Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.7831.52ON1135113550170.0
Suva_2.6871.52ON112854825010.0
Smik_4.7891.52ON113654824870.0
YDR507C (GIN4)1.52ON114254824750.0
KAFR0D041001.52ON111754920130.0
TDEL0C064901.52ON115356619050.0
KNAG0F002901.52ON112556518900.0
CAGL0K05709g1.52ON110355618860.0
Kpol_2002.461.52ON112356318640.0
NCAS0B086001.52ON111757518610.0
ZYRO0F17402g1.52ON118956218480.0
KLLA0C01650g1.52ON111255818310.0
NDAI0A006601.52ON102255818100.0
KLTH0F01672g1.52ON116456617850.0
TPHA0E036401.52ON113757517550.0
SAKL0C01716g1.52ON121557917430.0
AFR696C1.52ON114255817250.0
Ecym_10581.52ON116455917210.0
TBLA0A071501.52ON139150217290.0
Skud_3.391.52ON101754615690.0
Smik_3.541.52ON103255915350.0
Suva_3.1901.52ON102436014331e-180
KLTH0D05566g2.479ON112835510321e-121
SAKL0E02860g2.479ON137735510381e-120
Ecym_73922.479ON143435510331e-119
ABL034W2.479ON142535810271e-118
KLLA0F13552g2.479ON126738710171e-118
Kwal_26.77882.479ON126736310161e-117
NCAS0A057702.479ON14613839991e-114
YKL101W (HSL1)2.479ON15183899991e-114
TDEL0A025502.479ON13693929931e-114
Smik_11.1392.479ON15343899971e-113
KNAG0A065402.479ON14323779931e-113
TBLA0I011502.479ON174538110001e-113
Suva_11.1232.479ON15263909861e-112
Skud_11.1262.479ON15183899831e-112
KAFR0D032002.479ON14483809751e-111
Kpol_431.92.479ON15524029771e-111
CAGL0K08514g2.479ON14894079731e-110
ZYRO0G03366g2.479ON16163989711e-110
Kwal_33.132251.52ON9643638951e-103
TPHA0G032002.479ON15344269051e-101
NDAI0D027502.479ON15152988347e-92
Kwal_33.13222singletonOFF1481206134e-73
TPHA0C004705.611ON6312946503e-72
CAGL0M08910g5.611ON6122816413e-71
Kpol_495.145.611ON6242776415e-71
NCAS0A080805.611ON6232706362e-70
KLLA0A03806g5.611ON6022706333e-70
Suva_2.6515.611ON6332706345e-70
YDR477W (SNF1)5.611ON6332706338e-70
Smik_4.7545.611ON6322706311e-69
TBLA0E033605.611ON6542776331e-69
Kpol_1018.655.611ON6012706272e-69
Skud_4.7515.611ON6342706292e-69
Kwal_47.182335.611ON5982746263e-69
KAFR0C058605.611ON6442706284e-69
AEL230W5.611ON6082706255e-69
NDAI0H009405.611ON6852706289e-69
TPHA0D028405.611ON6342696241e-68
KNAG0B032305.611ON6412836232e-68
KLTH0G05698g5.611ON5972746192e-68
SAKL0G06952g5.611ON5992706175e-68
Ecym_55885.611ON6132706167e-68
TDEL0A047805.611ON6212706178e-68
ZYRO0A05544g5.611ON6312986133e-67
CAGL0M02519g8.654ON7563035213e-54
Kwal_26.87098.654ON8293005207e-54
KNAG0J015908.654ON8053195135e-53
TPHA0G017108.654ON8052885126e-53
TDEL0A060008.654ON7902995101e-52
SAKL0H07084g8.654ON9192995141e-52
KLTH0D10714g8.654ON8723005121e-52
ZYRO0F06842g8.654ON8433035102e-52
NCAS0C015908.654ON8642985102e-52
NDAI0E023208.654ON9322955094e-52
NDAI0J012508.279ON11763835044e-51
Suva_16.1698.654ON8582984986e-51
Kpol_1072.298.654ON8932874989e-51
NDAI0E012908.654ON7292954929e-51
CAGL0M11396g8.279ON11922895001e-50
Kpol_1012.68.654ON6282964852e-50
Smik_4.3678.279ON10662874982e-50
Smik_6.3398.654ON8652984933e-50
YPL141C (FRK1)8.654ON8652914906e-50
Skud_4.3838.279ON10652874946e-50
KAFR0H025408.654ON8173354887e-50
KAFR0A037308.654ON7882974878e-50
Smik_15.4178.654ON8062944871e-49
Suva_2.2838.279ON10892874912e-49
CAGL0J03872g8.654ON6612874792e-49
Skud_16.1408.654ON8653014862e-49
NCAS0B014708.654ON7272904822e-49
TPHA0J008208.279ON12182894912e-49
CAGL0M02299g8.668ON8932824862e-49
YDR122W (KIN1)8.279ON10642874892e-49
TPHA0D011408.654ON6222874735e-49
NCAS0B037408.279ON10492904856e-49
Ecym_83398.654ON9202904829e-49
TBLA0B039708.654ON12082944841e-48
Skud_15.3998.654ON8073444781e-48
NDAI0B020708.279ON12583484832e-48
NCAS0B050908.279ON12102944822e-48
ACR119W8.654ON9312974792e-48
SAKL0H16632g8.279ON10622894794e-48
TDEL0F040608.279ON11262964804e-48
Suva_8.2848.654ON8082944735e-48
TBLA0C046008.279ON13152844787e-48
Kpol_1066.468.279ON12252844788e-48
SAKL0H06754g8.668ON8842794738e-48
YOR233W (KIN4)8.654ON8002944691e-47
AGR058W8.279ON10712934742e-47
Smik_12.1558.279ON11622894733e-47
KNAG0G021108.279ON11922884733e-47
Skud_12.1648.279ON11602924723e-47
Ecym_42918.279ON11452994723e-47
KAFR0B028008.279ON10953014705e-47
YLR096W (KIN2)8.279ON11472894705e-47
KNAG0A030408.654ON6442934588e-47
TBLA0C017508.654ON9812974661e-46
CAGL0B01925g8.279ON9442924642e-46
Suva_10.1808.279ON11592974662e-46
KLLA0F19536g8.279ON11042894643e-46
KLTH0G13288g8.279ON11423414625e-46
KNAG0H031408.279ON9362874589e-46
NCAS0C016708.668ON8962794561e-45
ZYRO0F07194g8.668ON9383514552e-45
KLLA0D07348g8.654ON9092944533e-45
ZYRO0D06776g8.279ON12042844538e-45
NDAI0E023908.668ON8833014462e-44
SAKL0D07656g1.374ON4322724262e-44
KNAG0D010906.222ON3722944204e-44
KNAG0I014801.374ON4402964221e-43
ACR133C8.668ON8512824391e-43
TPHA0G016308.668ON8712794363e-43
KLLA0F23155g1.374ON4272704165e-43
KNAG0J016708.668ON10093454366e-43
KLLA0F11319g8.668ON8432924337e-43
TDEL0A061408.668ON8613504302e-42
Ecym_24058.668ON8552824282e-42
NDAI0G053001.374ON4372754113e-42
TBLA0B038608.668ON9882824294e-42
KLTH0D11044g8.668ON8493454265e-42
TPHA0O011201.374ON4293094085e-42
Kpol_1072.198.668ON8962814257e-42
Smik_6.3508.676ON8222904247e-42
TBLA0B038408.676ON8583074231e-41
Kwal_26.87518.668ON8482774221e-41
Skud_16.1298.676ON8272914202e-41
CAGL0M02233g8.676ON7672984183e-41
YPL153C (RAD53)8.676ON8213074193e-41
NDAI0E021108.676ON9032894195e-41
Suva_16.1578.676ON8322964175e-41
Suva_16.1608.668ON9182944186e-41
KLTH0D11242g8.676ON7952814157e-41
SAKL0H06534g8.676ON8042824158e-41
YFR014C (CMK1)1.374ON4462793991e-40
KNAG0J017008.676ON8202854141e-40
Suva_6.781.374ON4452793981e-40
Kpol_1065.36.222ON3762793931e-40
Kwal_26.87968.676ON7962804131e-40
Smik_7.3191.374ON4462793982e-40
KAFR0H024308.676ON7842834122e-40
KLTH0H11396g1.374ON4372773972e-40
KLLA0F11143g8.676ON8132794132e-40
TDEL0A062208.676ON7942834122e-40
NCAS0A088801.374ON4222753943e-40
Skud_6.891.374ON4462793937e-40
NCAS0B044906.222ON3492573868e-40
Kpol_1072.168.676ON7952834078e-40
Smik_6.3478.668ON9172824098e-40
Skud_16.1328.668ON9242834089e-40
NCAS0D006301.374ON4272793901e-39
YPL150W8.668ON9012834081e-39
CAGL0F04741g1.374ON4422963911e-39
Kwal_0.961.374ON4272713901e-39
NCAS0D021006.31ON7262694032e-39
KAFR0C044801.374ON4352853892e-39
AAR009W1.374ON4532703902e-39
NCAS0C013708.676ON7992814032e-39
TPHA0E028206.222ON3842633843e-39
Kpol_1069.131.374ON4272793864e-39
CAGL0K10604g1.374ON4462903865e-39
TPHA0G016008.676ON8452834015e-39
Skud_16.706.222ON3672573798e-39
CAGL0L07326g2.352ON5063143889e-39
TBLA0B004906.31ON7873193989e-39
TBLA0A020506.222ON4342743831e-38
Smik_6.4146.222ON3672893771e-38
NDAI0H035201.374ON4582733832e-38
Ecym_23978.676ON8722813962e-38
ACR142W8.676ON8373363943e-38
Kwal_56.224766.31ON6972303913e-38
Kwal_56.240596.214ON3532723734e-38
KLTH0C10912g6.31ON6972503914e-38
YPL209C (IPL1)6.222ON3672573736e-38
TBLA0D050101.374ON4342783776e-38
ZYRO0E07018g6.222ON3672603736e-38
Skud_15.1441.374ON4492753786e-38
KLLA0B02332g6.222ON3612953726e-38
Ecym_12751.374ON4512713787e-38
ZYRO0F07370g8.676ON7622813907e-38
Ecym_30356.31ON7402103898e-38
ACL006W6.31ON7082103888e-38
CAGL0G09020g6.214ON3612723701e-37
NDAI0F016006.222ON4122593741e-37
Skud_13.1546.31ON7052723861e-37
Kwal_56.240916.222ON3812893711e-37
Suva_15.1551.374ON4522773751e-37
Kpol_1004.192.352ON4943033782e-37
YMR001C (CDC5)6.31ON7052723862e-37
YPL203W (TPK2)6.214ON3802813702e-37
KAFR0G026906.31ON7132693852e-37
Suva_13.1636.31ON7052723852e-37
Kwal_56.237178.279ON8582303882e-37
TBLA0A020306.214ON4032773712e-37
Smik_6.4086.214ON3812813693e-37
KLTH0H04180g6.214ON3532723673e-37
YOL016C (CMK2)1.374ON4472753733e-37
Skud_16.766.214ON3822813693e-37
Smik_15.1531.374ON4422753733e-37
KNAG0D011406.214ON3952813703e-37
KAFR0K003306.214ON3732813674e-37
Smik_13.1596.31ON7052723825e-37
KLLA0E01585g2.352ON5122943755e-37
Kpol_1037.206.31ON7042373825e-37
SAKL0C05368g1.182ON4182723695e-37
CAGL0I09504g1.336ON5283143747e-37
TDEL0B063201.374ON4442873707e-37
CAGL0E05720g6.222ON3582743647e-37
KAFR0K002806.222ON3602813648e-37
KAFR0I020101.374ON4322813689e-37
CAGL0J11638g6.31ON7462113819e-37
NCAS0A011006.214ON3542813631e-36
KLTH0H03982g6.222ON3982953651e-36
KAFR0K024502.352ON5112993712e-36
Suva_16.1046.214ON3832813632e-36
Kpol_1033.506.214ON3842813632e-36
TPHA0J004206.31ON7072963772e-36
SAKL0E01584g6.31ON6952093762e-36
ZYRO0E05588g1.374ON4712793672e-36
AFL101C6.222ON3672913603e-36
KAFR0H025108.668ON8793643793e-36
NDAI0A009601.182ON4082613624e-36
NDAI0C026806.31ON7502083764e-36
SAKL0E05984g2.352ON5052943675e-36
TPHA0F024306.31ON7982793756e-36
KNAG0E008506.31ON7112093746e-36
TDEL0E053106.222ON3742643586e-36
Skud_10.501.182ON3972743596e-36
NOTE: 1 genes in the same pillar as Skud_4.783 were not hit in these BLAST results
LIST: YCL024W

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.783
         (1135 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...  1937   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   967   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   962   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   957   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   780   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   738   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   732   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   731   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   722   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   721   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   716   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   709   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    701   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   692   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   680   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   676   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   669   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   667   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   670   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   608   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   595   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   556   e-180
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   402   e-121
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   404   e-120
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   402   e-119
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   400   e-118
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   396   e-118
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   395   e-117
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   389   e-114
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   389   e-114
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   387   e-114
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   388   e-113
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   387   e-113
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   389   e-113
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   384   e-112
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   383   e-112
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   380   e-111
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   380   e-111
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   379   e-110
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   378   e-110
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   349   e-103
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   353   e-101
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   325   7e-92
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   240   4e-73
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   254   3e-72
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   251   3e-71
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   251   5e-71
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   249   2e-70
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   248   3e-70
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   248   5e-70
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   248   8e-70
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   247   1e-69
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   248   1e-69
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   246   2e-69
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   246   2e-69
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   245   3e-69
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   246   4e-69
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   245   5e-69
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   246   9e-69
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              244   1e-68
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   244   2e-68
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   243   2e-68
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   242   5e-68
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   241   7e-68
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   242   8e-68
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   240   3e-67
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   205   3e-54
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   204   7e-54
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   202   5e-53
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   201   6e-53
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   201   1e-52
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   202   1e-52
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   201   1e-52
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   201   2e-52
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    201   2e-52
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              200   4e-52
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   198   4e-51
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   196   6e-51
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   196   9e-51
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   194   9e-51
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   197   1e-50
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   191   2e-50
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   196   2e-50
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   194   3e-50
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   193   6e-50
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   194   6e-50
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   192   7e-50
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   192   8e-50
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   192   1e-49
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   193   2e-49
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   189   2e-49
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   191   2e-49
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    190   2e-49
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   193   2e-49
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   191   2e-49
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   192   2e-49
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   186   5e-49
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   191   6e-49
