIV + G++V   + GD+  I      C  C+ C  G  + C          +  D +  
Sbjct: 98  GIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNC----------LQADLSGY 147

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
            H+             +F +Y     V    I     L     + C   T Y  A+KTA+
Sbjct: 148 THDG------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY-KALKTAD 194

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ G  VA+ G  G +G   +Q AK+ G  +++ +D  + K +     G   FI    D 
Sbjct: 195 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVFI----DF 249

Query: 253 AEDQTIVEKLIDMTDGG 269
            + + +V  + + T+GG
Sbjct: 250 RKSKDMVADIQEATNGG 266

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 105/249 (42%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L  ++I V  PK +E+ I + ++ VCHTD +   G  P     P + GHEGAG V ++G 
Sbjct: 19  LEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGEVVALGS 78

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           DV   K GD   I      C  C+ C     + C            PD           D
Sbjct: 79  DVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDA----------D 116

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I     L     + C   T Y  A+K+AN++ G  VA
Sbjct: 117 LSGYTHDGSFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY-KALKSANLKAGQWVA 175

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G  G +G   +Q A++ G  +++ +D    K +     G   FI    D  ++  I E
Sbjct: 176 ISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFI----DFTKEHDIAE 230

Query: 261 KLIDMTDGG 269
            +I  T+GG
Sbjct: 231 AVIKATNGG 239

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 117/277 (42%), Gaps = 35/277 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y     L  ++I V  P  +E+ I + ++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 13  IFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 72

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD+  I      C  C+ C     + C            P+    
Sbjct: 73  GVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC------------PEA--- 117

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I   A L     + C   T Y  AIK+AN
Sbjct: 118 -------DLSGYTHDGSFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIKSAN 169

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ GD +A+ G CG +G   +Q  K+ G  +I+ +D   +K +     G   FI    D 
Sbjct: 170 LKAGDWLAISGACGGLGSLAIQYGKAMG-FRILGIDGGAEKEELFKKLGGEYFI----DF 224

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
            + + I+ ++   T+GG         N ++   A+EA
Sbjct: 225 TQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEA 257

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 128/306 (41%), Gaps = 58/306 (18%)

Query: 15  AVAYNAKKSLSVEEITVDPPKA--HEVRIKIEFTAVCHTDAYTLSGSD---PE------- 62
           A+AY  +K +   +   +P  +   ++ I I +  +C TD +  +      PE       
Sbjct: 3   ALAYFGQKDIRFTDELPEPVISADDDLIIDIAWCGICGTDLHEYTDGPIFFPEDGHTHDI 62

Query: 63  ---GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAEC--------------GKCK 105
              GL P  +GHE AG+V  +G  V   + GDHV+   T+ C                C 
Sbjct: 63  SGNGL-PQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCA 121

Query: 106 FCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAI 165
            C  G  N+CS +    G GV   G                    FSE  V+    V+ I
Sbjct: 122 ACKRGLYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKI 160

Query: 166 DPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKII 225
               PLD A L+     + +  AI+ + +  G +  V G G +GL  +   ++ GASKI+
Sbjct: 161 PKHIPLDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIV 218

Query: 226 AVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTGNTNIM 283
             +    +R+ +   GA  F +P E   E+   VE L  +  G  G D++FDC+G     
Sbjct: 219 VSEPAKNRRELAKLMGAEVF-DPTE--WEEHEAVEYLRKVAPGGDGFDYSFDCSGLPVTF 275

Query: 284 RDALEA 289
           R ++ A
Sbjct: 276 RASVHA 281

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 119/273 (43%), Gaps = 35/273 (12%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L +TV  P      + Y     L  ++I V  PKA+E+ I ++++ VCHTD +   G  P
Sbjct: 22  LQSTVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWP 81

Query: 62  EGL-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
                P + GHEG+G V ++G++V   K GD   I      C  C+ C SG  + C    
Sbjct: 82  LATKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHA- 140

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAP--LDAACLL 177
                                D+  +    +F +Y   AD    A  PK     + A +L
Sbjct: 141 ---------------------DLSGYTHDGSFQQYA-TADAVQAARIPKGTNMAEVAPIL 178

Query: 178 GCGVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQY 236
             G+T     A+K A+++ G  V + G  G +G   +Q AK+ G  ++I +D    K + 
Sbjct: 179 CAGITV--YKALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEEL 235

Query: 237 SSNFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
             + G   F+    D  + + IV ++ + T GG
Sbjct: 236 FKSLGGEIFV----DFTKTKDIVAEIQEATRGG 264

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 134/360 (37%), Gaps = 45/360 (12%)

Query: 15  AVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF----PCIL 69
           A+ Y  +    +E    DP   H V++KIE T +C +D  Y L GS   G F    P +L
Sbjct: 16  AIVYEHRPVPVIE----DP---HYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 70  GHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPD 129
           GHE +G V  VG DV  V+ GD V           +   SG  NLC  +R         D
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--D 124

Query: 130 GTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAI 189
           GT   +    ED    +  S   E   + +   VA+                      A 
Sbjct: 125 GTLVKYYISPEDFLVKLPDSVSLEEGALCEPLAVAVH---------------------AN 163

Query: 190 KTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPK 249
           + A  Q    V VFG G VGL     AK+ GA+ +  VDI+  K   +   G T  ++  
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-S 222

Query: 250 EDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXX 309
            D +  + +  KL       +D  FDC+G    +  A+  C  G                
Sbjct: 223 SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTHVQVGSSRDYVS-- 280

Query: 310 STRPFQLVTGRVWKGSAFGGIK-GRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFE 368
               F L    V +    G  +    +    ++   S  +     +THR PF    +A++
Sbjct: 281 ----FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAYK 336

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 96/378 (25%), Positives = 159/378 (42%), Gaps = 59/378 (15%)

Query: 23  SLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLF---PCILGHEGAGIVES 79
           ++S+ +I+ DP   +EV I+I+ T +C +D +  +           P +LGHE +GIV  
Sbjct: 22  NVSIPKIS-DP---NEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESSGIVAL 77

Query: 80  VGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAK 138
           +G++V T+K GD V                G+ NL   ++         DGT T+++   
Sbjct: 78  IGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPF--DGTLTKYYKTM 135

Query: 139 GEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGD 198
            + +Y      +F E  ++  +SV                         A K A ++ G 
Sbjct: 136 KDFVYKLPDDVSFEEGALIEPLSVAI----------------------HANKLAKIKFGA 173

Query: 199 TVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTI 258
              VFG G +GL   + A   GA+ ++ VD+   K + +  FGAT  +N   DL    T 
Sbjct: 174 RCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN-SGDLPHGVT- 231

Query: 259 VEKLIDMTDG--GLDFTFDCTGNTNIMRDALEAC-------HKGWGQSXXXXXXXXXXXX 309
           V+ +I    G  G D  F+C+G    +R  +E C         G GQ             
Sbjct: 232 VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEEIQF-------- 283

Query: 310 STRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFE 368
              P  ++ T  +     F   +G  +    I+   S  L ++ FITHR  FK+  +AFE
Sbjct: 284 ---PISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDAVEAFE 338

Query: 369 DL--HNGDCLRTVLRFQE 384
           +   H  + ++T++   E
Sbjct: 339 ETSHHPLNNIKTIIEGPE 356

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 113/266 (42%), Gaps = 31/266 (11%)

Query: 7   GKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-F 65
           G P+   A + Y     L  ++I V  PK +E+ + ++++ VCHTD +   G  P     
Sbjct: 29  GIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPLATKL 88

Query: 66  PCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
           P + GHEGAGIV + G +V   + GD+  +      C  C++C +G  + C+    +   
Sbjct: 89  PLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADLS--- 145

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
           G   DG                   +F +Y     V    I     L     + C   T 
Sbjct: 146 GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGVTV 186

Query: 185 YGAAIKTANVQEGDTVAV-FGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243
           Y  A+KTAN+  G  VA+    G +G   +Q AK+ G  +++ +D    K       G  
Sbjct: 187 Y-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKKLGGE 244

Query: 244 DFINPKEDLAEDQTIVEKLIDMTDGG 269
            FI    D  + + IV  + + T+GG
Sbjct: 245 VFI----DFTKSKDIVADIQEATNGG 266

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 111/259 (42%), Gaps = 31/259 (11%)

Query: 14  AAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y     L  ++I V  P A E+ I ++++ VCHTD +   G  P     P + GHE
Sbjct: 12  AVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 73  GAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V ++G++V   K GD+  I      C  C+ C     + C            P+  
Sbjct: 72  GAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC------------PEA- 118

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K+
Sbjct: 119 ---------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY-KALKS 168

Query: 192 ANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
           AN+  GD VA+ G CG +G   +Q A + G  +++ +D   +K +     G   FI    
Sbjct: 169 ANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVFI---- 223

Query: 251 DLAEDQTIVEKLIDMTDGG 269
           D    + +  ++I  T+GG
Sbjct: 224 DFTTCKDVEGEIIKATNGG 242

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 126/306 (41%), Gaps = 58/306 (18%)

Query: 15  AVAYNAKKSLSVEEITVDPPKA--HEVRIKIEFTAVCHTDAYT-LSGSD--PE------- 62
           A+AY  KK +        P     +E+ I I +  +C +D +  L G    PE       
Sbjct: 3   ALAYFGKKDIHFSADIAKPEIGADNELEIDISWCGICGSDLHEYLDGPIFFPEEGKTHGV 62

Query: 63  -GL-FPCILGHEGAGIVESVGDDVM-TVKPGDHVIALYTAEC--------------GKCK 105
            G+  P  +GHE +GIV  VG  V    K GDHV+   T  C                C 
Sbjct: 63  SGIGLPQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCS 122

Query: 106 FCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAI 165
            C  G  N C+ +    G G    G                    FSE  V+++  V+ I
Sbjct: 123 ACKRGIYNCCTHL-GFCGLGAHGGG--------------------FSEKVVISEQHVIKI 161

Query: 166 DPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKII 225
             + PLD A L+     + +  A+K +N++ G +  V G G +GL+ +   +  GA KI+
Sbjct: 162 PKEIPLDIAALVEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIV 219

Query: 226 AVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTGNTNIM 283
             +    +R+ ++  G   F NP E     +  VE+L  +  G  G DF+FDC+G     
Sbjct: 220 VSEPAQIRREQAAKLGVETF-NPFE---HGEKAVEELRKIPPGGDGFDFSFDCSGMKATF 275

Query: 284 RDALEA 289
              L A
Sbjct: 276 DTGLHA 281

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 96/215 (44%), Gaps = 27/215 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L  ++I V  P + E+ I ++++ VCHTD +   G  P     P + GHEGAG+V ++G+
Sbjct: 19  LEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVALGE 78

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   I      C  C++C  G  + C                         D
Sbjct: 79  NVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHA----------------------D 116

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
           +  +    +F +Y     V    I     L     + C   T Y  A+K+A+++ G  VA
Sbjct: 117 LSGYTHDGSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSADLKAGQWVA 175

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQ 235
           + G CG +G   +Q A++ G  +++ +D  + KR+
Sbjct: 176 ISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRK 209

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 161/365 (44%), Gaps = 51/365 (13%)

Query: 30  TVDPPKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVMT 86
           T+D P  H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VGD V  
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCT-SGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGEDIYH 144
           VK GD V A+     G+    T  G+ NLC  +       +  DGT  R++ +  + +  
Sbjct: 84  VKIGDRV-AIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVK 140

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFG 204
                ++ E   V  +SV                 GV +      K A V+ G  V VFG
Sbjct: 141 LPDGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFG 178

Query: 205 CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT-DFINPKEDLAEDQTIVEKLI 263
            G VGL     A + GAS +I VD+ + + Q + +FGA+  F + K  + E Q + +++ 
Sbjct: 179 AGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVE 238

Query: 264 DMTDG-GLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
            +  G   D  F+C+G  ++  DA     K  G              +  P   V+G+  
Sbjct: 239 KLLGGHHADVVFECSG-ADVCIDAGVKTTKVGG---TMVQVGMGKNYTNFPIAEVSGKEM 294

Query: 323 K-----GSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFED--LHNGDC 375
           +       +FG  +    +        SG + V+  ITHR  F++  +A++    H GD 
Sbjct: 295 RLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDV 348

Query: 376 LRTVL 380
           ++T++
Sbjct: 349 VKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 161/365 (44%), Gaps = 51/365 (13%)

Query: 30  TVDPPKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVMT 86
           T+D P  H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VGD V  
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCT-SGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGEDIYH 144
           VK GD V A+     G+    T  G+ NLC  +       +  DGT  R++ +  + +  
Sbjct: 84  VKIGDRV-AIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVK 140

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFG 204
                ++ E   V  +SV                 GV +      K A V+ G  V VFG
Sbjct: 141 LPDGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFG 178

Query: 205 CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT-DFINPKEDLAEDQTIVEKLI 263
            G VGL     A + GAS +I VD+ + + Q + +FGA+  F + K  + E Q + +++ 
Sbjct: 179 AGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVE 238

Query: 264 DMTDG-GLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
            +  G   D  F+C+G  ++  DA     K  G              +  P   V+G+  
Sbjct: 239 KLLGGHHADVVFECSG-ADVCIDAGVKTTKVGG---TMVQVGMGKNYTNFPIAEVSGKEM 294

Query: 323 K-----GSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFED--LHNGDC 375
           +       +FG  +    +        SG + V+  ITHR  F++  +A++    H GD 
Sbjct: 295 RLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDV 348

Query: 376 LRTVL 380
           ++T++
Sbjct: 349 VKTII 353

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 104/249 (41%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L   +I V   KA+E+ I ++++ VCH+D Y      P     P + GHEGAG+V  +G 
Sbjct: 32  LEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGHEGAGVVVGMGS 91

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   +    + C  C+ C  G    C     ++  G   +G           
Sbjct: 92  NVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGFTRNG----------- 137

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
                   +F +Y  V  +    +     L       C   T Y  AIK+AN++ G  +A
Sbjct: 138 --------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIKSANIRAGQWMA 188

Query: 202 VFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           + G CG +G   +Q  K+ G  +++ +D    K       G   FI    D  + + +V 
Sbjct: 189 ITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVFI----DFTKSKDLVA 243

Query: 261 KLIDMTDGG 269
            ++  T+GG
Sbjct: 244 DVVSATNGG 252

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 115/263 (43%), Gaps = 30/263 (11%)

Query: 37  HEVRIKIEFTAVCHTDAYTL---SGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHV 93
           H V+++I+ T +C +D +     S  D     P +LGHE +GI+  VG  V T+K GD V
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSIGDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGEDIYHFMGCSTFS 152
                      +   SG  NLC  +          DGT T+++    + +Y      ++ 
Sbjct: 91  ALEPGYPSRYTEATMSGHYNLCPFMHFAATPPC--DGTLTKYYLTPFDFVYKLPDNVSYE 148

Query: 153 EYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSV 212
           E  ++  +SV                 GV      A K A  + GD V VFG G VGL  
Sbjct: 149 EGALLEPLSV-----------------GVH-----ANKQAGTRFGDKVVVFGAGPVGLLN 186

Query: 213 MQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGL-- 270
              AK  GA +++ +D+ ++K + + +FGAT  IN  +    D+  +   I    GG+  
Sbjct: 187 GAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAIKEKLGGVDP 246

Query: 271 DFTFDCTGNTNIMRDALEACHKG 293
           D   +CTG    +R  + A   G
Sbjct: 247 DIVLECTGAEPCIRAGIRALKTG 269

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 126/308 (40%), Gaps = 63/308 (20%)

Query: 15  AVAYNAKKSLSVEEITVDPPKAH-----EVRIKIEFTAVCHTDAYTLSG----------- 58
           A+AY  K  +     T D PK       EV + + +  +C +D +  S            
Sbjct: 3   ALAYFKKGDI---HFTNDIPKPEIQADDEVILDVSWCGICGSDLHEYSDGPIFMPKDGEC 59

Query: 59  -SDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG--------------K 103
            S      P  +GHE +GI+  VG  V  VK GDHV+    + C                
Sbjct: 60  HSLSNAGLPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKP 119

Query: 104 CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVV 163
           C  C  G  NLC+      G GV+  G                    F+E  VV++  ++
Sbjct: 120 CDACKKGCENLCTHA-GFIGLGVISGG--------------------FAEQVVVSEHHII 158

Query: 164 AIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASK 223
            +  + PLD A L+     T +  A++ +  ++G +  V G G +GL  +   K  GA +
Sbjct: 159 PVPKEIPLDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQ 216

Query: 224 IIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTGNTN 281
           I+  ++  ++ + +   G   F +P++     +  VE L  +T    G D+++DC+G   
Sbjct: 217 IVVSEVAERRMELARRLGVEIF-DPRK---HGEKSVESLRALTKSHDGFDYSYDCSGIQA 272

Query: 282 IMRDALEA 289
               +L+A
Sbjct: 273 TFDASLKA 280

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 109/257 (42%), Gaps = 31/257 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y     L  ++I V  PK +E+ I I+++ VCHTD +   G  P  +  P + GHEGA
Sbjct: 36  IFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 95

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V + G DV   + GD   +    + C  C++C  G  + C+                 
Sbjct: 96  GVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKA--------------- 140

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     +    I     L     + C   T Y  A+KT+ 
Sbjct: 141 -------DLSGYTHDGSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY-KALKTSG 192

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
            + G  VA+ G  G +G   +Q A + G  +++ +D    K +   + G   F+    D 
Sbjct: 193 AKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVFV----DF 247

Query: 253 AEDQTIVEKLIDMTDGG 269
            + + +V  + + T+GG
Sbjct: 248 TKTKDMVSAIQEATNGG 264

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 131/286 (45%), Gaps = 41/286 (14%)

Query: 15  AVAYNAKKSLSVEEITVDP--PKAHEVRIKIEFTAVCHTDAYT-LSG-----SDPE---- 62
           A+AY  +K +       +P    + +V+I I +  VC +D +  L G      D E    
Sbjct: 3   ALAYFGQKDIRFTNDLPEPTIQASDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGEKHAM 62

Query: 63  ---GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG---KCKFCTSGKTNLCS 116
              GL P  +GHE +G+V  +G  V  +K GDHV+   T  C    +           C+
Sbjct: 63  SGVGL-PQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASDEECA 121

Query: 117 AVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST--FSEYTVVADVSVVAIDPKAPLDAA 174
           A +              F+N   E  +  +GC +  F+E  V+++  VV +    PLD A
Sbjct: 122 ACKKD------------FYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVPKDIPLDVA 169

Query: 175 CLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKR 234
            L+     + +  A++ + ++ G +  + G G +GL+ +   +  GA  I+  + +  +R
Sbjct: 170 ALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPSASRR 227

Query: 235 QYSSNFGATDFINPKE--DLAEDQTIVEKLIDMTDGGLDFTFDCTG 278
           + +   GA  F NP +  D A D+  + K+   +D G DF++DC+G
Sbjct: 228 KQAEALGALTF-NPFDHGDKAVDE--LRKIPPGSD-GFDFSYDCSG 269

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 116/271 (42%), Gaps = 35/271 (12%)

Query: 4   ATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEG 63
           A+   P      + Y     L  +++ V  PK +E+ I ++++ VCHTD +   G  P  
Sbjct: 38  ASTNIPTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLD 97

Query: 64  L-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRAT 121
           +  P + GHEGAG+V + G++V   + GD   I      C  C+ C  G    C      
Sbjct: 98  VKLPLVGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHA--- 154

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKA--PLDAACLLGC 179
                              D+  +    +F +Y   AD    A  PK     + A +L  
Sbjct: 155 -------------------DLSGYTHDGSFQQYA-TADAVQAAQLPKGINLAEVAPILCA 194

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
           GVT     A+KTA++  G  VA+ G  G +G   +Q AK+ G  +++ +D  ++K++   
Sbjct: 195 GVTV--YKALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFH 251

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
             G   FI    D    + +V  + + T GG
Sbjct: 252 KLGGEIFI----DYTTTKDMVGAIQEATQGG 278

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 133/313 (42%), Gaps = 70/313 (22%)

Query: 15  AVAY----NAKKSLSVEEITVDPPKAH---EVRIKIEFTAVCHTDAYTLSGSDPEGLFP- 66
           A+AY    N + + S++E     P  H   +V I I +  +C TD    +  D    FP 
Sbjct: 3   ALAYFGKGNVRFTYSLKE-----PHIHAEDDVIIDISWCGICGTDLKEYT--DGAIFFPE 55

Query: 67  --CI-----------LGHEGAGIVESVGDDVMTVKPGDHVIALYTAEC------------ 101
             C+           +GHE +GI+ SVG      K GDHV+   TA C            
Sbjct: 56  DGCVNHISNNNLPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNR 115

Query: 102 --GKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVAD 159
               C+ C +G  N+C  +  T G GV   G                    F+E  V+ +
Sbjct: 116 DTPMCEACRNGMPNICKYLGLT-GAGVEGGG--------------------FAEKMVINE 154

Query: 160 VSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSR 219
                I    PLD A L+       +  A+K ++ ++G +V + G G +GL  +   K  
Sbjct: 155 HHCHKIPHHMPLDVASLIQPISVCWH--AVKVSHYKQGGSVLIVGGGPIGLGTILALKGF 212

Query: 220 GASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCT 277
           G   I+  +    +R+ +   GA  F +P  +++ D +I + L +M  G  G D+TFDC+
Sbjct: 213 GCEDIVVSEPALIRRELAEKMGARVF-DPS-NMSLDNSI-KTLTEMAPGSQGFDYTFDCS 269

Query: 278 GNTNIMRDALEAC 290
           G    ++ A+E C
Sbjct: 270 GIPATLKVAIECC 282

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 99/369 (26%), Positives = 154/369 (41%), Gaps = 59/369 (15%)

Query: 30  TVDPPKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVMT 86
           T++ P  H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VG+ V  
Sbjct: 26  TIEDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGEVVEVGNAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFM 146
           VK GD V                G+ NLC  +       +  DGT   +    ED    +
Sbjct: 84  VKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKL 141

Query: 147 GCSTFSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTTGYGAAIKTANVQEGDTVAVFG 204
                 E                  + AC+  L  GV +      K A V+    V VFG
Sbjct: 142 PEGVSYE------------------EGACVEPLSVGVHSN-----KLAGVRFSTRVVVFG 178

Query: 205 CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN----PKEDLAEDQTIVE 260
            G VGL     A++ GAS ++ VD+ + K Q + +FGAT+  N    P +   E  + VE
Sbjct: 179 AGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELASEVE 238

Query: 261 KLIDMTDGG--LDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVT 318
           KL+    GG   D  F+C+G  ++  DA     K  G              +  P   V+
Sbjct: 239 KLL----GGNHADVVFECSG-ADVCIDAGVKVTKVGG---TMVQVGMGKNYTNFPIAEVS 290

Query: 319 GRVWK-----GSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFED--LH 371
           G+  K       +FG  +    +        +G + V+  ITHR  F++  +A++    H
Sbjct: 291 GKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHRFKFEDAAKAYDYNISH 344

Query: 372 NGDCLRTVL 380
            GD ++T++
Sbjct: 345 GGDVVKTII 353

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 117/306 (38%), Gaps = 60/306 (19%)

Query: 15  AVAYNAK------KSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLS---------GS 59
           A+AY  K      K L    IT D     E+ I I F  +C TD +  +         G 
Sbjct: 3   ALAYFGKGDIHFTKDLEEPRITTD----DELLIDIIFCGICGTDLHEYTDGPIFFPSDGH 58

Query: 60  DPE---GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG-------------- 102
             E      P  +GHE AGIV  VG  V   K GDHV    T  C               
Sbjct: 59  KHEISNNELPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKE 118

Query: 103 KCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
           KC  C  G  N+CS +    G GV   G                    F+E  V+ +   
Sbjct: 119 KCAACKRGMYNVCSHL-GLIGNGVQSGG--------------------FAERVVINESHC 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGAS 222
             +    P++   L+     + +  A++ +  + G +V + G G +GLS +      G +
Sbjct: 158 YKLPNHIPMEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCT 215

Query: 223 KIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNI 282
           +I+  +    +R  +   GA  + +P +   E+     + +     G D+ FDC+G    
Sbjct: 216 EIVVSEPAKIRRDLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTPAT 274

Query: 283 MRDALE 288
           +R ++E
Sbjct: 275 LRSSIE 280

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 105/281 (37%), Gaps = 57/281 (20%)

Query: 38  EVRIKIEFTAVCHTD----------------AYTLSGSDPEGLFPCILGHEGAGIVESVG 81
           E+ I I +  +C TD                 + +SG       P  +GHE AG+V  VG
Sbjct: 28  ELMIDISWCGICGTDLKEYTEGAIFFPNDGECHQISGEP----LPQAMGHEMAGVVSRVG 83

Query: 82  DDVMTVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCSAVRATQGKGVM 127
             V   K GDHV+   T  C                C  C  G  N+CS +    G GV 
Sbjct: 84  PGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNICSKL-GLCGAGVQ 142

Query: 128 PDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGA 187
             G                    F+E  V+ +     +    PLD A L+       +  
Sbjct: 143 SGG--------------------FAERVVMNESHCHKVPDDLPLDIAALIQPIAVCWH-- 180

Query: 188 AIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN 247
           A++  N ++G +  V G G +GL ++      G + I+  +    +R ++   GAT F  
Sbjct: 181 ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKELGATVFDP 240

Query: 248 PKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALE 288
                 E+     + I     G D+TFDC+GN      ++E
Sbjct: 241 SSLPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 144/356 (40%), Gaps = 40/356 (11%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L  E++ V  P ++EV I ++++ VCHTD +T  G  P +   P + GHEGAG+V + G 
Sbjct: 42  LYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGK 101

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
           DV T + GD   +    + C  C+ C  G    C     +   G   DG           
Sbjct: 102 DVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMS---GSSHDG----------- 147

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
                   TF +Y  +  +    +     L A   + C   + Y  A+K  N+Q    VA
Sbjct: 148 --------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQWVA 198

Query: 202 VFGC-GTVGLSVMQGAKSRGASKIIAVD-INNKKRQYSSNFGATDFINPKEDLAEDQTIV 259
           +FG  G +G   +Q AK+ G  +++ +D    +++Q   + G   F+    D  +   I 
Sbjct: 199 IFGATGGLGSIAVQYAKAMG-YRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDNIP 253

Query: 260 EKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVT- 318
             +   T GG     + T +       ++ C +  G               T  F +V  
Sbjct: 254 AAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIVQH 312

Query: 319 GRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFEDLHNGD 374
           G   KGSA G    R++    +  +  G +K    I       E+ +AFE L +G 
Sbjct: 313 GFSIKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQ 362

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 108/250 (43%), Gaps = 32/250 (12%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGD 82
           L  ++I V  P+ +E+ I ++++ VCHTD +   G  P     P + GHEGAGIV + G 
Sbjct: 21  LQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGIVVAKGS 80

Query: 83  DVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGE 140
            V    + GD   I      C  C++C     + C                         
Sbjct: 81  MVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQA---------------------- 118

Query: 141 DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTV 200
           D+  +    +F +Y     V    +     L     + C   T Y  A+K+AN++ G+ V
Sbjct: 119 DLSGYTHDGSFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KALKSANLRAGEWV 177

Query: 201 AVFGC-GTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIV 259
           A+ G  G +G   +Q AK+ G  +++ +D  ++K +     G   FI    D  + + ++
Sbjct: 178 AISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFI----DFTKSKDVI 232

Query: 260 EKLIDMTDGG 269
            ++I  TDGG
Sbjct: 233 AEVIKATDGG 242

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 118/277 (42%), Gaps = 35/277 (12%)

Query: 16  VAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y     L  +++ V  PK  E+ I + ++ VCHTD +   G  P +   P + GHEGA
Sbjct: 16  IFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGA 75

Query: 75  GIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD   I      C  C+ C     + C            P+    
Sbjct: 76  GVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC------------PEA--- 120

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                  D+  +    +F +Y     V    I   A +     + C   T Y  A+K+A 
Sbjct: 121 -------DLSGYTHDGSFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY-KALKSAE 172

Query: 194 VQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q AK+ G  +++ +D  ++K ++  + G   F+    D 
Sbjct: 173 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVFV----DF 227

Query: 253 AEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
              + IV  + + T+GG      C  N ++   A+EA
Sbjct: 228 MTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 107/252 (42%), Gaps = 32/252 (12%)

Query: 34  PKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVMTVKPG 90
           P  H V++ I+ T +C +D  Y  SGS  + +   P +LGHE +G V  VG  V ++K G
Sbjct: 27  PNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRSIKVG 86

Query: 91  DHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST 150
           D V                G+ NLC  +       +  DGT                   
Sbjct: 87  DRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGTL------------------ 126

Query: 151 FSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTTGYGAAIKTANVQEGDTVAVFGCGTV 208
              Y   AD  V   D  +  + AC+  L  GV      A K A V  G  V VFG G V
Sbjct: 127 VKYYVSPADFLVKLPDHVSFEEGACIEPLSVGVH-----ANKLAKVHFGSVVVVFGAGPV 181

Query: 209 GLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE-DLAEDQTIVEKLIDMTD 267
           GL     AK+ GAS++I VD+ + K + +  FGAT  IN K     E   +   + +   
Sbjct: 182 GLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVSNYLG 241

Query: 268 GGL-DFTFDCTG 278
           G L D  F+C+G
Sbjct: 242 GALADVVFECSG 253

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 99/375 (26%), Positives = 148/375 (39%), Gaps = 70/375 (18%)

Query: 29  ITVDPPKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVM 85
           I  DP   H V+I I+ T +C +D  Y  SG   + +   P +LGHE +G V  VG  V 
Sbjct: 26  IIEDP---HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGSAVT 82

Query: 86  TVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHF 145
            VK GD V                G+ NLC  +       +  DGT   +    ED    
Sbjct: 83  RVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVK 140

Query: 146 MGCSTFSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTTGYGAAIKTANVQEGDTVAVF 203
           +      E                  + AC+  L  GV +      K A V+ G  V VF
Sbjct: 141 LPEGVSYE------------------EGACVEPLSVGVHSN-----KLAGVRFGSRVVVF 177

Query: 204 GCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN----PKEDLAEDQTIV 259
           G G VGL     A++ GAS ++ +D+ + K   +  FGAT   N    P +   E    V
Sbjct: 178 GAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELADEV 237

Query: 260 EKLIDMTDGGLDFTFDCTG-------NTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTR 312
           EKL  ++    D  F+C+G          I +        G G++            +  
Sbjct: 238 EKL--LSGHHADIVFECSGADACIDAGVKITKVGGTMVQIGMGKN-----------YTNF 284

Query: 313 PFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQA- 366
           P   V+G+  K       +FG  +        +K   SG + V+  ITHR  F++  +A 
Sbjct: 285 PIAEVSGKEMKLIGCFRYSFGDYR------DAVKLVASGKVNVKAMITHRFKFEDAAKAY 338

Query: 367 -FEDLHNGDCLRTVL 380
            F   H G+ ++T++
Sbjct: 339 DFNIAHGGEVVKTII 353

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 120/285 (42%), Gaps = 35/285 (12%)

Query: 9   PIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGS---DPEGLF 65
           P    A V Y     L   +I V  PK +E+ + I+++ VCHTD +   G     P+   
Sbjct: 29  PTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPK--L 86

Query: 66  PCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
           P + GHEGAG+V + G +V   + GD+  +      C +C+FC  G    C     +   
Sbjct: 87  PLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETPTLS--- 143

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
           G   DG                   TF +Y     +    I P   L     + C   T 
Sbjct: 144 GYTHDG-------------------TFQQYATADAIHAAHIPPGTDLAKVAPILCAGITV 184

Query: 185 YGAAIKTANVQEGDTVAV-FGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243
           Y  A+KTA +  G  VA+    G +G   +Q A + G  +++ +D  N+K     + G  
Sbjct: 185 Y-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMG-YRVVGIDGGNEKEALFRSLGGE 242

Query: 244 DFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALE 288
            F+    D  +++ IV  + + T GG     + + +TN +  ++E
Sbjct: 243 TFV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVE 283

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 151/362 (41%), Gaps = 57/362 (15%)

Query: 37  HEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVMTVKPGDHV 93
           H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VGD V  VK GD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE 153
                           G+ NLC  +       +  DGT   +    ED    +      E
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 154 YTVVADVSVVAIDPKAPLDAACL--LGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLS 211
                             + AC+  L  GV +      K A V+ G  V VFG G VGL 
Sbjct: 149 ------------------EGACVEPLSVGVHSN-----KLAGVRFGTKVVVFGAGPVGLL 185

Query: 212 VMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE---DLAEDQTI-VEKLIDMTD 267
               A++ GA+ +I VD+ + K Q + +FGAT+  N  +   D A+D    V+KL+    
Sbjct: 186 TGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLL---- 241

Query: 268 GG--LDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWK-- 323
           GG   D  F+C+G    +  A++    G                +  P   V+G+  K  
Sbjct: 242 GGNHADVVFECSGADVCIDAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLI 297

Query: 324 ---GSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFED--LHNGDCLRT 378
                +FG  +    +        +G + V+  ITH+  F++  +A++    H G+ ++T
Sbjct: 298 GCFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKT 351

Query: 379 VL 380
           ++
Sbjct: 352 II 353

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 111/271 (40%), Gaps = 28/271 (10%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61
           L +TV  P      + Y     L  ++I V  PK +E+ + ++++ VCHTD +   G  P
Sbjct: 20  LQSTVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWP 79

Query: 62  EGL-FPCILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
             +  P + GHEGAG+V + G +V   + GD   I      C  C+ C SG  + C    
Sbjct: 80  LSVKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNC---- 135

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                             +  D+  +    +F +Y     V    I     L     + C
Sbjct: 136 ------------------EHADLSGYTHDGSFQQYATADAVQAAKIPEGTNLAEVAPVLC 177

Query: 180 GVTTGYGAAIKTANVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSS 238
              T Y  A+K A++  G  V + G  G +G   +Q  K+ G  ++I +D    K +   
Sbjct: 178 AGITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFK 235

Query: 239 NFGATDFINPKEDLAEDQTIVEKLIDMTDGG 269
           + G   FI+  +    D  +V  +   T+GG
Sbjct: 236 SLGGEVFIDFTKQ-KTDSDMVAAIQKATNGG 265

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 129/299 (43%), Gaps = 42/299 (14%)

Query: 15  AVAYNAKKSLSVEEITVDPPKAH---EVRIKIEFTAVCHTDAYTLSG----------SDP 61
           AVAY  K  +     T+  PK +   EV I++ +  +C TD +  +           ++P
Sbjct: 3   AVAYYKKGDIHFSS-TLPEPKINSPDEVLIEVSYCGICGTDLHEYTDGPIFFPKDGETNP 61

Query: 62  EGLFPCI--LGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG--------KCKFCTSGK 111
               P    +GHE +G V+++G +V  V+ GD V+    A CG          K     K
Sbjct: 62  LSNIPLPQPMGHEFSGFVKAIGSNVTKVEVGDKVVV--EAGCGCKDVHRWPDSKLYEKRK 119

Query: 112 TNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL 171
              CSA       G+  D     ++  G  +        F+E  VV +  +V +  + P 
Sbjct: 120 DTFCSACE----NGI--DNCCENYDFTGLGVV----GGAFAERVVVGERHIVKLPEEVPT 169

Query: 172 DAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINN 231
           D   L+   ++  +  A++ +  ++G +  + G G +GL+ +   K+ GASKI+  ++  
Sbjct: 170 DVGALVE-PISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSELAE 227

Query: 232 KKRQYSSNFGATDFINPKEDLAEDQTIVE-KLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
           ++R  +S  G   F   K     D  + E + I     G D+ FDC+G       AL+A
Sbjct: 228 RRRILASKMGVEVFDPSKHG---DNAVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 118/306 (38%), Gaps = 60/306 (19%)

Query: 15  AVAYNAKKSLSVEEITVDP--PKAHEVRIKIEFTAVCHTDAYT----------------L 56
           A+AY AK  +   +  V+P      E+ ++I +  +C TD +                 L
Sbjct: 3   ALAYFAKGDIHFTKDLVEPKISTPDELILEINYCGICGTDLHEYIDGPIFFPEDGETNEL 62

Query: 57  SGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGK------------- 103
           SGS      P  +GHE AG V  +G  V   K GDHV+      C               
Sbjct: 63  SGSG----LPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKP 118

Query: 104 -CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+CS +    G GV   G                     +E   + +   
Sbjct: 119 WCSACKKGHYNVCSNL-GLIGNGVQSGGC--------------------AERMCINESHC 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGAS 222
             +    P+D A L+     + +  AIK A  + G +V V G G +GL  +   +  G S
Sbjct: 158 FKVPKDMPMDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCS 215

Query: 223 KIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNI 282
            I+  +    +R+ +   GAT +   + +  ++   + K+I   D G D+ FD +G    
Sbjct: 216 DIVVSEPAKVRRELAERMGATTYDPSQHNTEKNIQNLRKMILGGD-GFDYVFDNSGTPET 274

Query: 283 MRDALE 288
           +  A+E
Sbjct: 275 LETAIE 280

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 150/362 (41%), Gaps = 57/362 (15%)

Query: 37  HEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVMTVKPGDHV 93
           H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VGD V  VK GD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE 153
                           G  NLC  +       +  DGT   +    ED    +      E
Sbjct: 91  AIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 154 YTVVADVSVVAIDPKAPLDAACL--LGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLS 211
                             + AC+  L  GV +      K A V+ G  V VFG G VGL 
Sbjct: 149 ------------------EGACVEPLSVGVHSN-----KLAGVRFGTKVVVFGAGPVGLL 185

Query: 212 VMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE---DLAEDQTI-VEKLIDMTD 267
               A++ GA+ +I VD+ + K Q + +FGAT+  N  +   D A+D    V+KL+    
Sbjct: 186 TGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLL---- 241

Query: 268 GG--LDFTFDCTGNTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWK-- 323
           GG   D  F+C+G    +  A++    G                +  P   V+G+  K  
Sbjct: 242 GGNHADVVFECSGADVCIDAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLI 297

Query: 324 ---GSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFED--LHNGDCLRT 378
                +FG  +    +        +G + V+  ITH+  F++  +A++    H G+ ++T
Sbjct: 298 GCFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKT 351

Query: 379 VL 380
           ++
Sbjct: 352 II 353

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 115/262 (43%), Gaps = 32/262 (12%)

Query: 37  HEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDDVMTVKPGDHV 93
           H V++ I+ T +C +D  Y   G+  + +   P +LGHE +GIV  VG  V  VK GD V
Sbjct: 29  HYVKLHIKATGICGSDVHYYTQGAIGQFVVKSPMVLGHESSGIVAEVGSAVTNVKVGDRV 88

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGEDIYHFMGCSTFS 152
                          SG  NLC  +          DGT T+++ A  + +Y      +F 
Sbjct: 89  AIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGTLTKYYLAPEDFVYKMPDHLSFE 146

Query: 153 EYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSV 212
           E  +   +SV                 GV      A K A  + G  V V G G VGL  
Sbjct: 147 EGALAEPMSV-----------------GVH-----ANKLAGTRFGSKVLVSGAGPVGLLA 184

Query: 213 MQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGL-D 271
              A++ GA++++ VDI  +K + S  FGAT  ++   D   ++  V ++  +  G L +
Sbjct: 185 GAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSSD---EERFVSEVSKVLGGDLPN 241

Query: 272 FTFDCTGNTNIMRDALEACHKG 293
              +C+G    +R  ++AC  G
Sbjct: 242 IVLECSGAQPAIRCGVKACKAG 263

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 113/294 (38%), Gaps = 56/294 (19%)

Query: 15  AVAYNAKKSLSVEEITVDPP--KAHEVRIKIEFTAVCHTDAYTLSGSD---PE------- 62
           A+AY  K ++       +P      E+ I IE+  +C TD +  +      PE       
Sbjct: 3   ALAYFGKGNIRFTNHLKEPHIVAPDELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEI 62

Query: 63  --GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGK--------------CKF 106
                P  +GHE AG V  VG  V  +K GD V+   T  C                C  
Sbjct: 63  SHNPLPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAA 122

Query: 107 CTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAID 166
           C  G  N+CS +    G GV   G                    F+E  V+ +     + 
Sbjct: 123 CKKGYYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHCYKVP 161

Query: 167 PKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIA 226
              PLD A L+       +  AI+    + G T  + G G +GL  +    + G   I+ 
Sbjct: 162 DFVPLDVAALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVV 219

Query: 227 VDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTG 278
            +    +R+ +   GA  + +P    A++   ++ L  + DG  G D+TFDC+G
Sbjct: 220 SEPAKVRRELAEKMGARVY-DPTAHAAKES--IDYLRSIADGGDGFDYTFDCSG 270

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 90/342 (26%), Positives = 138/342 (40%), Gaps = 37/342 (10%)

Query: 38  EVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKPGDHV-IA 95
           ++ +KIE   VC +D +  SG   +   P I+GHE  G V  VG +  + VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 96  LYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYT 155
                C KCK C +G  + C     T             ++   ED Y   G   +++Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYCPNAIQT-------------YSTPYEDGYVSKG--GYADYV 139

Query: 156 VVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQG 215
            V +   V I    P   A  L CG  T +   ++      G  VA+ G G +G   +  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 216 AKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFD 275
           AK+ GA ++ A+   + K++ +   GA  FI  K    E+    EK  D     LD    
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATK----EEPDWHEKYFDE----LDLVVV 249

Query: 276 CTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRS 334
           C G+ T+I  + L       G+               +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSME--- 305

Query: 335 EMGGLIKDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
           E+  L+K      +K+        P  E  +++ FE +  GD
Sbjct: 306 ELKQLLKLVSEKDIKI---WVETVPISEKGVHEVFERMDKGD 344

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 97/243 (39%), Gaps = 43/243 (17%)

Query: 65  FPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG----------------KCKFCT 108
            P  +GHE  G V+++G+ V  V  GD V+    A CG                +C  C 
Sbjct: 67  LPQPMGHEFCGFVKAIGNKVTKVAVGDKVVV--EAGCGCKDVHRWPQSHVYGKEQCTACR 124

Query: 109 SGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPK 168
            G  N C+    T G GV+                       F+E  VV +  VV +  +
Sbjct: 125 KGFDNCCTHAGFT-GLGVV--------------------GGAFAEQVVVGERHVVKLPEE 163

Query: 169 APLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVD 228
            P D   L+       +   +       G    V G G +GL+ +   K+ GASKI+  +
Sbjct: 164 VPTDVGALVEPLSVAWHAVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSE 223

Query: 229 INNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTD--GGLDFTFDCTGNTNIMRDA 286
           +   +R+ +   G   F +P +   E Q I +KL ++ +   G DF FDC+G       A
Sbjct: 224 LAAIRRELALKMGVEVF-DPSKHGDEKQGI-KKLREIPEDHDGFDFAFDCSGVETTFNTA 281

Query: 287 LEA 289
           L +
Sbjct: 282 LHS 284

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 116/305 (38%), Gaps = 58/305 (19%)

Query: 15  AVAYNAKKSLS----VEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGS----------- 59
           A+AY  K  +     + E T+  P   E+ I + +  +C TD +                
Sbjct: 42  ALAYFGKNDIKFTNDLPEPTISAPD--EMIIDVSWCGICGTDLHEFQDGPIFFPHDGCCH 99

Query: 60  --DPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG--------------K 103
               EGL P  +GHE AG +   G  V   K GD V+   T  C                
Sbjct: 100 EISGEGL-PQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEP 158

Query: 104 CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVV 163
           C  C  G  N+CS +    G GV   G                    F+E  V+ +    
Sbjct: 159 CAACKKGLYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQCY 197

Query: 164 AIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASK 223
            +     +D A L+     + +  A++ +  ++G +V + G G +GL  +      G S+
Sbjct: 198 KVPDHMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSE 255

Query: 224 IIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIM 283
           ++  +    +R ++   GA  +    +D  E    +  +    D G D+ FDC+GN   +
Sbjct: 256 VVVSEPAKIRRDFAEKMGAIVYDPSAKDHDESIKYLRSIAPGGD-GFDYAFDCSGNPATL 314

Query: 284 RDALE 288
           + A+E
Sbjct: 315 KAAIE 319

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 109/294 (37%), Gaps = 56/294 (19%)

Query: 15  AVAYNAKKSLS----VEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD---PE----- 62
           A+AY  K  +     +EE  +  P   E+ + I +  +C TD +  +      PE     
Sbjct: 3   ALAYFGKGDIRFTNHLEEPRIVAPD--ELVLDIAWCGICGTDLHEYTDGPIFFPEDGHTN 60

Query: 63  ----GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGK--------------C 104
                  P  +GHE AG V  VG  V   K GD V+   T  C                C
Sbjct: 61  EISHNPLPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWC 120

Query: 105 KFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVA 164
             C  G  N+CS +    G GV   G                    F+E  V+ +     
Sbjct: 121 AACKRGLYNICSYL-GLCGAGVQSGG--------------------FAERVVINESHCYK 159

Query: 165 IDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKI 224
           +    PLD A L+       +  AI   + + G T  + G G +GL  +    + G S I
Sbjct: 160 VPEFVPLDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDI 217

Query: 225 IAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTG 278
              +    +R+ +   GA  F +P    A+D     + +     G D+TFDC+G
Sbjct: 218 AVSEPAKVRRELAEKMGARVF-DPTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 115/298 (38%), Gaps = 60/298 (20%)

Query: 13  VAAVAYNAKKSL----SVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD---PE--- 62
           + A+AY  K  +    S++E  +  P   E+ I I +  +C TD +  +      PE   
Sbjct: 1   MKALAYFGKGDIRFTNSLKEPRIVAPD--ELVIDIAWCGICGTDLHEYTDGPIFFPEDGH 58

Query: 63  ------GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGK------------- 103
                    P  +GHE AG V  VG  V  +K GD V+   T  C               
Sbjct: 59  THEISHNPLPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKE 118

Query: 104 -CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+CS +    G GV   G                    F+E  V+ +   
Sbjct: 119 WCAACKKGYYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHC 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGAS 222
             +    PLD A L+       +  AI     + G T  + G G +GL  +    + G  
Sbjct: 158 YKVPDFVPLDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCR 215

Query: 223 KIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTG 278
            I+  +    +R+ +   GA  + +P E  A +   ++ L  + +G  G D+TFDC+G
Sbjct: 216 DIVVSEPAKLRRELAEKMGARVY-DPTEHAARES--IDYLRSVAEGGDGFDYTFDCSG 270

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 96/231 (41%), Gaps = 21/231 (9%)

Query: 66  PCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKG 125
           P  +GHE +G V  VG  V  VK GD V+   T  C         K     A  A + + 
Sbjct: 68  PQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC 127

Query: 126 VMPDGTTRFHNAKGEDIYHFMGCST----FSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
              D    +          FMG       F+E  V  +  VV +    P+D A L+   +
Sbjct: 128 ---DNCCEYAG--------FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PL 175

Query: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241
           +  + AA + +    G +  V G G +GL+++   K++GASKII  +    +R+ +    
Sbjct: 176 SVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMH 234

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDG-GLDFTFDCTGNTNIMRDALEACH 291
              F +P      D+++        DG G DF FDC+G        L+A H
Sbjct: 235 VETF-DPSTH--GDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 103/277 (37%), Gaps = 50/277 (18%)

Query: 38  EVRIKIEFTAVCHTDAYTLSGSD---PE---------GLFPCILGHEGAGIVESVGDDVM 85
           E+ I I +  +C TD +  +      PE            P  +GHE AG V  VG  V 
Sbjct: 28  ELVIDIAWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVA 87

Query: 86  TVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCSAVRATQGKGVMPDGT 131
            +K GD V+   T  C                C  C  G  N+CS +    G GV   G 
Sbjct: 88  HLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKGYYNICSYL-GLCGAGVQSGG- 145

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                              F+E  V+ +     +    PLD A L+       +  AI  
Sbjct: 146 -------------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AISV 184

Query: 192 ANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
              + G T  + G G +GL  +    + G   I+  +    +R+ +   GA  + +P E 
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRRELAEKMGARVY-DPTEH 243

Query: 252 LAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALE 288
            A++     + I     G D+TFDC+G    +  A++
Sbjct: 244 AAKESIDYLRSIAEGGDGFDYTFDCSGLEITLNAAIQ 280

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 121/288 (42%), Gaps = 37/288 (12%)

Query: 15  AVAYNAKKSLSVEEITV-DPPKAHEVRIKIEFTAVCHTDA-YTLSGSDPEGLF--PCILG 70
           AV    K  ++ E+I   +   +H V+I ++ T +C +D  Y   GS  E +   P +LG
Sbjct: 7   AVVLQKKGEITFEDIPAPEITDSHYVKIHVKKTGICGSDIHYYTHGSIGEFVVKKPMVLG 66

Query: 71  HEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCS--AVRATQGKGVMP 128
           HE +G+V  VG DV  V+ GD V               SG  NLC   A  AT       
Sbjct: 67  HESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDETKSGHYNLCPHMAFAATPPY---- 122

Query: 129 DGT-TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTTGY 185
           DGT  +++ A  + +       +F E                    AC   L  GV    
Sbjct: 123 DGTLVKYYLAPEDFLVKLPDHVSFEE-------------------GACAEPLAVGV---- 159

Query: 186 GAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDF 245
             A + A    G  V VFG G VGL     A + GAS ++ VD+   K + S +FGAT+ 
Sbjct: 160 -HANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNT 218

Query: 246 INPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKG 293
           IN  +  +ED+       ++     +   DC+G    +R A++    G
Sbjct: 219 INSTKYKSEDELTEVIKSELKGEQPEIAIDCSGAEICIRTAIKVLKAG 266

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 116/295 (39%), Gaps = 61/295 (20%)

Query: 15  AVAYNAKKSLSVEEITVDPP-----KAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFP--- 66
           A+AY   + +     T D P     K  +V I I +  +C TD + L   D    FP   
Sbjct: 3   ALAYFGTRDI---RFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHELL--DGPNFFPKDG 57

Query: 67  -----------CILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGK----------CK 105
                        +GHE AG+V  VG  V   +PGDHV+   T  C            CK
Sbjct: 58  ETHEISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCK 117

Query: 106 FCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAI 165
            C  G  N+C  +    G GV   G                    F+E  V+ +     +
Sbjct: 118 ACKRGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKV 156

Query: 166 DPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKII 225
               PLD A L+       +  A+K   V+EG +  + G G +GL ++   +  G + I+
Sbjct: 157 PSWIPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIV 214

Query: 226 AVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTG 278
             +    +R  +   GA   ++   D   ++  ++ L  ++    G DFTFDC+G
Sbjct: 215 VSEPAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 115/300 (38%), Gaps = 67/300 (22%)