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   190   9e-49
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   191   1e-48
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   188   1e-48
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             190   2e-48
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             190   2e-48
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   189   2e-48
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   189   4e-48
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   189   4e-48
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   186   5e-48
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   188   7e-48
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   188   8e-48
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   186   8e-48
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   185   1e-47
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   187   2e-47
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   186   3e-47
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   186   3e-47
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   186   3e-47
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   186   3e-47
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   185   5e-47
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   185   5e-47
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   181   8e-47
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   184   1e-46
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   183   2e-46
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   184   2e-46
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   183   3e-46
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   182   5e-46
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   181   9e-46
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   180   1e-45
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   179   2e-45
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   179   3e-45
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   179   8e-45
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   176   2e-44
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   168   2e-44
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   166   4e-44
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   167   1e-43
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   173   1e-43
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   172   3e-43
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   164   5e-43
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   172   6e-43
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   171   7e-43
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   170   2e-42
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   169   2e-42
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   162   3e-42
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   169   4e-42
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   168   5e-42
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   161   5e-42
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   168   7e-42
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   167   7e-42
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   167   1e-41
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   167   1e-41
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   166   2e-41
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   165   3e-41
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   166   3e-41
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   166   5e-41
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   165   5e-41
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   165   6e-41
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   164   7e-41
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   164   8e-41
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   158   1e-40
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             164   1e-40
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   157   1e-40
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   155   1e-40
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   163   1e-40
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   157   2e-40
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   163   2e-40
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   157   2e-40
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   163   2e-40
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   163   2e-40
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   156   3e-40
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   155   7e-40
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    153   8e-40
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   161   8e-40
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   162   8e-40
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   161   9e-40
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   154   1e-39
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   161   1e-39
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   155   1e-39
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   154   1e-39
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     159   2e-39
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   154   2e-39
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   154   2e-39
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   159   2e-39
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   152   3e-39
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   153   4e-39
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   153   5e-39
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   159   5e-39
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   150   8e-39
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   154   9e-39
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   157   9e-39
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              152   1e-38
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   149   1e-38
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              152   2e-38
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   157   2e-38
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   156   3e-38
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   155   3e-38
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   148   4e-38
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   155   4e-38
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   148   6e-38
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   149   6e-38
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   148   6e-38
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   150   6e-38
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   147   6e-38
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   150   7e-38
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   154   7e-38
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   154   8e-38
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   154   8e-38
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   147   1e-37
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   148   1e-37
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   153   1e-37
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   147   1e-37
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   149   1e-37
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   150   2e-37
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   153   2e-37
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   147   2e-37
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   152   2e-37
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   152   2e-37
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   154   2e-37
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   147   2e-37
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   146   3e-37
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   145   3e-37
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   148   3e-37
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   146   3e-37
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   148   3e-37
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              147   3e-37
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   145   4e-37
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   151   5e-37
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   149   5e-37
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   151   5e-37
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   146   5e-37
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   148   7e-37
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   147   7e-37
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   144   7e-37
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   144   8e-37
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   146   9e-37
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   151   9e-37
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              144   1e-36
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   145   1e-36
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   147   2e-36
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   144   2e-36
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   144   2e-36
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   149   2e-36
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   149   2e-36
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   145   2e-36
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   143   3e-36
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   150   3e-36
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   144   4e-36
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   149   4e-36
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   145   5e-36
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   149   6e-36
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   148   6e-36
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   142   6e-36
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   142   6e-36
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   145   7e-36
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   145   7e-36
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   142   7e-36
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    142   7e-36
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   143   1e-35
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   147   1e-35
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   142   1e-35
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   140   2e-35
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   146   2e-35
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   141   2e-35
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   144   2e-35
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   142   2e-35
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   146   3e-35
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   141   3e-35
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   144   3e-35
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   143   3e-35
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   146   3e-35
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   139   4e-35
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   142   5e-35
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   139   5e-35
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   140   5e-35
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   141   6e-35
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   140   6e-35
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   138   6e-35
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   139   8e-35
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   138   9e-35
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   140   1e-34
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   138   1e-34
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   138   1e-34
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   139   1e-34
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   140   1e-34
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   141   1e-34
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   138   2e-34
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   137   2e-34
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   138   2e-34
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   140   2e-34
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   140   2e-34
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   138   3e-34
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   140   3e-34
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   144   3e-34
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   137   6e-34
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      137   7e-34
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   139   7e-34
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   137   8e-34
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   139   1e-33
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   136   1e-33
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   136   2e-33
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   139   2e-33
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   138   2e-33
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   141   2e-33
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   135   2e-33
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   141   2e-33
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   135   2e-33
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   135   3e-33
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   141   3e-33
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   135   3e-33
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   136   3e-33
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   137   5e-33
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   138   7e-33
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   140   7e-33
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   136   8e-33
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   139   9e-33
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   138   1e-32
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   137   1e-32
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   135   2e-32
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   132   2e-32
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   139   2e-32
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   139   2e-32
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   137   2e-32