Query: 22  KSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYT-LSG-----SDPEG------LFPCIL 69
           K L   +I VD     E+ I + +  +C +D +  L G      D E         P  +
Sbjct: 16  KDLPEPKINVDD----EIIIDVSYCGICGSDLHEYLEGPIFMPKDNETNEISNLSLPLAM 71

Query: 70  GHEGAGIVESVG--------------------DDVMTVKPGDHVIALYTAECGKCKFCTS 109
           GHE +GIV  VG                     DV     G H    Y  E  KC  C  
Sbjct: 72  GHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGKH----YGEE--KCPNCAR 125

Query: 110 GKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKA 169
           G  N C A     G G +  G                    F+E  +V +  +V I  + 
Sbjct: 126 GYDN-CCAYAGFTGLGFIGGG--------------------FAEQILVGEQHIVRIPDEI 164

Query: 170 PLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDI 229
           PLD A L+     T + A  K     +G T  + G G +GL+++   K+ GASKI+  ++
Sbjct: 165 PLDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEV 222

Query: 230 NNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEA 289
              +R+ +       F +P     ++ +   +L+     G DF FDC+G    M  A+ A
Sbjct: 223 AQVRRKLAEKMKVEVF-DPSVH-GKNTSNELRLLTENKDGFDFAFDCSGLEVTMNTAIHA 280

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 88/340 (25%), Positives = 137/340 (40%), Gaps = 32/340 (9%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHV-IA 95
           ++V +KIE   VC +D +T SG   E   P ++GHE  G V  +G     +K GD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 96  LYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYT 155
                C +C  C S     C     T  K    DG    +N+KG           +++Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRKDYT-DG----YNSKG----------GYADYI 142

Query: 156 VVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQG 215
            + +   V I    P   A  L CG  T +   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 216 AKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFD 275
           AK+ GA +  A+  ++ K++ +   GA  FI  K    E+     K  D      D    
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIATK----EEPDWATKYFDT----FDLIVV 252

Query: 276 CTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRS 334
           C+ + T+I  + +    K  G+             + +PF L+ G     SA GGI    
Sbjct: 253 CSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGINEIK 311

Query: 335 EMGGLIKDYQSGALKVEEFITHRRPFKEINQAFEDLHNGD 374
           +M  L+   ++  + VE      +  KE+   FE +  GD
Sbjct: 312 QMLDLVSK-KNLKIWVETIPISEKGVKEV---FERMEKGD 347

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 100/398 (25%), Positives = 159/398 (39%), Gaps = 75/398 (18%)

Query: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKA--HEVRIKIEFTAVCHTDAYTLSGS 59
           +A T  +  Q +A + +   K+   +++  DP K   H++ IK+E   VC +D +  SG+
Sbjct: 1   MAYTSPEKFQGIAVLDHKDWKN--PKKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGN 58

Query: 60  DPEGLFPCILGHEGAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSA 117
             +   P ++GHE  G V  +G++  + +K GD V +      C  C+ C +     C  
Sbjct: 59  WGDLTKPLVVGHEIIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEG 118

Query: 118 VRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLL 177
              T G+   PDG    +++KG           +++Y  V +   V I    P   A  L
Sbjct: 119 FVTTYGQD-YPDG----YSSKG----------GYADYFRVHEHFAVPIPENIPSHLAAPL 163

Query: 178 GCGVTTGYGAAIKTANVQEGDTVAVFGCG--------TVGLSVMQG---AKSRGASKIIA 226
            CG  T Y   ++             GCG         +G    QG   AK+ GA ++ A
Sbjct: 164 MCGGLTVYSPLVRN------------GCGPNKKVGIVGIGGIGHQGLLFAKAMGA-EVYA 210

Query: 227 VDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDF--TFD----CTGN- 279
           +   + K++ +   GA  FI  KE+               D G  +  TFD    C  + 
Sbjct: 211 ISRTSAKKEDAMKLGADHFIATKEE--------------PDWGTKYFDTFDLIVVCASSL 256

Query: 280 TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGL 339
           T++  + +    K  G              S +PF L  G     SA G I   SEM  L
Sbjct: 257 TDVDFNTVPNTMKIGGSIVSISVPEQNETLSLKPFGL-KGVSISNSALGSI---SEMRDL 312

Query: 340 IKDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGDC 375
           +K      +K+        P  E  + +AFE +  GDC
Sbjct: 313 LKLVSENNIKL---WVETIPIGEKGVKEAFERMDKGDC 347

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 99/240 (41%), Gaps = 38/240 (15%)

Query: 65  FPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGK--------------CKFCTSG 110
            P  +GHE +G+VE VG    T K GDHV+   T  C                C  C+ G
Sbjct: 67  LPQAMGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAP 170
            TN+C+ + A  G G+   G                    F+E  V+ +  V  I    P
Sbjct: 127 MTNICAHL-ALCGAGLESGG--------------------FAERLVINEAHVHKIPDHMP 165

Query: 171 LDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDIN 230
           LD   L+       +  A+K A+ ++G +  + G G +GL  +   K  G   I+  +  
Sbjct: 166 LDIGALIQPISVCWH--AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPA 223

Query: 231 NKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEAC 290
             +R+Y+   GA  + +P     ++     + +     G D+TFDC+G    +  A+E C
Sbjct: 224 TIRREYAGKMGAKVY-DPTGVPFDESVKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 95/244 (38%), Gaps = 30/244 (12%)

Query: 17  AYNAKKSLSVEEITVDPPKA---HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC------ 67
           A N  K  +  ++T   PKA   H+V I++E   +C ++ + L          C      
Sbjct: 11  AINDPKDWATPKLTSFEPKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYG 70

Query: 68  ----ILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQ 122
               ++GHE  G V +VG  V     GD V +    + C +C  C SG    C    +T 
Sbjct: 71  PKTQVVGHEVVGKVVAVGPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTY 130

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
            K   PDG              ++    ++ +    +     I P+ P +    L CG  
Sbjct: 131 CK-PYPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGL 175

Query: 183 TGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGA 242
           T +    +    +    VAV G G +G   +  A++ GA ++ A    + KR  +   GA
Sbjct: 176 TVFSPIKRNLQGKHDPKVAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGA 234

Query: 243 TDFI 246
             F+
Sbjct: 235 HHFV 238

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 147/358 (41%), Gaps = 45/358 (12%)

Query: 27  EEITVDPPK--AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDV 84
           +++  +P K   H++ IKIE   VC +D +T SG   +   P ++GHE  G V  +GD  
Sbjct: 23  KKVEYEPKKFLDHDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKC 82

Query: 85  MT-VKPGDHV----IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKG 139
            + +K GD V     A    ECG+CK   S     C+    T             ++   
Sbjct: 83  TSGLKLGDRVGVGAQAFSCLECGRCK---SDNEPYCTKSVWT-------------YSTNY 126

Query: 140 EDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDT 199
           ED Y+  G   +++Y  + +   + I    P   A  L CG  T +   ++      G  
Sbjct: 127 EDGYNSKG--GYADYIRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKK 183

Query: 200 VAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIV 259
           V + G G +G   +  AK+ GA ++ A+   + K+  S   GA  FI  K    E+    
Sbjct: 184 VGIMGIGGIGHMALIFAKAMGA-EVYAISRTSAKKDDSIKMGADHFIATK----EEPDWA 238

Query: 260 EKLIDMTDGGLDFTFDCTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVT 318
            K  D      D    C+ + T+I  D +    K  G+             + +PF L+ 
Sbjct: 239 TKYFDT----FDLIVVCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVINLKPFGLL- 293

Query: 319 GRVWKGSAFGGIKGRSEMGGLI--KDYQSGALKVEEFITHRRPFKEINQAFEDLHNGD 374
           G     SA GGI    +M  L+  KD +   + VE      +  KE+   FE +  GD
Sbjct: 294 GVSISNSALGGINEIKQMLDLVSKKDLK---IWVETVPISEKGVKEV---FERMDMGD 345

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 96/386 (24%), Positives = 155/386 (40%), Gaps = 51/386 (13%)

Query: 13  VAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHE 72
           +A V +   K+    E    P   ++V IKIE   VC +D +  +G+  +   P ++GHE
Sbjct: 9   IAVVDHKDWKNPKKVEFPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHE 68

Query: 73  GAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDG 130
             G V  VG    T +K GD V +      C +C+ C +     C+    T         
Sbjct: 69  IIGKVVKVGPKCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTT--------- 119

Query: 131 TTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIK 190
               ++   ED Y   G   ++ Y  V +   V I    P + A  L CG  T Y   ++
Sbjct: 120 ----YSQPYEDGYVSQG--GYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLR 173

Query: 191 TANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
                 G  V + G G +G   +  AK+ GA ++ A+  +N K++ S   GA  +I  KE
Sbjct: 174 NG-CGPGKKVGILGIGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKE 231

Query: 251 DLAEDQTIVEKLIDMTDGGLDF--TFD----CTGN-TNIMRDALEACHKGWGQSXXXXXX 303
           +               D G  +  TFD    C  + T++  D +    K  G+       
Sbjct: 232 E--------------PDWGTKYFDTFDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISVP 277

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKE- 362
                 + +PF L+ G     S  G I   +EM  L+K      +K+        P  E 
Sbjct: 278 EQDEVLTMKPFGLI-GVSIANSILGSI---AEMKQLLKLVSENNIKI---WVETLPVGEA 330

Query: 363 -INQAFEDLHNGDCLR--TVLRFQEE 385
            + +AFE +  GD     T++ +++E
Sbjct: 331 GVKEAFERMDKGDVRYRFTLVDYEKE 356

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 91/226 (40%), Gaps = 48/226 (21%)

Query: 35  KAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVI 94
           K +E+ IK ++  + H D  +         FP + G E +GIV   G+ V          
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIVVRRGEKV---------- 121

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                   + KF   G+  + S                          Y  +  STF EY
Sbjct: 122 -------DEEKFPLGGEVFIASTT------------------------YRDLRTSTFQEY 150

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANV----QEGDTVAVFGCGT-VG 209
           TV     V  +  +  LD A  +G  + T   A     NV    +E  ++ ++G  T VG
Sbjct: 151 TVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVG 210

Query: 210 LSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAED 255
           + V+Q AKS G +KII +  + K  QY  + GAT  I+ +E+  ED
Sbjct: 211 IFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIH-REEKTED 254

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 97/247 (39%), Gaps = 63/247 (25%)

Query: 38  EVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALY 97
           EV IK  +T V + ++Y   G  P  L P +LG E  G V ++G  V  +K GD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYPAEL-PYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 98  TAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVV 157
                                                          ++  +TF+++T V
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 158 ADVS-VVAIDPKAPLDAACLLGCGVTTGYGAAI---KTANVQEGDTVAVFGC-GTVGLSV 212
            + + V  +      +   L   G+  G  A     +  +V++GD V ++   G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 213 MQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG-GLD 271
            Q  + RGA  I AV   N+K   +   GA   IN KED      I+EK+  +T G G+D
Sbjct: 166 NQLLRMRGAHTI-AVASTNEKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVD 219

Query: 272 FTFDCTG 278
             FD  G
Sbjct: 220 VAFDSVG 226

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 93/394 (23%), Positives = 147/394 (37%), Gaps = 61/394 (15%)

Query: 10  IQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCIL 69
            Q +A + +   K+    E    P   H++ IKI+   VC +D +  +G+  +   P ++
Sbjct: 7   FQGIAVLDHKDWKNPKKVEFPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVV 66

Query: 70  GHEGAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVM 127
           GHE  G V  +G    T +K GD V +      C +C  C +     C     T      
Sbjct: 67  GHEIIGKVVKIGPKCNTGLKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTT------ 120

Query: 128 PDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGA 187
                  ++   ED Y   G   ++ Y  V +   V I    P   A  L CG  T Y  
Sbjct: 121 -------YSQPYEDGYVSQG--GYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSP 171

Query: 188 AIKTANVQEGDTVAVFGCGTVGLSV-----------MQGAKSRGASKIIAVDINNKKRQY 236
            ++             GCG                 +  AK+ GA ++ A+  +N K++ 
Sbjct: 172 LLRN------------GCGPGKKVGIVGIGGIGHMGLLFAKAMGA-EVYAISRSNAKKED 218

Query: 237 SSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGN-TNIMRDALEACHKGWG 295
           S   GA  +I  K    E+    EK  D      D    C  + T++  D +    K  G
Sbjct: 219 SLKLGADHYIATK----EEPNWGEKYFDT----FDLIVVCASSLTDVDFDVMPKAMKVGG 270

Query: 296 QSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFIT 355
           +             + +PF L+ G     SA G IK   E+  L+K      +K+     
Sbjct: 271 RIVSISIPDEDQTLTMKPFGLL-GVSIANSALGSIK---EIEQLLKLVSEKDIKI---WV 323

Query: 356 HRRPFKE--INQAFEDLHNGDCLR--TVLRFQEE 385
              P  E  + +AFE +  GD     T++ F +E
Sbjct: 324 ETLPVGEAGVKEAFERMDKGDVKYRFTLVDFDKE 357

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 98/253 (38%), Gaps = 71/253 (28%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIAL 96
           +E+ IK ++  +   +AY   G  P  L P ILG E  G+V + G  V     GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPVQL-PQILGREATGVVVAKGQSVKNFDIGDKV--- 92

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                                                           +M  STF++YT 
Sbjct: 93  -----------------------------------------------AYMSSSTFAQYTK 105

Query: 157 VADVSVVAIDPKAPLD-------AACLLGCGVTTGYGAAIKTANVQEGDTVAVFGC-GTV 208
            +   +++  P    D       AA + G    T    A K   V+EGD + ++   G V
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYK---VKEGDYILLYAAAGGV 162

Query: 209 GLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN-PKEDLAEDQTIVEKLIDMT- 266
           GL + Q  K RGA   IAV    +K + +  FGA   IN  KED      I+++ +++T 
Sbjct: 163 GLLMDQLLKERGAHA-IAVVSTEEKEELAKKFGAEYVINSSKED------ILKRALEITN 215

Query: 267 DGGLDFTFDCTGN 279
           D G+D  FD  G 
Sbjct: 216 DKGVDAVFDSVGK 228

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 117/306 (38%), Gaps = 60/306 (19%)

Query: 15  AVAYNAKKSLSVEEITVDPP--KAHEVRIKIEFTAVCHTD----------------AYTL 56
           A+AY  K  +       +P      E+ I I +  +C TD                 + +
Sbjct: 3   ALAYFGKNDIKFTNDLPEPKITAPDELIIDISWCGICGTDLHEFQDGPIFFPENGCCHEI 62

Query: 57  SGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECG-------------- 102
           SG   EGL P  +GHE AGIV  +G  V   + GD V+   T  C               
Sbjct: 63  SG---EGL-PQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQE 118

Query: 103 KCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
           +C  C  G  N+CS +    G GV   G                    F+E  V+ +   
Sbjct: 119 ECAACKKGLYNICSNL-GLVGCGVQSGG--------------------FAERMVMNEAKC 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGAS 222
             I     +D A L+     + +  A++ +  + G +V + G G +GL  +      G +
Sbjct: 158 YKIPEHLTMDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVT 215

Query: 223 KIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNI 282
           +++  +    +R  +   GA  +     D  E    +  +    D G D+TFDC+GN   
Sbjct: 216 EVVVSEPAKIRRDLAEKMGAVVYDPMTRDHDESIKYLRSIAPGGD-GFDYTFDCSGNPAT 274

Query: 283 MRDALE 288
           ++ A+E
Sbjct: 275 LKAAIE 280

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 99/252 (39%), Gaps = 41/252 (16%)

Query: 13  VAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHE 72
           +A   YN  K+    +        H+++IK+E   VC +D +  SG       P ++GHE
Sbjct: 10  IAVQDYNDWKNPKKIQFKAKTFNDHDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHE 69

Query: 73  GAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDG 130
             G V  VGD     +K GD V +      C +C  C +   + C    AT G G  PDG
Sbjct: 70  IVGRVVKVGDRCDNGLKVGDRVGVGAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG 128

Query: 131 TTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIK 190
                         ++    ++++  V +  VV I    P + A  L CG  T +   ++
Sbjct: 129 --------------YISKGGYADFVRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLR 174

Query: 191 TANVQEGDTVAVFGCGTVGLSVMQG-----------AKSRGASKIIAVDINNKKRQYSSN 239
                        GCG      + G           A + GA ++ A+   +KK+  +  
Sbjct: 175 N------------GCGPGKKVGIVGIGGIGHQGVIFANAMGA-EVYAISRTSKKKDDAFK 221

Query: 240 FGATDFINPKED 251
            GA  FI  KE+
Sbjct: 222 LGAHHFIATKEE 233

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 111/268 (41%), Gaps = 77/268 (28%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVES 79
           +  E+  V      ++ IK ++T V + ++Y       +GL+PC    ILG E AG + +
Sbjct: 23  IKYEDYPVPSISGKDLLIKNKYTGVNYIESYF-----RKGLYPCEKPYILGREAAGTIVA 77