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   134   2e-32
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   137   3e-32
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   134   3e-32
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   138   3e-32
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   134   4e-32
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   134   4e-32
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   136   4e-32
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   137   4e-32
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   137   4e-32
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   137   5e-32
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   137   6e-32
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   135   6e-32
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   136   6e-32
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   135   6e-32
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   135   7e-32
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   135   7e-32
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   135   8e-32
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   133   8e-32
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   136   8e-32
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   135   9e-32
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   137   9e-32
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   136   1e-31
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   130   1e-31
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   135   1e-31
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   135   1e-31
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   133   2e-31
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   135   2e-31
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   134   2e-31
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   135   2e-31
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   133   2e-31
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   134   2e-31
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   135   2e-31
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   134   2e-31
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   134   2e-31
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   133   3e-31
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   134   3e-31
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   132   3e-31
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   134   3e-31
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   133   3e-31
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   134   3e-31
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   133   4e-31
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    133   4e-31
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   132   4e-31
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   132   5e-31
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   134   5e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   129   5e-31
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   134   5e-31
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   134   6e-31
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             132   6e-31
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   133   7e-31
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              131   7e-31
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   130   7e-31
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   132   8e-31
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   132   8e-31
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   132   8e-31
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   127   8e-31
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   130   9e-31
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   133   9e-31
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   133   9e-31
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    132   1e-30
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   133   1e-30
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   132   1e-30
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   133   1e-30
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   131   2e-30
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   131   2e-30
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   131   2e-30
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   132   2e-30
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   128   2e-30
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   132   2e-30
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   132   2e-30
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   129   2e-30
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   131   2e-30
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   132   3e-30
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   129   3e-30
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   130   3e-30
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   132   3e-30
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   130   3e-30
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             130   3e-30
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   130   3e-30
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   131   4e-30
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   131   4e-30
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   130   4e-30
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   129   4e-30
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   130   4e-30
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   125   4e-30
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   130   4e-30
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   128   4e-30
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   129   4e-30
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   130   4e-30
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   130   5e-30
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   129   5e-30
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   130   7e-30
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   130   7e-30
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   129   7e-30
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   127   8e-30
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   129   8e-30
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   129   8e-30
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   130   8e-30
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   129   9e-30
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   128   9e-30
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   129   9e-30
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   130   9e-30
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   130   9e-30
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   128   9e-30
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   129   1e-29
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   126   1e-29
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   129   1e-29
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   129   1e-29
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   129   1e-29
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   126   1e-29
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   128   1e-29
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   129   1e-29
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   130   1e-29
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   129   1e-29
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   127   1e-29
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   130   1e-29
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   126   1e-29
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   127   1e-29
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   128   1e-29
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   128   2e-29
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   127   2e-29
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   126   2e-29
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   127   2e-29
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   129   2e-29
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   129   2e-29
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   129   2e-29
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   128   2e-29
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   127   2e-29
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     129   2e-29
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   128   2e-29
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   128   2e-29
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   124   2e-29
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   128   2e-29
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   124   2e-29
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   126   3e-29
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   128   3e-29
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   128   3e-29
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   126   3e-29
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   128   3e-29
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   128   3e-29
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   127   3e-29
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   128   3e-29
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   128   3e-29
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   128   4e-29
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   127   4e-29
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   125   4e-29
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   127   4e-29
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   126   4e-29
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   128   4e-29
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   127   4e-29
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   128   4e-29
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   128   5e-29
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              127   5e-29
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   127   5e-29
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   126   5e-29
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   127   5e-29
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   127   5e-29
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   127   6e-29
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   126   6e-29
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   124   7e-29
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   127   8e-29
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   127   8e-29
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   125   8e-29
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   123   9e-29
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   126   9e-29
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   124   1e-28
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   127   1e-28
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   123   1e-28
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   124   1e-28
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   126   1e-28
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   126   1e-28
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   125   1e-28
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   126   1e-28
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   125   1e-28
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   125   1e-28
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   125   1e-28
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   125   1e-28
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   125   2e-28
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   124   2e-28
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   123   2e-28
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   125   2e-28
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   125   2e-28
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   124   2e-28
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   125   2e-28
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   123   2e-28
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   125   2e-28
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   125   2e-28
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   125   2e-28
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   125   2e-28
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   125   3e-28
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   125   3e-28
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   122   3e-28
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   125   3e-28
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   125   3e-28
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   124   3e-28
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   124   3e-28
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   124   3e-28
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   125   3e-28
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   125   3e-28
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    124   3e-28
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   123   3e-28
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   122   4e-28
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   124   4e-28
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   122   4e-28
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   125   4e-28
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   124   5e-28
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   124   5e-28
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   124   5e-28
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   124   5e-28
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   124   5e-28
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   123   5e-28
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   124   5e-28
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   123   6e-28
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   124   6e-28
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   121   6e-28
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   124   6e-28
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   124   6e-28
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   121   6e-28
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   123   6e-28
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   124   7e-28
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   123   7e-28