Query: 80  VGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKG 139
            G DV   + GD V                                              
Sbjct: 78  KGKDVTNFEIGDKV---------------------------------------------- 91

Query: 140 EDIYHFMGCSTFSEYT------VVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                ++  STF++YT       V  +S    D +  L AA LL     T      +  +
Sbjct: 92  ----AYISNSTFAQYTKFPSEGTVMKLSKETNDEELKLYAAGLLQA--LTALSFTNEAYH 145

Query: 194 VQEGDTVAVF-GCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN-PKED 251
           V++GD + +F   G VGL + Q  + +GA   IAV   ++K + +  +GA   IN  KED
Sbjct: 146 VRKGDYILLFAAAGGVGLILNQLLRMKGAHA-IAVASTDEKLEIAKEYGAEYLINSSKED 204

Query: 252 LAEDQTIVEKLIDMTDG-GLDFTFDCTG 278
                 I++K++++T+G G+D +FD  G
Sbjct: 205 ------ILKKVLEITNGEGVDASFDSVG 226

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 92/396 (23%), Positives = 151/396 (38%), Gaps = 71/396 (17%)

Query: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60
           M ++T     Q +A + +   K+    E    P   +++ IKIE   VC +D +  +G  
Sbjct: 1   MTSSTSPAKFQGIAVLDHKDWKNPKKVEFEPKPFYPNDIDIKIECCGVCGSDIHAAAGHW 60

Query: 61  PEGLFPCILGHEGAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
            +   P ++GHE  G V  +G++  + +K GD V +      C  C+ C S     C + 
Sbjct: 61  GDLEKPLVVGHEVIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKSNNEPYCPSF 120

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLG 178
             T G+    DG    +++KG           +++Y  V +   V I    P   A  L 
Sbjct: 121 VTTYGQSYK-DG----YSSKG----------GYADYIRVHEHFAVPIPENIPSHLAAPLM 165

Query: 179 CGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSV-----------MQGAKSRGASKIIAV 227
           CG  T +   ++             GCG                 +  AK+ GA ++ A+
Sbjct: 166 CGGITVFSPLLRN------------GCGPGKKVGIVGIGGIGHMGLIFAKAMGA-EVYAI 212

Query: 228 DINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDF--TFD----CTGN-T 280
              + K++ +   GA  FI  KE+               D G  +  TFD    C  + T
Sbjct: 213 SRTSAKKEDAMKLGADHFIATKEE--------------PDWGTKYFDTFDLIVVCANSLT 258

Query: 281 NIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI 340
           ++  + +    K  G              + +PF L+ G     SA GG+K   E+  L+
Sbjct: 259 DVDFNVVPKAMKVGGNIVSICVPEQNEVLNLKPFGLL-GVSISNSALGGVKEIKELLDLV 317

Query: 341 KDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
                  LK+        P  E  + QAFE +  GD
Sbjct: 318 ---SKNNLKI---WVETLPIGEEGVKQAFERMDKGD 347

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 95/224 (42%), Gaps = 22/224 (9%)

Query: 33  PPKA---HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VK 88
           PPK     +V IKIE   VC +D +  SG   +   P I+GHE  G V  +G      +K
Sbjct: 28  PPKPFHDRDVDIKIECCGVCGSDIHAASGHWGDIEKPLIVGHEIIGTVVKLGSKCENGLK 87

Query: 89  PGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMG 147
            GD V +      C KC  C +   + C     T G    PDG    + +KG        
Sbjct: 88  LGDRVGMGAQCYSCLKCDRCLNNNESYCQHFVTTYGMN-YPDG----YASKG-------- 134

Query: 148 CSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGT 207
              ++E+  V +  V+ I    P   A  L CG  T +    +      G  V + G G 
Sbjct: 135 --GYAEFVRVHEHFVIPIPENIPSHLAAPLMCGGNTIFSPLTRNG-CGPGKKVGIMGIGG 191

Query: 208 VGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
           +G   +  A + GA ++ A+   +KKR+ +   GA  FI  KE+
Sbjct: 192 IGHMGLIFANALGA-EVYAISRTSKKREDAKKLGAHHFIATKEE 234

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 94/217 (43%), Gaps = 19/217 (8%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKPGDHV-I 94
           +++ IKIE   VC +D +  SG+  +   P ++GHE  G V  VG    + +K GD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C  C  C +     C  V  T G    PDG    +N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG----YNGKG----------GYANY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQ 214
             V +   V I    P   A  L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 215 GAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
            AKS GA ++ A+  ++ K++ +   GA  FI  K++
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDE 233

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 81/351 (23%), Positives = 132/351 (37%), Gaps = 82/351 (23%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIAL 96
           +E+ IK ++T +   ++Y   G  P    P +LG E +G V + G  V            
Sbjct: 47  NEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASGTVVAKGKAV------------ 93

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                         K NL   V                          ++   TF++YT 
Sbjct: 94  -------------SKFNLADKV-------------------------AYLSAGTFAQYTK 115

Query: 157 VADVSVVAIDPKAPLDAACLLGCG----VTTGYGAAIKTANVQEGDTVAVF-GCGTVGLS 211
           +A+   ++  P+   D    L       V T    A +   V++GD V ++   G VGL+
Sbjct: 116 IAETGHISKLPENTTDKQLELYAASLVQVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLA 175

Query: 212 VMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN-PKEDLAEDQTIVEKLIDMTDG-G 269
             Q  K  GA   IAV   ++K Q +  FGA   +N  KED      ++ +++++T G G
Sbjct: 176 FNQILKRLGAH-TIAVASTDEKLQLAKEFGAEYLVNSSKED------VLARVLEITQGQG 228

Query: 270 LDFTFDCTGNTNIMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKG 324
           +D  +D  G  +     L A  +      +G +            S +       ++ + 
Sbjct: 229 VDVAYDSIGK-DTFETTLSALRRKGTFVSFGNASGPVPPIAISRLSPKNI-----KILRP 282

Query: 325 SAFGGIKGRSEMG----GLIKDYQSGALKVEEFITHRRPFKEINQAFEDLH 371
           + FG I  + E       LIK   S   KV   IT   P +E  +A E+L 
Sbjct: 283 TLFGYIASQEEWAYYSEELIKLLHSEEFKV--LITKIYPLEEYRKATEELE 331

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 112/295 (37%), Gaps = 48/295 (16%)

Query: 17  AYNAKKSLSVEEITVDPPK---AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC------ 67
           A +  K  +  ++T   PK     +V I++E   +C ++ + L          C      
Sbjct: 11  AISDPKDWATPKLTSFQPKNFGPRDVDIEVECCGICASELFALKNDWTHEPLACLSSKYG 70

Query: 68  ----ILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQ 122
               ++GHE  G V +VG +V   K GD V +    + C +C  C S     C+    T 
Sbjct: 71  PKTQVVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTY 130

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
                PDG              ++    ++ +    +     I P+ P +    L CG  
Sbjct: 131 CNP-YPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGL 175

Query: 183 TGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGA 242
           T +    +    ++   VA+ G G +G   +  +K+ GA ++ AV     KR  +   GA
Sbjct: 176 TVFSPIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGA 234

Query: 243 TDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFD----CTGNTNIM-RDALEACHK 292
             FI   E                + GLD TFD    C  +T+ +  +AL  C K
Sbjct: 235 DHFIATSE-------------PNWNAGLDDTFDLILNCASSTSSLDLNALLPCLK 276

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 116/306 (37%), Gaps = 60/306 (19%)

Query: 15  AVAYNAKKSLSVEEITVDP--PKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----- 67
           A+ Y +K  +   +   +P      E+ + I +  +C TD + L+  D    FP      
Sbjct: 3   ALVYFSKGDIRFTDTLAEPEISTGDELLVDIVYCGICGTDLHELT--DGPIFFPLDNERN 60

Query: 68  ---------ILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGK--------------C 104
                     +GHE AGIV +VG  V   + GDHV    T  C                C
Sbjct: 61  EISGNGLPQAMGHEMAGIVTAVGSGVKKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVC 120

Query: 105 KFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVA 164
             C  G  N C  +    G GV   G                    F+E  VV +     
Sbjct: 121 TSCQRGMYNCCDYL-GLIGNGVQSGG--------------------FAERIVVNESHCYK 159

Query: 165 IDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKI 224
                P + A L+       +  AI  A  + G +V + G G +GL  +      G ++I
Sbjct: 160 CPDNLPWEVAALIQPIAVCWH--AINIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEI 217

Query: 225 IAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG--GLDFTFDCTGNTNI 282
           I  +    +R Y+   GA  + +P +  + +Q+I   L  M  G  G D+ FDC+G    
Sbjct: 218 IVSEPVKLRRDYAEKMGAVVY-DPLQ-CSHEQSI-PNLRKMAPGADGFDYCFDCSGTPAT 274

Query: 283 MRDALE 288
           ++ ++E
Sbjct: 275 LKASIE 280

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 84/190 (44%), Gaps = 23/190 (12%)

Query: 193 NVQEGDTVAVFGC-GTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
           NVQ+GD + V+   G VGL   Q  K+RGA + IAV   ++K Q +  +GA   IN  +D
Sbjct: 164 NVQKGDFILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD 222

Query: 252 LAEDQTIVEKLIDMTDG-GLDFTFDCTGNTNIMRDALEACHKG----WGQSXXXXXXXXX 306
                 IVEK+ + T+G G+   FD  G             KG    +G +         
Sbjct: 223 -----DIVEKVKEFTNGEGVAAAFDSIGKDTFETTLQVVKRKGTIVSFGNASGAVPPFSI 277

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEM----GGLIKDYQSGALKVEEFITHRRPFKE 362
              S +  +LV  ++     F  +   SE       LI+   SG LK+   I+   P K+
Sbjct: 278 NRLSPKNLKLVRPQL-----FAYVADPSEWEHYSSELIRLIDSGELKIT--ISKVYPLKD 330

Query: 363 INQAFEDLHN 372
             +A EDL +
Sbjct: 331 YKEATEDLES 340

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 105/255 (41%), Gaps = 19/255 (7%)

Query: 10  IQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCIL 69
            Q +A + +   K++   E +      H++ IKIE   VC +D +  SG+  +   P ++
Sbjct: 7   FQGIAVLDHKDWKNVKKTEYSPKKFGDHDIDIKIEACGVCGSDVHCASGNWGDTPKPLVV 66

Query: 70  GHEGAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVM 127
           GHE  G +  +G    +  K GD V +      C +C  C +     C+ V  T      
Sbjct: 67  GHEIIGTIVKMGPKCNSGYKIGDRVGMGAQAMSCLECDRCINDNEPYCAKVVCTYANPY- 125

Query: 128 PDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGA 187
                       ED Y   G   ++ Y  V +   V I    P   A  L CG  T + +
Sbjct: 126 ------------EDGYSSRG--GYANYVRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-S 170

Query: 188 AIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN 247
            +K      G  V + G G +G   +  AK+ GA ++ A+   +KKR  +   GA  FI 
Sbjct: 171 PLKRNGCGPGKKVGIIGIGGIGHMGIILAKAMGA-EVYAISRTSKKRDDAMKLGADHFIA 229

Query: 248 PKEDLAEDQTIVEKL 262
            KE+    +   +KL
Sbjct: 230 IKEEPDWHKEYFDKL 244

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 132/343 (38%), Gaps = 36/343 (10%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKPGDHV-I 94
            +V IK+    VC +D +  +G        C++GHE  G V  VG      VK GD V +
Sbjct: 34  RDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
              +  C +C+ C +G    C          + PDG+     A+G           F  +
Sbjct: 94  GAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGS----KAQG----------GFGSH 139

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQ 214
               +  V  I  +     A  L CG  T +   ++   V  G TV + G G +G   + 
Sbjct: 140 VRTHEYFVHPIPKELDTVNAAPLLCGGITAFSPLLR-GQVGPGKTVGIVGIGGIGHIAIL 198

Query: 215 GAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTF 274
            AK+ GA K+IA+  +  K++     GA ++I   E     Q           G +DF  
Sbjct: 199 FAKAMGA-KVIAISRSASKKEDCLKLGADEYIASAEGDDWKQKFA--------GSIDFML 249

Query: 275 DCTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGR 333
            C  + +    D+L +  K  G+             S  P  L+  +      F  +  R
Sbjct: 250 LCNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLLGIKF----GFSALGSR 305

Query: 334 SEMGGLIKDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
           +E   + +  +   +K+        P  E  +++AFE + NGD
Sbjct: 306 NEFQKMFELVKKNNIKL---WVETLPIGEKGLHEAFERVENGD 345

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 108/262 (41%), Gaps = 65/262 (24%)

Query: 24  LSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVES 79
           +  E+  V      E+ IK ++T V + ++Y       +G++PC    +LG E +G V +
Sbjct: 23  IKYEDYPVPSISEEELLIKNKYTGVNYIESYFR-----KGIYPCEKPYVLGREASGTVVA 77

Query: 80  VGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV-MPDGTTRFHNAK 138
            G  V   + GD V     A      F    K        ++QG  + +P GT+      
Sbjct: 78  KGKGVTNFEVGDQV-----AYISNSTFAQYSKI-------SSQGPVMKLPKGTS------ 119

Query: 139 GEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGD 198
                                      D +  L AA LL   V T      +  +V++GD
Sbjct: 120 ---------------------------DEELKLYAAGLL--QVLTALSFTNEAYHVKKGD 150

Query: 199 TVAVF-GCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQT 257
            V +F   G VGL + Q  K +GA   IAV   ++K + +  +GA   IN     A  + 
Sbjct: 151 YVLLFAAAGGVGLILNQLLKMKGAH-TIAVASTDEKLKIAKEYGAEYLIN-----ASKED 204

Query: 258 IVEKLIDMTDG-GLDFTFDCTG 278
           I+ +++  T+G G+D +FD  G
Sbjct: 205 ILRQVLKFTNGKGVDASFDSVG 226

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 87/357 (24%), Positives = 141/357 (39%), Gaps = 43/357 (12%)

Query: 27  EEITVDPPK--AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDV 84
           ++I  DP     H+V IKIE   VC +D +  +G+  +   P ++GHE  G V  +G   
Sbjct: 22  KKIKYDPKPFYDHDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKS 81

Query: 85  MT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDI 142
            + ++ G  V +      C +C  C S     C+    T G+               ED 
Sbjct: 82  NSGLQVGQRVGMGAQVFSCLECDRCKSDNEPYCTKFVTTYGQPY-------------EDG 128

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT--ANVQEGDTV 200
           Y   G   +++Y  V +  VV I    P   A  L CG  T Y   ++      ++   V
Sbjct: 129 YVSQG--GYADYVRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKVGIV 186

Query: 201 AVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
              G G++G  +   AK+ GA   + +  ++KKR+ +   GA  +I       E++   E
Sbjct: 187 GFGGIGSMGTLI---AKAMGAETYV-ISRSSKKREDAMKMGADHYIA----TLEEENWGE 238

Query: 261 KLIDMTDGGLDFTFDCTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTG 319
           K  D      D    C  + T I  D +    K  G+             + +P+ L   
Sbjct: 239 KYFDT----FDLIVVCASSLTGIDFDVMPKAMKVGGRIVSISIPEQHEVLTLKPYGLKAV 294

Query: 320 RVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
            +   SA G IK   E+  L+K      +K+        P  E  +++A E +  GD
Sbjct: 295 SI-SYSALGSIK---ELKQLLKLVSEKNVKI---WVETLPVGEAGVHEALERMEKGD 344

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 108/271 (39%), Gaps = 32/271 (11%)

Query: 15  AVAYNAKKSLSVEEITVDPPK---AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGH 71
           AV  + KK LS E++ V P K     +V I+IE   VC +D +   G+  E   P ++GH
Sbjct: 11  AVVDSHKKWLSPEKV-VYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGH 69

Query: 72  EGAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPD 129
           E  G V  +GD   T +K GD V +    + C  C  C +     C     T  +    D
Sbjct: 70  EIIGKVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFED 129

Query: 130 GTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAI 189
           G              ++G   ++ +  V +  V+ I      +    L CG  T Y    
Sbjct: 130 G--------------YVGQGGYASHIRVHEHFVIPIPESLETNNVAPLLCGGATVYSPLK 175

Query: 190 KTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPK 249
           +           V   G   + ++  AK+ GA ++ A+  ++ K + S   GA  +I   
Sbjct: 176 RNGCGPGKKVGIVGIGGIGHMGILL-AKAMGA-EVYAISRSHAKEETSKQLGADHYI--- 230

Query: 250 EDLAEDQTIVEKLIDMTDGGLDFTFDCTGNT 280
               ED+    K  D     LDF   C GN+
Sbjct: 231 --ATEDEGWETKYFDT----LDFMVLC-GNS 254

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 148/369 (40%), Gaps = 82/369 (22%)

Query: 18  YNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCIL----GHEG 73
           Y+  K  +++  TV+   ++E+ IK  ++ +   +AY       +G++PC L    G E 
Sbjct: 36  YDVIKYKTIQTPTVE--NSNEMVIKNSYSGINFIEAYF-----RKGIYPCELPYLPGREA 88