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   124   7e-28
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   117   8e-28
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   124   8e-28
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   122   8e-28
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   124   9e-28
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   124   9e-28
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   123   9e-28
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   121   1e-27
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   122   1e-27
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   124   1e-27
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   122   1e-27
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   120   1e-27
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   122   1e-27
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   121   1e-27
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   123   1e-27
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   123   1e-27
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   120   1e-27
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   122   1e-27
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   123   1e-27
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   115   2e-27
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    122   2e-27
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   122   2e-27
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   122   2e-27
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   120   2e-27
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   122   2e-27
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   122   2e-27
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   121   2e-27
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   122   2e-27
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   115   2e-27
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   121   2e-27
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   119   2e-27
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   122   2e-27
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   119   2e-27
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   119   3e-27
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   119   3e-27
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   122   3e-27
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   122   3e-27
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   121   3e-27
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   122   3e-27
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   121   4e-27
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   122   4e-27
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    116   4e-27
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   119   4e-27
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   118   4e-27
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             121   4e-27
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   120   4e-27
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   121   4e-27
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   120   4e-27
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   114   5e-27
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   120   5e-27
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   118   5e-27
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   118   5e-27
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   120   6e-27
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   114   6e-27
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   120   6e-27
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   119   6e-27
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   121   7e-27
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   120   7e-27
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   120   7e-27
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   119   7e-27
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   120   8e-27
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   119   8e-27
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   120   9e-27
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   120   9e-27
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   120   1e-26
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   119   1e-26
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    120   1e-26
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   118   1e-26
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   120   1e-26
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   120   1e-26
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   120   1e-26
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   113   1e-26
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   118   1e-26
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   117   1e-26
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   119   1e-26
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   115   1e-26
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   120   1e-26
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   119   1e-26
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   120   1e-26
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   115   1e-26
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   119   2e-26
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...   112   2e-26
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   119   2e-26
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   116   2e-26
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   117   2e-26
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   119   2e-26
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   117   2e-26
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...   112   2e-26
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   119   2e-26
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   115   2e-26
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   119   2e-26
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   116   2e-26
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   119   2e-26
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   116   2e-26
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                115   3e-26
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   119   3e-26
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   118   3e-26
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   118   3e-26
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   112   3e-26
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   118   3e-26
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   114   4e-26
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   118   4e-26
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   111   4e-26
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   117   4e-26
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   117   4e-26
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   118   4e-26
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   116   4e-26
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   117   5e-26
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   115   5e-26
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   115   5e-26
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   118   5e-26
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   114   5e-26
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   118   5e-26
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   115   5e-26
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   118   5e-26
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   117   5e-26
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   117   6e-26
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   117   6e-26
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   117   6e-26
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   114   6e-26
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   111   6e-26
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   117   8e-26
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   113   1e-25
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   115   1e-25
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   115   1e-25
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   111   1e-25
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   114   1e-25
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   116   1e-25
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   114   1e-25
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   114   1e-25
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   113   1e-25
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   115   1e-25
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   114   1e-25
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   112   2e-25
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   112   2e-25
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   114   2e-25
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   115   2e-25
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   115   2e-25
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   115   2e-25
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              114   2e-25
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   109   2e-25
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   114   2e-25
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   109   2e-25
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   113   3e-25
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   113   3e-25
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   115   3e-25
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   114   3e-25
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   114   3e-25
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   113   3e-25
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   115   3e-25
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   115   4e-25
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   112   4e-25
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   111   4e-25
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   115   4e-25
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   113   4e-25
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   115   4e-25
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   114   4e-25
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   115   4e-25
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   115   4e-25
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   114   5e-25
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   112   5e-25
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   114   5e-25
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   114   5e-25
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   114   5e-25
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   112   5e-25
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   114   5e-25
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   108   5e-25
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   108   5e-25
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   112   6e-25
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   110   6e-25
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   108   6e-25
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   112   6e-25
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   108   6e-25
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   110   7e-25
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   114   7e-25
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   109   7e-25
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   112   7e-25
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   111   7e-25
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   111   7e-25
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   113   8e-25
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   114   8e-25
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...   107   8e-25
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   113   9e-25
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   110   9e-25
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   114   1e-24
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   112   1e-24
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   113   1e-24
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   107   1e-24
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   113   1e-24
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   113   1e-24
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   110   1e-24
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...   108   1e-24
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   111   1e-24
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   113   1e-24
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   110   1e-24
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   111   1e-24
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   113   1e-24
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   112   2e-24
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   112   2e-24
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   110   2e-24
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   112   2e-24
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   112   2e-24
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   109   2e-24
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   112   2e-24
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   112   2e-24
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   109   2e-24
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   110   3e-24
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   112   3e-24
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   110   3e-24
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   112   3e-24
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              111   3e-24
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   112   3e-24
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   111   3e-24
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   108   4e-24
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   112   4e-24
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   108   4e-24
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   110   4e-24
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   111   4e-24
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   109   4e-24
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   110   4e-24
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   105   4e-24