Query: 74  AGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           +GIV  VG DV   + GD V  L+                                    
Sbjct: 89  SGIVAEVGKDVKNFQIGDKVAYLH------------------------------------ 112

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN 193
                GE +  F   +   E   +  +S  A D    L AA LL     T      +   
Sbjct: 113 -----GETMAEF---TKIKETDPIIKLSKDASDENLKLYAAGLLQS--LTAITLINEAHE 162

Query: 194 VQEGDTVAVF-GCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDL 252
           V++G+ V V+   G VGL + Q  K +GA   IAV    +K + +   GA   IN KE  
Sbjct: 163 VKKGEYVLVYAAAGGVGLLLDQLLKMKGAH-TIAVCSTKEKLELAKANGAEFSINSKE-- 219

Query: 253 AEDQTIVEKLIDMTDG-GLDFTFDCTGNTNIMRDALEACH-KG----WGQSXXXXXXXXX 306
              + +V++++++T+  G+D  +D  G      D L A   KG    +G +         
Sbjct: 220 ---ENVVQRVMEITNNKGVDVAYDSIGKAT-FEDTLAALKLKGSLVSFGNASGPVPPLLI 275

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ----SGALKVEEFITHRRPFKE 362
              S +  +LV  +++     G I    +     K++Q    SG L ++ F T+  P K+
Sbjct: 276 NRLSPKNLKLVRPQLY-----GYITNPEDWEKYSKEFQSLVDSGKLNIKIFKTY--PLKD 328

Query: 363 INQAFEDLH 371
              A ++L 
Sbjct: 329 YKIAVQELE 337

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 101/272 (37%), Gaps = 43/272 (15%)

Query: 22  KSLSVEEITVDPPK---AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----------I 68
           K  +  ++T   PK   AH+V I++E   +C ++ ++L          C          +
Sbjct: 18  KDWANPKLTSYEPKNFEAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQV 77

Query: 69  LGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVM 127
           +GHE  G V +VG +V     GD V +      C KC  C SG    C     T      
Sbjct: 78  VGHEVVGKVVAVGSNVTLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY----- 132

Query: 128 PDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGA 187
               +R+ +        ++    ++ +    +     I    P +    L CG  T Y  
Sbjct: 133 ---CSRYADG-------YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSP 182

Query: 188 AIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN 247
             +     +   VA+ G G +G   +  +K+ GA ++ A      K++ +   GA  FI 
Sbjct: 183 IKRNIEGVKDPKVAIIGIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFIA 241

Query: 248 PKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGN 279
             E+  E              GL+ TFD   N
Sbjct: 242 TGEEGWES-------------GLNDTFDLILN 260

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 69/350 (19%), Positives = 129/350 (36%), Gaps = 78/350 (22%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIAL 96
           +E+ IK ++  + + ++Y   G  P    P +LG E +G+V + GD V      D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKV--- 114

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                                                           ++  +TF++YT 
Sbjct: 115 -----------------------------------------------AYLSSNTFAQYTK 127

Query: 157 VADVSVVAIDPKAPLDAACLLGCG----VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSV 212
           +++   V+  P+   D    L  G      T      +   V++GD + ++         
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 213 MQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG-GLD 271
                 +  +  IAV   ++K Q +  +GA   IN  +D      ++ +++++T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 272 FTFDCTGNTNIMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSA 326
             FD  G  +    +L+A  +      +G +            + +  +L+     + S 
Sbjct: 243 AAFDSVGK-DTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPKNIKLL-----RPSL 296

Query: 327 FGGIKGRSEM----GGLIKDYQSGALKVEEFITHRRPFKEINQAFEDLHN 372
           FG I    E       L     SGALK+   I+   P +E NQA E L +
Sbjct: 297 FGYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLES 344

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 105/249 (42%), Gaps = 67/249 (26%)

Query: 38  EVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVESVGDDVMTVKPGDHV 93
           ++ IK ++T V + ++Y       +GL+PC    +LG E  G++ + G DV   + GD V
Sbjct: 37  DILIKNKYTGVNYIESYFR-----KGLYPCEKPYVLGREATGVIVAKGKDVTNFETGDQV 91

Query: 94  IALYTAECGK-CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFS 152
             +  +   +  KF + G                +P GT+                    
Sbjct: 92  AYISNSTFAQYTKFPSEGTIM------------KLPSGTS-------------------- 119

Query: 153 EYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVF-GCGTVGLS 211
                        D K  L AA LL     T      +  +V++GD + V+   G VGL 
Sbjct: 120 -------------DEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYILVYAAAGGVGLI 164

Query: 212 VMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN-PKEDLAEDQTIVEKLIDMTDG-G 269
           + Q  + + A   IAV    +K + + ++GA   I+  KED      I+ +++++TDG G
Sbjct: 165 LNQLLRMKDAHA-IAVASTYEKLETAKDYGAEFLIDSSKED------ILTRVLEITDGKG 217

Query: 270 LDFTFDCTG 278
           +D +FD  G
Sbjct: 218 VDASFDSVG 226

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 85/355 (23%), Positives = 137/355 (38%), Gaps = 39/355 (10%)

Query: 27  EEITVDPPK--AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDV 84
           ++I+ +P K   ++V ++IE   +C +D +  SG+      P ++GHE  G V  VG   
Sbjct: 22  KKISYEPKKFDDYDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKC 81

Query: 85  MT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDI 142
            T VK GD V +    + C  C  C S     C+    T  +   PDG    + ++G   
Sbjct: 82  HTGVKVGDRVGVGAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG----YVSQGGYA 136

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAV 202
            H      F          V+ I  K P   A  L CG  T +   I            V
Sbjct: 137 SHIRAHEHF----------VIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIV 186

Query: 203 FGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKL 262
              G   + ++  AK+ GA ++ A+  ++ K++ +   GA  FI  KE+   ++      
Sbjct: 187 GIGGIGHMGLI-FAKALGA-EVYAISRSSAKKEDAMKLGADHFIATKEEPDWEKKYA--- 241

Query: 263 IDMTDGGLDFTFDCTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRV 321
                  LD    C  + T I  + L    +  G+             + +PFQL +G  
Sbjct: 242 -----STLDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SGIT 295

Query: 322 WKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
              S  G    R E+  L++      LK+        P  E  ++ AF  +  GD
Sbjct: 296 IGNSQLG---SRKELIQLLQLVADKDLKI---WVETLPISEESVHDAFVRMEKGD 344

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 104/263 (39%), Gaps = 58/263 (22%)

Query: 18  YNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIV 77
           Y+  K   +   T+  P  +++ IK ++  V + ++Y   G  P  L P ILG E +G+V
Sbjct: 35  YDVIKYKDIATPTIQTP--NDIIIKNKYAGVNYIESYFRKGIYPCAL-PAILGREASGVV 91

Query: 78  ESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNA 137
              G ++   + GD V   Y   C   +F                         T+  N+
Sbjct: 92  VDKGTNIKNFEIGDKV--AYIGNCSMAQF-------------------------TKIDNS 124

Query: 138 KGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEG 197
               I      ST  +  + A              A  L G    T      +   V++G
Sbjct: 125 M---IMKLSSDSTNEDLKLYA--------------AGILQGL---TALSFVTEAYEVKKG 164

Query: 198 DTVAVF-GCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQ 256
           D + V+   G  GL   Q  K+RGA  +IAV  +++K Q +   GA   IN K D     
Sbjct: 165 DYILVYAAAGGAGLIFDQLIKARGAH-VIAVCSSDEKLQLAKENGAEYLINSKTD----- 218

Query: 257 TIVEKLIDMTDG-GLDFTFDCTG 278
            I+ K++++TD  G+   FD  G
Sbjct: 219 DILTKVMEITDNKGVQAAFDSVG 241

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 103/250 (41%), Gaps = 67/250 (26%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVESVGDDVMTVKPGDH 92
            ++ IK ++  V + ++Y       +GL+PC    +LG E  G V + G DV   + GD 
Sbjct: 36  EDLLIKNKYAGVNYIESYF-----RKGLYPCEKPYVLGREATGTVVAKGKDVNNFQIGDQ 90

Query: 93  VIAL-YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTF 151
           V  + ++      KF + G                              ++     C++ 
Sbjct: 91  VAYISHSTFAQYTKFSSKG------------------------------NVMRLPKCTS- 119

Query: 152 SEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVF-GCGTVGL 210
                         D K  L AA LL     T      +  +V++GD + V+   G VGL
Sbjct: 120 --------------DEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYILVYAAAGGVGL 163

Query: 211 SVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN-PKEDLAEDQTIVEKLIDMTDG- 268
            + Q  K +GA   IAV   ++K   +   GA   IN  KED      ++E+++++T+G 
Sbjct: 164 ILNQLLKMKGAHA-IAVASTDEKLDIAKKNGAEYLINSSKED------VLERVLEITNGE 216

Query: 269 GLDFTFDCTG 278
           G+D +FD  G
Sbjct: 217 GVDSSFDSIG 226

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 83/360 (23%), Positives = 129/360 (35%), Gaps = 80/360 (22%)

Query: 27  EEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT 86
           E+  V    A EV IK +F+ +   ++Y   G  P    P +LG E AG V + GD V  
Sbjct: 40  EDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSK 98

Query: 87  VKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFM 146
              GD V                                                   ++
Sbjct: 99  FNIGDKV--------------------------------------------------AYL 108

Query: 147 GCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN----VQEGDTVAV 202
              TF++YT   +   +   PK   D       G       A+   N    V++GD + +
Sbjct: 109 SPGTFAQYTKYPENGKILKLPKETTDEQLKFYAGSLVQGLTALTFVNDAYDVKKGDYILL 168

Query: 203 F-GCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEK 261
           +   G  GL   Q  K +GA   IAV   ++K + +  +GA   IN  +D       + K
Sbjct: 169 YAAAGGAGLIFNQLLKLKGA-HTIAVASTDEKLKLAREYGAEYVINSSKD-----DTLSK 222

Query: 262 LIDMTDG-GLDFTFDCTGNTNIMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQ 315
           ++++T+G G+   FD  G  +    +L+A  +      +G +            S++   
Sbjct: 223 VLEITNGEGVAAAFDSIGK-DTFEISLQAIKRKGTLVSFGNASGPVPPFSINRLSSKNL- 280

Query: 316 LVTGRVWKGSAFGGIKGRSEMG----GLIKDYQSGALKVEEFITHRRPFKEINQAFEDLH 371
               +V +   FG I    E       LI+   SG LKV  FI+   P  E   A E L 
Sbjct: 281 ----KVLRPQVFGYITTSEEWNHYASKLIELLSSGDLKV--FISGTYPLSEYRAATEALE 334

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 102/244 (41%), Gaps = 22/244 (9%)

Query: 10  IQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCIL 69
           I  V    + + K +S +  TV    A ++ +K+E   VC +D +  +G       P ++
Sbjct: 33  IAVVEGTEWTSPKKVSFKPKTV---YARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVV 89

Query: 70  GHEGAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVM 127
           GHE  G V  VG      +K GD V +      C +C  C S     CS +  T      
Sbjct: 90  GHEIIGRVIEVGSGCKEGLKVGDRVGVGAQALSCLECSRCESENEQYCSNMTGTYNFP-Y 148

Query: 128 PDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGA 187
           PDG              ++    ++ + +V +   + I    P   A  L CG  T +  
Sbjct: 149 PDG--------------YISQGGYASHVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSP 194

Query: 188 AIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN 247
            +++ NV  G +V V G G +G   +  AK+ GA+ + A+   + K+  +   GA  +I 
Sbjct: 195 LLRS-NVGPGTSVGVVGIGGIGHMAVIFAKALGAN-VTAISRRSNKKDDALKLGADVYIA 252

Query: 248 PKED 251
             ED
Sbjct: 253 AVED 256

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 84/345 (24%), Positives = 136/345 (39%), Gaps = 41/345 (11%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKPGDHV-I 94
           H+V IKIE   VC +D +  +G       P ++GHE  G V  +G    + +K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C +C  C S     C+    T             ++   ED Y   G   ++ Y
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTT-------------YSQPYEDGYVSQG--GYANY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT--ANVQEGDTVAVFGCGTVGLSV 212
             V +  VV +    P   A  L CG  T Y   I+      ++   V   G G++G  +
Sbjct: 139 VRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGSMGSLI 198

Query: 213 MQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDF 272
              AK+ GA   + +  ++KK++ +   GA  +I       E++   EK  D  D  +  
Sbjct: 199 ---AKAMGAETYV-ISRSSKKKEDAMKMGADHYIA----TLEEEDWGEKYFDTFDLIVVC 250

Query: 273 TFDCTG-NTNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIK 331
               TG + N+M  A+    K  G+             + +P+ L    +   SA G IK
Sbjct: 251 ASSLTGIDFNVMPKAM----KVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALGSIK 305

Query: 332 GRSEMGGLIKDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
              E+  L+K      +K+        P  E  +++A E +  GD
Sbjct: 306 ---ELKQLLKLVSENDIKI---WVETLPIGEAGVHEALERMEKGD 344

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 86/216 (39%), Gaps = 19/216 (8%)

Query: 38  EVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKPGDHV-IA 95
           +V I+IE   VC +D +  SG   E     ++GHE  G V  +G +  T +K GD V + 
Sbjct: 35  DVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRVGVG 94

Query: 96  LYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYT 155
              A C  C+ C       C     T  +   PDG              ++    ++ + 
Sbjct: 95  AQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG--------------YISQGGYASHI 139

Query: 156 VVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQG 215
            V +  V+ +  K P   A  L CG  T Y   ++           V   G   + ++  
Sbjct: 140 RVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVRGGCAPGKKVGIVGIGGIGHMGIL-F 198

Query: 216 AKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
           AK+ GA ++ A   +  KR+ S   GA  +I   E+
Sbjct: 199 AKAMGA-EVYAFSRHENKREDSMKLGADHYIATLEE 233

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 92/232 (39%), Gaps = 31/232 (13%)

Query: 33  PPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----------ILGHEGAGIVESVGD 82
           P    +V I+IE   +C ++ + L  +  +    C          ++GHE  G V +VG+
Sbjct: 34  PMSDFDVDIEIECCGICGSELHALQNNWSDEPLACLSAKIGPKSQVVGHEIVGHVVNVGN 93

Query: 83  DVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
            V     G+ V +      C KC  C +G    C+    T      PDG           
Sbjct: 94  KVTKFHKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE-YPDG----------- 141

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDT-- 199
              ++    ++ +    +  +V + P+        L CG  T Y + IK A     D   
Sbjct: 142 ---YVSQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVY-SPIKRALKDVTDKKP 197

Query: 200 -VAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
            VA+ G G +G   +  +K+    ++ A+  ++ K++ +   GA  F+N  E
Sbjct: 198 RVAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKKMGADHFVNTTE 248

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 86/381 (22%), Positives = 138/381 (36%), Gaps = 59/381 (15%)

Query: 10  IQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCIL 69
            Q +A + +   K     E    P   ++V I+I+   VC +D +  +G   +   P ++
Sbjct: 7   FQGIAVLDHKDWKDPKKIEYDPKPFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVV 66

Query: 70  GHEGAGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVM 127
           GHE  G V  VG    T VK GD V +      C KC  C S     C     T      
Sbjct: 67  GHEVIGRVVRVGPKCHTGVKIGDRVGVGAQVYSCLKCDRCKSDNEPYCPKFVTT------ 120

Query: 128 PDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGA 187
                  ++   ED Y   G   ++ +    +  V+ I    P   A  L CG  T Y  
Sbjct: 121 -------YSQPYEDGYVSQG--GYASHIRCHEHFVIPIPENIPTHLAAPLLCGGITVYSP 171

Query: 188 AIKTANVQEGDTVAVFGCGTVGLSVMQG-----------AKSRGASKIIAVDINNKKRQY 236
             +             GCG      + G           AK+ GA ++ A+  ++ K++ 
Sbjct: 172 LSRN------------GCGPGKKVGIVGIGGIGHMGLIFAKAMGA-EVYAISRSSAKKED 218

Query: 237 SSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGN-TNIMRDALEACHKGWG 295
           +S  GA  FI  K    E++   +K  D      D    C  + T++  D +    K  G
Sbjct: 219 ASKLGADHFIATK----EEENWSQKYFDT----FDLVVVCASSLTDVDFDKMSRVMKIGG 270

Query: 296 QSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFIT 355
           +               +P  L+   +    +  G+  R E+  L++      LK+     
Sbjct: 271 KIVSISVPEQSERLVLKPLGLLGVSI----SNSGLGSRKEIIQLLQLVSEKNLKI---WV 323

Query: 356 HRRPFKE--INQAFEDLHNGD 374
              P  E  + +AFE +  GD
Sbjct: 324 ETLPVGEKGVREAFERMDKGD 344

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 102/264 (38%), Gaps = 73/264 (27%)

Query: 27  EEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVESVGD 82
           E+  V   +  ++ IK  +  V   + Y  +G     L+PC    +LG E  G+V ++G 
Sbjct: 26  EDYPVPEVRGSDILIKNRYAGVNFIETYFRTG-----LYPCEKPYVLGREAVGVVAAIGA 80