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...   106   4e-24
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   111   4e-24
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   109   4e-24
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   110   5e-24
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   109   5e-24
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   105   5e-24
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   110   5e-24
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   110   5e-24
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   109   5e-24
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   111   5e-24
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   109   5e-24
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...   105   5e-24
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   108   5e-24
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   105   7e-24
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   110   7e-24
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   108   7e-24
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   110   7e-24
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   110   7e-24
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   108   7e-24
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   109   8e-24
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   108   8e-24
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   110   8e-24
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   105   9e-24
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   110   9e-24
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   110   1e-23
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    105   1e-23
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   108   1e-23
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      110   1e-23
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   108   1e-23
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   110   1e-23
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...   103   1e-23
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   105   1e-23
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...   104   1e-23
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   110   1e-23
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   110   1e-23
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   110   1e-23
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   110   1e-23
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   107   1e-23
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   109   2e-23
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   109   2e-23
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...   107   2e-23
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   107   2e-23
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   109   2e-23
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   109   2e-23
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   108   2e-23
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   105   3e-23
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   108   3e-23
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   107   3e-23
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   108   3e-23
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   108   3e-23
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   107   3e-23
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   107   3e-23
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   108   3e-23
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   108   3e-23
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   108   3e-23
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   106   3e-23
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   108   4e-23
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   106   4e-23
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   105   4e-23
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   107   4e-23
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   106   4e-23
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   108   4e-23
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   108   4e-23
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   108   4e-23
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   106   4e-23
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...   102   4e-23
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   106   5e-23
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   107   5e-23
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   108   5e-23
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   107   5e-23
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   102   5e-23
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   106   6e-23
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   103   6e-23
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   107   6e-23
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   103   6e-23
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   107   7e-23
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   107   7e-23
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   104   7e-23
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...   102   7e-23
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   107   8e-23
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...   100   8e-23
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   107   8e-23
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   107   9e-23
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            106   1e-22
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   107   1e-22
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   105   1e-22
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   104   1e-22
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   107   1e-22
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   107   1e-22
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   104   1e-22
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   105   1e-22
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   107   1e-22
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   105   1e-22
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...   104   1e-22
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   106   1e-22
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   106   1e-22
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   106   2e-22
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...   103   2e-22
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   106   2e-22
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   104   2e-22
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   106   2e-22
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   104   2e-22
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   104   2e-22
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   106   2e-22
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   104   2e-22
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   102   2e-22
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   105   2e-22
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   105   2e-22
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   104   2e-22
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   105   2e-22
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   104   2e-22
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   104   2e-22
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...   102   2e-22
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   102   2e-22
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   106   2e-22
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   104   2e-22
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   106   2e-22
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...   101   2e-22
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   105   3e-22
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   105   3e-22
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   105   3e-22
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   105   3e-22
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...   101   3e-22
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   105   3e-22
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   105   3e-22
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   103   3e-22
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   105   3e-22
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   105   4e-22
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   105   4e-22
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   103   4e-22
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   105   4e-22
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   104   4e-22
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...   105   4e-22
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...   105   4e-22
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   103   4e-22
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   103   4e-22
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   105   4e-22
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   101   4e-22
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   104   4e-22
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...   100   5e-22
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   104   5e-22
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...   100   5e-22
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...   102   6e-22
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              99   6e-22
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   103   6e-22
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   102   6e-22
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              103   7e-22
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    99   7e-22
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   104   7e-22
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   100   7e-22
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...   100   8e-22
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    99   9e-22
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   102   9e-22
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   103   1e-21
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   102   1e-21
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   102   1e-21
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   102   1e-21
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   102   1e-21
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...   100   1e-21
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...   100   1e-21
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    99   1e-21
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    103   1e-21
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    99   1e-21
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   103   1e-21
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   101   1e-21
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...   103   1e-21
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   103   2e-21
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    99   2e-21
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    99   2e-21
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   101   2e-21
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   102   2e-21
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   103   2e-21
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    97   2e-21
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   102   2e-21
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...   101   2e-21
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...   101   2e-21
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   102   2e-21
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...   102   2e-21
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   102   2e-21
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...   100   2e-21
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...   101   2e-21
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180    102   2e-21
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...   100   2e-21
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   100   3e-21
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   102   3e-21
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...   101   3e-21
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   102   3e-21
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...   102   3e-21
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...   102   3e-21
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...   100   3e-21
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   101   3e-21
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    97   3e-21
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   102   4e-21
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...   100   4e-21
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   100   4e-21
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    97   4e-21
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    97   4e-21
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    97   4e-21
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    97   4e-21
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...   101   4e-21
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...   101   5e-21
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    98   5e-21
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180      101   5e-21
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...   101   5e-21
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...   102   5e-21
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...   100   5e-21
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    99   5e-21
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   101   5e-21
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   101   6e-21
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    97   6e-21
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    97   6e-21
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...   101   6e-21
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...   101   6e-21
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    98   6e-21
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   101   6e-21
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    99   7e-21
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...   100   7e-21
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...   100   7e-21
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...   100   8e-21
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    97   8e-21
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...   100   8e-21
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   100   8e-21
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    99   9e-21
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    97   9e-21
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...   100   1e-20
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    99   1e-20
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   100   1e-20
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...   100   1e-20
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    96   1e-20
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     99   1e-20
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    99   1e-20
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...   100   1e-20
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...   100   1e-20
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    97   1e-20
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    96   1e-20
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...   100   1e-20
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    96   1e-20
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   100   1e-20
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    96   1e-20
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...   100   1e-20
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    96   1e-20
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    97   1e-20
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...   100   1e-20
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    99   1e-20
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    99   2e-20
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    99   2e-20
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    99   2e-20
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    97   2e-20
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    97   2e-20
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    99   2e-20
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    99   2e-20
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    96   2e-20
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    92   2e-20
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...   100   2e-20
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    95   2e-20
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    99   2e-20
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    99   2e-20
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    98   2e-20
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    97   2e-20
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    97   2e-20
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    99   2e-20
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    98   3e-20
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    96   3e-20
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    99   3e-20
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    99   3e-20
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    99   3e-20
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    96   3e-20
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    94   3e-20
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    99   3e-20
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    97   3e-20
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    98   3e-20
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    97   4e-20
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    94   4e-20
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    98   4e-20
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    98   4e-20
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    99   4e-20
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    99   4e-20
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    98   5e-20
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    97   5e-20
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    97   5e-20
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    99   5e-20
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    97   5e-20
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    97   5e-20
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    97   5e-20
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    97   5e-20
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    98   6e-20
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    95   6e-20
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    97   6e-20
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    98   6e-20
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    96   6e-20
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    96   6e-20
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    97   6e-20
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    97   7e-20
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    97   7e-20
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    96   7e-20
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    95   7e-20
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    97   7e-20
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    97   8e-20
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    97   8e-20
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    97   8e-20
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    93   9e-20
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    98   9e-20
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    97   9e-20
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    97   9e-20
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    97   9e-20
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    96   9e-20
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    96   9e-20
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    96   9e-20
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    98   1e-19
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    94   1e-19
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    96   1e-19
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    96   1e-19
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    97   1e-19
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    94   1e-19
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    97   1e-19
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    96   1e-19
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    92   1e-19
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    96   1e-19
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    96   1e-19
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    96   1e-19
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    95   1e-19
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    96   2e-19
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    96   2e-19
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    96   2e-19
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      96   2e-19
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    93   2e-19
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    95   2e-19
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    97   2e-19
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    96   2e-19
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    97   2e-19
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    93   2e-19
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    92   2e-19
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    96   2e-19
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    96   2e-19
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    97   2e-19
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    97   2e-19
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    95   2e-19
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    94   2e-19
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    95   2e-19
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    95   2e-19
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    95   3e-19
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    94   3e-19
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    96   3e-19
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    95   3e-19
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    96   3e-19
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    95   3e-19
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    95   3e-19
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    94   3e-19
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    94   3e-19
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    96   3e-19
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    95   3e-19
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    94   3e-19
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    94   3e-19
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    94   3e-19
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    92   3e-19
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    94   3e-19
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    96   4e-19
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    91   4e-19
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    94   4e-19
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     94   4e-19
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    96   4e-19
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    95   4e-19
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    94   4e-19
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    95   4e-19
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    91   5e-19
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    94   5e-19
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    94   5e-19
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    94   5e-19
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    95   5e-19
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    96   5e-19
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    94   5e-19
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    96   5e-19
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     95   5e-19
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    94   5e-19
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    93   5e-19
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    94   5e-19
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    94   5e-19
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    96   5e-19
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    93   6e-19
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    94   6e-19
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    96   6e-19
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    93   6e-19
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    95   6e-19
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    93   6e-19
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    94   7e-19
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    93   7e-19
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    94   7e-19
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    92   7e-19
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    91   7e-19
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    91   8e-19
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    94   8e-19
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    93   8e-19
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    95   9e-19
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    93   9e-19
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    94   9e-19
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        93   9e-19
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    91   9e-19
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    94   9e-19
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    93   9e-19
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    92   1e-18
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    92   1e-18
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    93   1e-18
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    92   1e-18
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    94   1e-18
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    94   1e-18
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    92   1e-18
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    91   1e-18
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    92   2e-18
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    93   2e-18
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    92   2e-18
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    92   2e-18
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    92   2e-18
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    94   2e-18
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    93   2e-18
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    93   2e-18
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    90   2e-18
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    94   2e-18
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    92   2e-18
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    93   2e-18
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    93   2e-18
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    93   3e-18
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    92   3e-18
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    93   3e-18
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    92   3e-18
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    91   3e-18
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    92   3e-18
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    90   4e-18
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    92   4e-18
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    91   4e-18
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    92   4e-18
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    92   4e-18
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    92   4e-18
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    92   4e-18
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    91   4e-18
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    92   5e-18
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    92   5e-18
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    91   5e-18
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    90   5e-18
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    90   5e-18
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    91   5e-18
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    92   5e-18