Query: 83  DVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDI 142
           DV   K GD V  L           +SG                                
Sbjct: 81  DVRRFKVGDRVACL-----------SSG-------------------------------- 97

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTAN----VQEGD 198
                  TF++YT V++ S V   P    D       G       A+   +     Q G+
Sbjct: 98  -------TFAQYTAVSEKSNVLKLPDDIQDGELQAVAGSLVNGLTALTLVDEAYKPQVGE 150

Query: 199 TVAVF-GCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFIN-PKEDLAEDQ 256
            V V+   G VG  ++Q   +R   ++IAV   ++K Q + + GA   IN  +ED     
Sbjct: 151 IVLVYAAAGGVGQLLIQLLHARSV-RVIAVASTDEKLQIAKSRGAEFLINSSRED----- 204

Query: 257 TIVEKLIDMTDG-GLDFTFDCTGN 279
            IV K+++ TDG G+  ++D  G 
Sbjct: 205 -IVAKVLEFTDGEGVGASYDSVGK 227

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 99/239 (41%), Gaps = 26/239 (10%)

Query: 27  EEITVDPPK--AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDV 84
           E+ +  PP     ++ ++IE   VC +D + ++G       P  +GHE  G + ++G+ V
Sbjct: 22  EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVAGDWGRLYKPFAVGHEIVGKISAMGEQV 81

Query: 85  MTVK--PGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
              K   GD V +      CGKC  C+ G+   C     T       D +  F    G  
Sbjct: 82  NKEKFHLGDRVGVGAQIDSCGKCTRCSRGRQQNCKKSVLTY---TSVDESNGFQTQGG-- 136

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
                    ++     +   V  I        A  L CG  TG+   +    V+EG  V 
Sbjct: 137 ---------YASKIRASSEFVFKIPDGLDSAVAAPLLCGGITGFRPLL-AGGVKEGSKVG 186

Query: 202 VFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVE 260
           V G G +G   +  AK+ GA ++ A+  +N+K + +   GA  F+       ED+ +VE
Sbjct: 187 VVGIGGIGHMSILFAKALGA-EVTAISRSNRKLEDAKKLGADHFVA-----MEDKKLVE 239

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 63/161 (39%), Gaps = 17/161 (10%)

Query: 33  PPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKPGD 91
           P   H+V IKIE   VC +D +  +G       P ++GHE  G V  +GD   + +K G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQ 89

Query: 92  HV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST 150
            V +      C +C  C S     C+    T             ++   ED Y   G   
Sbjct: 90  RVGVGAQVFSCLECDRCKSDNEPYCTKFVTT-------------YSQPYEDGYISQG--G 134

Query: 151 FSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
           ++ Y  V +  +V I    P   A  L CG  T Y   ++ 
Sbjct: 135 YANYVRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRN 175

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 126/343 (36%), Gaps = 37/343 (10%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKPGDHV-I 94
           H++ I++    VC +D +  SG   E   P ++GHE  GIV   G    + +K  D V +
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C  C  CT      C    +T  K    DG              ++    +++Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQ 214
             V +   V I    P   A  L CG  T +   ++           +   G   + V+ 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNGCGPGKKVGILGIGGIGHMGVLL 198

Query: 215 GAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTF 274
            AK+ GA ++ A+   + K+  +   G   FI  K    E+    EK  D     LD   
Sbjct: 199 -AKAMGA-EVYAISRTSSKKADAVKLGTDHFIATK----EEPDWHEKYFDT----LDLLV 248

Query: 275 DCTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGR 333
            C G+ T++  D L       G+               +PF LV G     S  G +K  
Sbjct: 249 ICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMKEL 307

Query: 334 SEMGGLIKDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
            E+  L+    +  + VE       P  E  +N+AF  +  GD
Sbjct: 308 KELLELVAK-NNIKIWVETI-----PIGEKGVNEAFTRMEKGD 344

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 132/352 (37%), Gaps = 47/352 (13%)

Query: 33  PPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKPGD 91
           P   H++ IKIE   VC +D +  +G       P ++GHE  G V  +G    + +K G 
Sbjct: 30  PFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQ 89

Query: 92  HV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST 150
            V +      C +C  C +     C+    T             ++   ED Y   G   
Sbjct: 90  RVGVGAQVFSCLECDRCKNDNEPYCTKFVTT-------------YSQPYEDGYVSQG--G 134

Query: 151 FSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTA-----NVQEGDTVAVFGC 205
           ++ Y  V +  VV I    P   A  L CG  T Y   ++        V       +   
Sbjct: 135 YANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 206 GTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDM 265
           GT+ +S   GA++   S+      +++KR+ +   GA  +I       E+    EK  D 
Sbjct: 195 GTL-ISKAMGAETYVISR------SSRKREDAMKMGADHYIA----TLEEGDWGEKYFDT 243

Query: 266 TDGGLDFTFDCTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKG 324
                D    C  + T+I  + +    K  G+             S +P+ L    +   
Sbjct: 244 ----FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSI-SY 298

Query: 325 SAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
           SA G IK   E+  L+K      +K+        P  E  +++AFE +  GD
Sbjct: 299 SALGSIK---ELNQLLKLVSEKDIKI---WVETLPVGEAGVHEAFERMEKGD 344

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 127/341 (37%), Gaps = 82/341 (24%)

Query: 38  EVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALY 97
           +V +K ++  V   +AY   G  P  L P +LG E +G V  VG +V   K GD V    
Sbjct: 36  DVLVKNKYAGVNFIEAYFRKGYYPCEL-PYVLGREASGEVVQVGSEVKDFKIGDKV---- 90

Query: 98  TAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV- 156
                                                          ++G STF++YT  
Sbjct: 91  ----------------------------------------------AYLGGSTFAQYTKK 104

Query: 157 -----VADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGC-GTVGL 210
                + ++     D    L  + L+ C   T      +   V EGD + V+   G VG 
Sbjct: 105 STENHIMNLGQSCPDEDLKLYGSSLVQC--LTAISFIDEAYKVMEGDYILVYAASGGVG- 161

Query: 211 SVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG-G 269
           S++    S+  + +IAV  + +K   +   GA   IN  ED      I+EK++  T+G G
Sbjct: 162 SILCQLISQRKAHVIAVASSAEKLAMAKENGAEFLINYAED-----DILEKVMQYTNGKG 216

Query: 270 LDFTFDCTGNTNIMRDALEACHKG----WGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGS 325
           +   FD  G      D      KG    +G +            S +  +L+  +V+   
Sbjct: 217 VHAAFDSIGKDTFETDLAALRRKGTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVY--- 273

Query: 326 AFGGIKGRSEMG---GLIKDY-QSGALKVEEFITHRRPFKE 362
             G +  RSE      + K + QS +LKV+  I+   P  E
Sbjct: 274 --GYLGTRSEWDHYCSIFKHFVQSKSLKVD--ISGIYPLSE 310

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 108/280 (38%), Gaps = 40/280 (14%)

Query: 17  AYNAKKSLSVEEITVDPPK---AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC------ 67
           A N  K     ++T   PK   AH+V I++E   +C ++ ++L          C      
Sbjct: 13  AINDPKDWDHPKLTKFEPKKFDAHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYG 72

Query: 68  ----ILGHEGAGIVESVGDDVMTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQ 122
               ++GHE  G V +VGD V   K GD + +    + C  C  C       C+    T 
Sbjct: 73  PKSQVVGHEVVGKVVAVGDKVSLCKVGDRIGLGAQASSCMSCPRCHGNNEQYCAKSVTT- 131

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
                       + +K ED Y   G   ++ +    +     +  +   +    L CG  
Sbjct: 132 ------------YCSKYEDGYVSQG--GYASHVRAHEQFCFPVPEEIESEYVAPLMCGGL 177

Query: 183 TGYGAAIKTAN-VQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241
           T Y    ++    +E     +   G   +++M  +K+ GA  ++A   +N+KR  +   G
Sbjct: 178 TVYSPIKRSIQGSKEPRVGVIGIGGLGHMAIMI-SKALGA-HVVAFSRSNRKRADAEKMG 235

Query: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTN 281
           A  F+       E++   E+ +D      D   +C  +T+
Sbjct: 236 ADAFVA----TGEEKDWSERYMDQ----FDLILNCASSTS 267

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 144/380 (37%), Gaps = 63/380 (16%)

Query: 27  EEITVDPPK--AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDV 84
           ++I+ DP K   ++V IKIE   VC +D +  S +        ++GHE  G V  +G   
Sbjct: 22  KKISYDPKKFDDYDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKC 81

Query: 85  -MTVKPGDHV-IALYTAECGKCKFCTSGKTNLC-SAVRATQGKGVMPDGTTRFHNAKGED 141
            + +K GD V +      C  CK C S     C S  R     G   DG           
Sbjct: 82  KLGLKVGDRVGVGAQAKSCLNCKRCKSDNEPYCKSKDRVGTYSGTYSDG----------- 130

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
              ++    ++ +    +  V  I    P + A  L CG  T +   ++           
Sbjct: 131 ---YVSQGGYASHVRTHEHFVFKIPDNIPTELAAPLLCGGVTVFSPLLRN---------- 177

Query: 202 VFGCGTVGLSVMQG-----------AKSRGASKIIAVDINNKKRQYSSNFGATDFINPKE 250
             GCG      + G           AK+ GA ++ A+  ++ K++ S   GA  +I  +E
Sbjct: 178 --GCGPGKKVGVVGIGGIGHMGILFAKAMGA-EVYAISRSSSKKEDSLKLGADYYIATQE 234

Query: 251 DLAEDQTIVEKLIDMTDGGLDFTFDCTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXX 309
           +     T  +         LD    C  + ++I  D L A     G+             
Sbjct: 235 EKDWATTYADT--------LDLIVLCASSLSDINIDDLVATMTIGGKIVSIAIPDASQQL 286

Query: 310 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKE--INQAF 367
           + +PF L+ G     SA G  K   ++  L+ +      K++ ++    P  E  +N+ F
Sbjct: 287 TLKPFGLL-GVYISNSALGSRKEIIQLLDLVSEK-----KIKPWV-QTVPISEAGVNEVF 339

Query: 368 EDLHNGDCLR--TVLRFQEE 385
           E +  GD     T++ F +E
Sbjct: 340 ERMEKGDVKYRFTLVDFDKE 359

>Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W -
           Hypothetical ORF [contig 311] FULL
          Length = 379

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 98/234 (41%), Gaps = 21/234 (8%)

Query: 27  EEITVDPPK--AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDV 84
           E+ +  PP     ++ ++IE   VC +D + +SG       P  +GHE  G + ++G  V
Sbjct: 37  EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQV 96

Query: 85  MTVK--PGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
              K   GD V +   T  CG C  C+  +   C     T       D    F   +G  
Sbjct: 97  NKEKFHLGDRVGVGAQTNSCGDCTRCSRDRQQNCKKSVLTY---TCVDERNGFET-QGGY 152

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
             H    S F      A  S VA    AP      L CG  TG+   + T  V+EG  + 
Sbjct: 153 ASHIRANSGFVFKIPDALDSAVA----AP------LLCGGITGFRPLL-TGGVKEGSKLG 201

Query: 202 VFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAED 255
           V G G +G   +  AK+ GA ++ A+  +N+K   +   GA  F+   ++ + D
Sbjct: 202 VVGIGGIGHMSILFAKALGA-EVTAISRSNRKFDDAKKLGADHFLAMSDEKSRD 254

>YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}
           ADH7NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 361

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 86/366 (23%), Positives = 139/366 (37%), Gaps = 44/366 (12%)

Query: 19  NAKKSLSVEEITVDPPKA--HEVRIKIEFTAVCHTDAYTLSGSD---PEGLFPCILGHEG 73
           NAK     + ++ DP     H+V ++IE   +C +D +   G+    PE     ILGHE 
Sbjct: 14  NAKDWKHPKLVSFDPKPFGDHDVDVEIEACGICGSDFHIAVGNWGPVPENQ---ILGHEI 70

Query: 74  AGIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
            G V  VG    T VK GD V +      C +C+ C S     C+            DG 
Sbjct: 71  IGRVVKVGSKCHTGVKIGDRVGVGAQALACFECERCKSDNEQYCTNDHVLTMWTPYKDG- 129

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT 191
                        ++    F+ +  + +   + I    P   A  L CG  T +   ++ 
Sbjct: 130 -------------YISQGGFASHVRLHEHFAIQIPENIPSPLAAPLLCGGITVFSPLLRN 176

Query: 192 ANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
                G  V + G G +G   +  AK+ GA ++ A    + KR+ S   GA  +I     
Sbjct: 177 G-CGPGKRVGIVGIGGIGHMGILLAKAMGA-EVYAFSRGHSKREDSMKLGADHYIA---- 230

Query: 252 LAEDQTIVEKLIDMTDGGLDFTFDCTGN-TNIMRDALEACHKGWGQSXXXXXXXXXXXXS 310
           + ED+   E+        LD    C+ + + +  D++    K  G               
Sbjct: 231 MLEDKGWTEQY----SNALDLLVVCSSSLSKVNFDSIVKIMKIGGSIVSIAAPEVNEKLV 286

Query: 311 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKE--INQAFE 368
            +P  L+ G     SA G    R E+  L+K      +K+      + P  E  ++ AF 
Sbjct: 287 LKPLGLM-GVSISSSAIG---SRKEIEQLLKLVSEKNVKI---WVEKLPISEEGVSHAFT 339

Query: 369 DLHNGD 374
            + +GD
Sbjct: 340 RMESGD 345

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 93/226 (41%), Gaps = 28/226 (12%)

Query: 34  PKA---HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMT-VKP 89
           PKA   H+V I+IE   VC +D +T +    E     ++GHE  G +  +G +  + +K 
Sbjct: 34  PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIVKLGPECDSGLKI 93

Query: 90  GDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGC 148
           GD V +   +  C +C  C       C    +T             +N   +D Y   G 
Sbjct: 94  GDRVGVGAQSFSCLECDRCKENNEPYCPKFVST-------------YNRPYDDGYISQG- 139

Query: 149 STFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKT---ANVQEGDTVAVFGC 205
             ++ +  + +   + +  + P + A  L CG  T +   ++     N +   +V V   
Sbjct: 140 -GYASHVRLHEHFAIPVPDEIPSELAAPLMCGGITVFSPLLRNGCGPNKKLASSVLV--- 195

Query: 206 GTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
             +G+      +  GA ++ A    N KR+ S N GA  +I   E+
Sbjct: 196 -VLGIWAYCLLRQVGA-EVYAFSRTNSKREDSVNLGADHYIATMEE 239

>Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]
           {ON} YCR105W - Hypothetical ORF [contig 261] FULL
          Length = 364

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 94/225 (41%), Gaps = 21/225 (9%)

Query: 27  EEITVDPPK--AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDV 84
           E+ +  PP     ++ ++IE   VC +D + +SG       P  +GHE  G + ++G  V
Sbjct: 22  EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQV 81

Query: 85  MTVK--PGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGED 141
              K   GD V +   T  CG C  C+  +   C     T       D    F   +G  
Sbjct: 82  NKEKFHLGDRVGVGAQTNSCGGCTRCSRDRQQNCKKSVLTY---TCVDERNGFET-QGGY 137

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVA 201
             H    S F      A  S VA    AP      L CG  TG+   + T  V+EG  V 
Sbjct: 138 ASHIRANSEFVFKIPDALDSAVA----AP------LLCGGITGFRPLL-TGGVKEGSKVG 186

Query: 202 VFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFI 246
           V G G +G   +  AK+ GA ++ A+  +N+K   +   GA  F+
Sbjct: 187 VVGIGGIGHMSILFAKALGA-EVTAISRSNRKFDDAKKLGADHFL 230

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 101/263 (38%), Gaps = 67/263 (25%)

Query: 35  KAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVI 94
           K +E+ ++ ++  + H D  +         FP I G E +GIV   G  V T        
Sbjct: 71  KEYEILVQNKYVGLNHVDWKSKKYRFNIYSFPWINGRESSGIVIRRGSKVDT-------- 122

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                     KF  S +  L S                          Y  +  STF EY
Sbjct: 123 ---------QKFPISAEVFLASTS------------------------YRDLETSTFQEY 149

Query: 155 TVVADVSVVAIDP-----------KAPLDAACLLGCGVTTGYGAAIKT---------ANV 194
           TV  D  +V   P           +  L+ A  +G G+ T  G+AI +         A+ 
Sbjct: 150 TVF-DSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVDLSLRDQADH 207

Query: 195 QE-GDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLA 253
           Q+ G+ V   G  +VGL V+Q AK+    + I V   +K ++Y    GA+  I+  +   
Sbjct: 208 QKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASCIIDRHQS-- 265

Query: 254 EDQTIVEKLIDMTDGGLDFTFDC 276
            ++ I++ ++     G+DF  D 
Sbjct: 266 -EEEILDDILSHCPEGIDFGIDV 287

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 98/248 (39%), Gaps = 43/248 (17%)

Query: 19  NAKKSLSVEEITVDPPK--AHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGI 76
           +AK     +++T DP    +H+V I+IE   VC +D +  +    E     ++GHE  G 
Sbjct: 14  DAKDWTHPKKVTYDPKPFDSHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIGR 73