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    90   5e-18
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    90   6e-18
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    92   6e-18
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    91   7e-18
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    91   7e-18
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    89   7e-18
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    90   8e-18
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    91   8e-18
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    89   8e-18
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    91   8e-18
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     90   8e-18
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    91   9e-18
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    92   9e-18
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    90   9e-18
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    91   9e-18
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    91   9e-18
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    90   1e-17
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    86   1e-17
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     88   1e-17
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    89   1e-17
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    90   1e-17
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    89   1e-17
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    91   1e-17
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    90   1e-17
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    89   1e-17
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     88   2e-17
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     89   2e-17
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    90   2e-17
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    91   2e-17
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    88   2e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    89   2e-17
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      90   2e-17
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    88   2e-17
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    88   2e-17
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    87   2e-17
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    90   2e-17
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    87   2e-17
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    88   2e-17
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               89   2e-17
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    90   3e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    88   3e-17
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    87   3e-17
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    89   3e-17
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    86   3e-17
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              90   3e-17
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    88   3e-17
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    89   3e-17
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    86   3e-17
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    90   3e-17
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    88   3e-17
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    89   3e-17
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    89   3e-17
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    89   3e-17
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    88   3e-17
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    88   4e-17
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    89   4e-17
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    88   4e-17
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    88   4e-17
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    89   4e-17
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               89   4e-17
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    88   4e-17
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    89   5e-17
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    87   5e-17
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    89   5e-17
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    88   5e-17
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    88   5e-17
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    88   5e-17
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    88   5e-17
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    87   5e-17
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    86   5e-17
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    88   5e-17
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    86   5e-17
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             88   5e-17
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    87   5e-17
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    86   6e-17
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    87   6e-17
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    87   6e-17
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    87   6e-17
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    87   6e-17
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    88   6e-17
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    88   7e-17
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    88   7e-17
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     86   7e-17
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    86   7e-17
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    88   7e-17
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    88   7e-17
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    88   7e-17
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    87   8e-17
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    86   8e-17
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    86   8e-17
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    87   9e-17
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    87   9e-17
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    87   9e-17
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    88   9e-17
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    87   9e-17
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    88   9e-17
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    87   9e-17
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    88   9e-17
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    87   1e-16
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    86   1e-16
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    87   1e-16
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    87   1e-16
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    86   1e-16
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    85   1e-16
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    87   1e-16
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    87   1e-16
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    87   1e-16
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    86   1e-16
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    87   1e-16
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    87   1e-16
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    87   1e-16
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    87   1e-16
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    86   1e-16
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    87   1e-16
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    86   1e-16
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    87   1e-16
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              86   1e-16
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    86   2e-16
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    84   2e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    86   2e-16
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    86   2e-16
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    86   2e-16
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    83   2e-16
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    87   2e-16
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    84   2e-16
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    86   2e-16
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    86   2e-16
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    85   2e-16
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    85   2e-16
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    84   3e-16
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    86   3e-16
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    86   3e-16
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    86   3e-16
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    86   3e-16
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    84   3e-16
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    85   3e-16
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    86   3e-16
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    83   3e-16
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    83   3e-16
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    86   3e-16
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    86   4e-16
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    82   4e-16
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    86   4e-16
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    84   4e-16
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    84   4e-16
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    86   4e-16
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    86   4e-16
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    83   5e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    84   5e-16
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    84   5e-16
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    84   5e-16
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    84   5e-16
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      85   5e-16
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    85   5e-16
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    83   5e-16
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    83   5e-16
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    83   6e-16
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    85   6e-16
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    83   6e-16
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    85   6e-16
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    83   6e-16
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    81   6e-16
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    85   7e-16
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    82   7e-16
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    84   7e-16
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    85   7e-16
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    84   7e-16
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    82   8e-16
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    83   8e-16
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    82   8e-16
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    84   9e-16
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    84   9e-16
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    82   9e-16
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    82   9e-16
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    84   9e-16
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    84   9e-16
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    84   1e-15
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    84   1e-15
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    84   1e-15
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     84   1e-15
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    82   1e-15
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    82   1e-15
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    82   1e-15
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      84   1e-15
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    82   1e-15
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    83   1e-15
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    84   1e-15
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    84   1e-15
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    84   1e-15
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    84   1e-15
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    81   2e-15
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    84   2e-15
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    83   2e-15
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    81   2e-15
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    84   2e-15
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    84   2e-15
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    82   2e-15
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    80   2e-15
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    84   2e-15
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    83   2e-15
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    83   2e-15
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    83   2e-15
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    81   2e-15
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    82   2e-15
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    82   2e-15
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    82   2e-15
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    82   2e-15
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    83   2e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    82   2e-15
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    81   2e-15
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    83   2e-15
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    83   2e-15
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    82   2e-15
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    83   2e-15
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    82   2e-15
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    81   3e-15
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    83   3e-15
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    83   3e-15
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    83   3e-15
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    81   3e-15
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    81   4e-15
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    80   4e-15