Query: 77  VESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRF 134
           V  VG +  T +K GD V +      C +C  C       C     T  +          
Sbjct: 74  VVKVGPECNTGLKLGDRVGVGAQVFSCLECDRCKEDNEPYCQKFVTTYNQPY-------- 125

Query: 135 HNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANV 194
             A G     ++    ++ +  V +  VV I  + P + A  L CG  T +   ++    
Sbjct: 126 --ANG-----YISQGGYASHIRVHEHFVVPIPDEIPSELAAPLMCGGITVFSPLLRN--- 175

Query: 195 QEGDTVAVFGCG-----------TVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGAT 243
                    GCG            +G   +  AK+ GA ++ A   ++ K++ S   GA 
Sbjct: 176 ---------GCGPNKKVGIVGIGGIGHMGVLFAKAMGA-EVYAFSRSDSKKEDSLKLGAD 225

Query: 244 DFINPKED 251
            +I  K+D
Sbjct: 226 HYIATKDD 233

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 88/226 (38%), Gaps = 27/226 (11%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPC----------ILGHEGAGIVESVGDDVMT 86
           H++ I++E   +C ++ ++L          C          ++GHE  G V  VG+ V  
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 87  VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHF 145
            K G  V +    + C +C  C+S     C     T      PDG    + ++G    H 
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYCLKSVGTYCSR-YPDG----YVSQGGYASHV 152

Query: 146 MGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGC 205
                F  + +  DV    + P         L CG  T Y    +     E   V + G 
Sbjct: 153 RAHEQFC-FPIPDDVPSAFVAP---------LMCGGLTVYSPIKRNIEGVEKPKVGIIGI 202

Query: 206 GTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
           G +G   +  AK+ GA ++ A   +NKK+  +   GA  F+   E+
Sbjct: 203 GGLGHMAIMIAKALGA-EVTAFSRSNKKKDDAIKMGAQYFVATGEE 247

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 11/97 (11%)

Query: 26  VEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAG-IVESVGDDV 84
           +E   V   K H+  +KI+   +CH+D   L G  P       +GHE  G +V++  D+ 
Sbjct: 100 LENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQR-YAMGHEICGELVQTYADE- 157

Query: 85  MTVKPGDHVIALYT----AECGKCKFCTSGKTNLCSA 117
               P   V  LYT    A CG C  C  G  + C+A
Sbjct: 158 ----PKYAVGELYTVVGNAPCGGCDSCKKGWESCCTA 190

>Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W
           (REAL)
          Length = 361

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 89/229 (38%), Gaps = 24/229 (10%)

Query: 29  ITVDPPKA--HEVRIKIEFTAVCHTDAYTLSGSDPEGLFP--CILGHEGAGIVESVGDDV 84
           +T DP     H+V I+IE   +C +D +  +G+   G  P   +LGHE  G V  VG   
Sbjct: 24  VTFDPKPFCDHDVDIEIEACGICGSDFHIAAGN--WGPVPKNQVLGHEIIGRVVKVGPKC 81

Query: 85  MT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDI 142
            T +K GD V +      C +C+ C S     C+            DG            
Sbjct: 82  HTGIKLGDRVGVGAQALACLECERCKSDNEQYCTIDHVLTMWTPYKDG------------ 129

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAV 202
             ++    F+ +  + +   + I    P   A  L CG  T +   ++           V
Sbjct: 130 --YIAQGGFASHVRLHEHFAIPIPENIPSPLAAPLLCGGITVFSPLLRNGCGPGKKVGIV 187

Query: 203 FGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKED 251
              G   + ++  AK+ GA ++ A    + K++ S   GA  +I   ED
Sbjct: 188 GIGGIGHMGILL-AKAMGA-EVYAFSRGHSKKEDSMRLGADHYIATLED 234

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 78/351 (22%), Positives = 125/351 (35%), Gaps = 83/351 (23%)

Query: 37  HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIAL 96
           +E+ +K +++ +   ++Y   G  P    P ILG E +G V + G+ V     GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKV--- 107

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                                                           ++  S F++YT 
Sbjct: 108 -----------------------------------------------AYLSGSAFAQYTK 120

Query: 157 VADVSVVAIDPKAPLDAAC-LLGCGVTTGYGAAI---KTANVQEGDTVAVFGC-GTVGLS 211
           V     V   PK   D    L   G+     A     +  NV++GD +  +   G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 212 VMQGAKSRGASKIIAVDINNK---KRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG 268
           + Q  K RGA  I  V    K    +++ + +G    I+ KED      IV ++ ++T+ 
Sbjct: 181 LDQLLKERGAHTIAVVSTEEKLELAKKHGAEYG---IISSKED------IVTRVKEITNN 231

Query: 269 -GLDFTFDCTGNTNIMRDALEACHKGWGQS-XXXXXXXXXXXXSTRPFQLVTG--RVWKG 324
            G+D  FD  G     +D  E       +              S  P   +TG  ++ + 
Sbjct: 232 QGVDAAFDSIG-----KDTFETTISALKRKGTFVSYGNASGPVSPFPLTKLTGNIKILRP 286

Query: 325 SAFGGIKGRSEMGGLIKDY----QSGALKVEEFITHRRPFKEINQAFEDLH 371
           S F  I    E     +++     SG LK+   I H  P  E  +A + L 
Sbjct: 287 SLFSYIATSEEWKHYSREFVSLVSSGKLKIN--IGHVFPLSEYPKATQLLE 335

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 105/291 (36%), Gaps = 71/291 (24%)

Query: 9   PIQCVAAVAYNAKKSLSVEEITVDPPKA--HEVRIKIEFTAVCHTDAYTLSGSDPEGLFP 66
           P+   AAV  + ++ + V +    P +   HE+ I+ ++T + H D  +         FP
Sbjct: 42  PLFQQAAVVKSFEEEIIVSDQIPVPQRLEDHEILIRNKYTGLNHVDWKSKKYRFNIHSFP 101

Query: 67  CILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
            I G E +GIV   G                 A+  + +F    +  L S          
Sbjct: 102 WINGRESSGIVVRRG-----------------AKVDRDRFPIGAEVFLASTC-------- 136

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACL---LGCGVTT 183
                           Y  +  STF E+TV  D  +V   P+  L         G     
Sbjct: 137 ----------------YRELKTSTFQEFTVF-DSRLVWRLPREILPDGTTRKRFGLDFAA 179

Query: 184 GYGAAIKTA--------------NVQEGDTVAVFG-CGTVGLSVMQGAKSRGASKIIAVD 228
           G G  + TA                 +G ++ V+G   +VG+  +Q A++ G  K I   
Sbjct: 180 GVGVPLVTAGSALSSFVDFNEIGKADQGRSLVVWGGSSSVGIFTIQLARNLGIFKNIIAV 239

Query: 229 INNKKRQYSSNFGATDFIN---PKEDLAEDQTIVEKLIDMTDGGLDFTFDC 276
            + +   Y    GAT  I+   P E+L      V+K  ++   G+D+  D 
Sbjct: 240 SSLRYEDYLKELGATAVIDRTLPSEEL------VQKFQELCPTGVDYGVDV 284

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 66/145 (45%), Gaps = 22/145 (15%)

Query: 152 SEYTVVADVSVVAIDPK-APLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGC-GTVG 209
           +EY VV++   VA+ PK      A  LG  +TT    A++ A V+  D V+V G  G+VG
Sbjct: 51  AEYCVVSE-DAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVG 108

Query: 210 LSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDG- 268
             V+Q A+S G   + A       RQ       TD       +AED+     L  +T G 
Sbjct: 109 SYVVQLAQSMGCRVLRAA------RQ-----SPTDVC-----IAEDEEF-SALTSLTQGR 151

Query: 269 GLDFTFDCTGNTNIMRDALEACHKG 293
           G+D   D  G   +M+ A E    G
Sbjct: 152 GVDVVIDTVGMPALMKAAAEKLAHG 176

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 36.2 bits (82), Expect = 0.036,   Method: Composition-based stats.
 Identities = 29/108 (26%), Positives = 44/108 (40%), Gaps = 5/108 (4%)

Query: 10  IQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCIL 69
           I  V    +   K +S E  +  P    +V IK+E   VC +D +  +G       P + 
Sbjct: 10  IAVVGDREWKNPKKISYEPKSFYP---EDVEIKVEACGVCGSDIHCAAGHWGPRNDPLVA 66

Query: 70  GHEGAGIVESVGDDVMTVKPGDHVIAL--YTAECGKCKFCTSGKTNLC 115
           GHE  G +  +G    +    D  + +   T  C KC  C  G+ N C
Sbjct: 67  GHEIVGRIVRMGSRCSSQLKVDMRVGMGAITFSCLKCSGCKKGEENYC 114

>Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]
           {ON} YCR105W (REAL)
          Length = 120

 Score = 35.4 bits (80), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 19  NAKKSLSVEEITVDP-PKA-HEVRIKIEFTAVCHTDAYTLSGSDPEGLFP--CILGHEGA 74
           NA+       +T DP P A H++ I+IE   +C +D +  +G+   G  P   +LGHE  
Sbjct: 13  NAEDWKHPTLVTFDPKPFADHDIDIEIEDCGICGSDFHIAAGN--WGPVPKNQVLGHEII 70

Query: 75  GIVESVGDDVMT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCS 116
           G V  VG    T +K GD V +      C +C+ C S     C+
Sbjct: 71  GRVVKVGPKCHTGIKIGDRVGVGAQALACLECERCKSDNEQYCT 114

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 33.1 bits (74), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 188 AIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFI 246
           A++   V+ GD V V     +GL V    +  G  K++ +   + K+Q S  FG T FI
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%)

Query: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHE 38
           + +AT+G  +Q +AA   N K+SL ++ + V+ P+AHE
Sbjct: 299 LFSATLGDNVQKLAAGIMNRKESLFLDTVDVNEPEAHE 336

>TBLA0C01490 Chr3 complement(343276..345864) [2589 bp, 862 aa] {ON}
           Anc_1.400 YLR176C
          Length = 862

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 37/87 (42%), Gaps = 5/87 (5%)

Query: 76  IVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFH 135
           ++++   D  +  P   + A Y + C         + +L   +RA     V PD TTR  
Sbjct: 318 LLQNCRSDSDSYVPRGRIFAQYASSCASNSLKPLSQASLGKLIRA-----VFPDLTTRRL 372

Query: 136 NAKGEDIYHFMGCSTFSEYTVVADVSV 162
             +G+  YH+ G    S+  V  + S+
Sbjct: 373 GIRGQSKYHYCGLKLLSDEPVPPEESL 399

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 222 SKIIAVDINNKKRQYSSNFGAT-DFINPKEDLAEDQTIVEKLIDMTDG-GLDFTFDCTG 278
           S +I VD+ + K Q + +FGAT  F + K  + E Q + ++L  +  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 48  VCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFC 107
           V  T  +TL G+     F         G+++  G  V+  K  D +++LY A  GK ++C
Sbjct: 773 VWKTRFFTLHGTR-LSYFSSTTDTREKGLIDITGHRVVPAKDDDKIVSLYAASTGKGRYC 831

>TBLA0B07930 Chr2 complement(1880760..1882700) [1941 bp, 646 aa]
           {ON} Anc_5.66 YHR171W
          Length = 646

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 157 VADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGA 216
           + D+SV+ IDP    + +  L   +           N+ E  +V + G GT+G  + +  
Sbjct: 295 IIDLSVM-IDPLKINEQSVKLNLKLMKWRIVPDLDLNIIENTSVLILGSGTLGCYISRAL 353

Query: 217 KSRGASKIIAVDINNKKRQYSSN-----FGATDFINPK 249
            + G SKI  VD  N K  YS+      F   D+  PK
Sbjct: 354 LAWGVSKITFVD--NGKISYSNPVRQPLFNFEDYGKPK 389

>YNL223W Chr14 (227370..228854) [1485 bp, 494 aa] {ON}
           ATG4Conserved cysteine protease required for autophagy;
           cleaves Atg8p to a form required for autophagosome and
           Cvt vesicle generation
          Length = 494

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 37/89 (41%), Gaps = 4/89 (4%)

Query: 61  PE-GLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVR 119
           PE G+  CI+      I E+  + V    P   ++ L   + G      S + ++C  + 
Sbjct: 233 PECGIDDCIVSVSSGDIYENEVEKVFAENPNSRILFLLGVKLGINAVNESYRESICGILS 292

Query: 120 ATQGKGV---MPDGTTRFHNAKGEDIYHF 145
           +TQ  G+    P  +  F   +G +  HF
Sbjct: 293 STQSVGIAGGRPSSSLYFFGYQGNEFLHF 321

>KNAG0I01300 Chr9 (248944..251364) [2421 bp, 806 aa] {ON} Anc_1.400
           YLR176C
          Length = 806

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 5/74 (6%)

Query: 89  PGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGC 148
           P   + A Y + C + +     + +L   +R      V PD TTR    +G+  YH+ G 
Sbjct: 333 PRGRIFAQYASSCSQNELKPLSQASLGKLIRT-----VFPDLTTRRLGTRGQSKYHYCGL 387

Query: 149 STFSEYTVVADVSV 162
              ++    AD SV
Sbjct: 388 KLITDEGEDADDSV 401

>Suva_7.343 Chr7 complement(587041..591117) [4077 bp, 1358 aa] {ON}
           YGR061C (REAL)
          Length = 1358

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 44/102 (43%), Gaps = 14/102 (13%)

Query: 198 DTVAVFGCGTVGLSVMQGAKSRGASKIIAV--DINNKKRQYSSNFGATDFINPKEDL-AE 254
           D+V V     V LSV Q AKS GAS ++ V   + NK      N     F+     L  E
Sbjct: 865 DSVLVL----VDLSVKQEAKSLGASALLQVYNQVGNKSPTVHDNVILKGFLESLIQLHQE 920

Query: 255 DQTIVEKLIDMTDGGL-------DFTFDCTGNTNIMRDALEA 289
           ++ IV    D +DGGL        F   C    NI  D LE+
Sbjct: 921 NEDIVLAYHDRSDGGLLVTLLEMAFASRCGLEINIDGDNLES 962

>SAKL0A10560g Chr1 (928213..929442) [1230 bp, 409 aa] {ON} similar
           to gnl|GLV|KLLA0F00638g Kluyveromyces lactis
           KLLA0F00638g and weakly similar to uniprot|P53912
           Saccharomyces cerevisiae YNL134C
          Length = 409

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 66/163 (40%), Gaps = 36/163 (22%)

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPK------AP-----LDAACLLGCGVTTGYGAAIKT 191
           Y  +  STF EYTVV D  +    P+      AP     LD A  +G G+ T  G A+  
Sbjct: 138 YRDLRTSTFQEYTVV-DSRLAWRVPRTKAGSSAPGRQFGLDFAAGIGVGLVTA-GCALSN 195

Query: 192 ANVQE------------------GDTVAVFGCGTVGLSVMQGAKSRGA-SKIIAVDINNK 232
               E                  G  V   G  +VG+ V+Q A++ G   KI+A+  + K
Sbjct: 196 LVAFEPEDHGSGCGSSGGGAEKLGSLVIWGGSSSVGIFVIQLARASGKFDKIVAIS-SKK 254

Query: 233 KRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFD 275
              Y    G T  I+    L  +  IVE++ +    G+ +  D
Sbjct: 255 NASYLKELGTTHVID---RLQPEDRIVEQVSESCPEGVRYGID 294

>ZYRO0E04642g Chr5 complement(349593..352016) [2424 bp, 807 aa] {ON}
           some similarities with uniprot|P48743 Saccharomyces
           cerevisiae YLR176C
          Length = 807

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 5/60 (8%)

Query: 89  PGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGC 148
           P   + A Y A C +       + +L   +RA     V PD TTR    +G+  YH+ G 
Sbjct: 302 PRGRIFAQYAASCAQNGLKPLSQASLGKLIRA-----VFPDLTTRRLGMRGQSRYHYCGL 356

>Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa]
           {ON} complement(282640..286023) [3384 nt, 1128 aa]
          Length = 1127

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 75  GIVESVGDDVMTVKPGDHVIALYTAECGKCKFC 107
           G+++  G  V+  K  D +I+LY A  GK ++C
Sbjct: 894 GLIDITGHRVVPAKEDDKLISLYAASTGKGRYC 926

>Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar to
           Ashbya gossypii AGL024W
          Length = 784

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 68  ILGHEG-AGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           ++GHEG    ++ VG++++     D  + ++  + GKC     G T+    +   + +GV
Sbjct: 431 LVGHEGGVWALKYVGNEILVSGSTDRTVRIWNVKAGKCTHVFKGHTSTVRCLDVVEYEGV 490

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,117,771
Number of extensions: 1534586
Number of successful extensions: 3807
Number of sequences better than 10.0: 208
Number of HSP's gapped: 3648
Number of HSP's successfully gapped: 218
Length of query: 385
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 274
Effective length of database: 40,753,473
Effective search space: 11166451602
Effective search space used: 11166451602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)