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    80   4e-15
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    80   4e-15
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     82   4e-15
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    82   4e-15
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    81   4e-15
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     82   5e-15
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    80   5e-15
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    82   5e-15
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    80   5e-15
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    80   5e-15
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    82   5e-15
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    82   5e-15
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    81   6e-15
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    81   6e-15
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    82   6e-15
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    82   6e-15
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    82   6e-15
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    80   6e-15
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    81   6e-15
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    80   7e-15
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    80   7e-15
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    82   8e-15
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    79   8e-15
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    82   8e-15
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    79   9e-15
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    81   9e-15
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    81   1e-14
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    79   1e-14
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    79   1e-14
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    80   1e-14
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    80   1e-14
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    81   1e-14
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              81   1e-14
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    79   1e-14
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    80   1e-14
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    80   1e-14
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    81   1e-14
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    79   1e-14
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    79   1e-14
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    80   2e-14
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    79   2e-14
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    79   2e-14
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    80   2e-14
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    80   2e-14
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    80   2e-14
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               79   2e-14
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    80   2e-14
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    78   2e-14
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    80   2e-14
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    78   2e-14
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    80   2e-14
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    80   2e-14
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     80   2e-14
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    80   2e-14
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    79   2e-14
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    80   2e-14
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    80   2e-14
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    79   2e-14
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    79   3e-14
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    77   3e-14
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    79   3e-14
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    80   3e-14
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    79   3e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    79   3e-14
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    79   3e-14
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    80   3e-14
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    80   3e-14
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    79   3e-14
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    79   4e-14
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    79   4e-14
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    79   4e-14
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    79   4e-14
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    78   4e-14
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    79   4e-14
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    77   5e-14
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    79   5e-14
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    78   5e-14
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    77   5e-14
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    79   5e-14
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    77   6e-14
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    79   6e-14
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    79   6e-14
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    77   6e-14
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     78   6e-14
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    77   7e-14
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    79   7e-14
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    78   7e-14
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    79   8e-14
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    78   8e-14
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    78   8e-14
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    77   8e-14
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    78   8e-14
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    78   8e-14
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    78   9e-14
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    78   9e-14
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    78   9e-14
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    77   9e-14
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    77   1e-13
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    77   1e-13
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    76   1e-13
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    78   1e-13
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    78   1e-13
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    77   1e-13
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    78   1e-13
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    77   1e-13
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    76   1e-13
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    76   1e-13
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    77   1e-13
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    77   1e-13
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    76   1e-13
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    77   1e-13
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    77   1e-13
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    77   1e-13
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              77   1e-13
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    77   1e-13
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    77   2e-13
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    75   2e-13
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    77   2e-13
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    77   2e-13
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    77   2e-13
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    75   2e-13
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    76   2e-13
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    76   2e-13
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    77   2e-13
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    77   2e-13
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    76   2e-13
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    77   2e-13
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    77   2e-13
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    76   2e-13
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    76   2e-13
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    76   2e-13
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    75   2e-13
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    76   3e-13
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    77   3e-13
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    76   3e-13
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               76   3e-13
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    76   3e-13
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    76   3e-13
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    74   3e-13
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    74   3e-13
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    76   3e-13
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    74   4e-13
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    75   4e-13
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    75   4e-13
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    76   4e-13
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    75   4e-13
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    75   4e-13
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    76   4e-13
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    75   5e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    74   5e-13
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    75   5e-13
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    75   5e-13
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    74   5e-13
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    75   5e-13
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    75   5e-13
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             74   6e-13
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    74   6e-13
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      75   6e-13
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    75   6e-13
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    75   6e-13
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    75   6e-13
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    75   6e-13
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    74   7e-13
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    74   8e-13
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    75   8e-13
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    75   9e-13
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    73   9e-13
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    73   9e-13
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    74   1e-12
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    73   1e-12
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    74   1e-12
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    73   1e-12
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    73   1e-12
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    73   1e-12
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    73   1e-12
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    74   1e-12
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    73   1e-12
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    72   1e-12
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    74   2e-12
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    74   2e-12
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    72   2e-12
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    74   2e-12
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    74   2e-12
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    74   2e-12
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    72   2e-12
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    74   2e-12
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    73   2e-12
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    72   2e-12
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    73   2e-12
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    74   2e-12
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    74   2e-12
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    74   3e-12
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    73   3e-12
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    73   3e-12
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    72   3e-12
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    73   3e-12
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    73   3e-12
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    73   3e-12
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    73   3e-12
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    73   3e-12
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    72   3e-12
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    73   3e-12
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    72   3e-12
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    73   3e-12
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    73   3e-12
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    73   4e-12
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    73   4e-12
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    72   4e-12
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    72   4e-12
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    71   4e-12
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    72   5e-12
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    72   5e-12
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    72   5e-12
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    70   5e-12
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    72   6e-12
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    72   6e-12
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    72   7e-12
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    72   7e-12
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    71   7e-12
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    72   7e-12
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    72   8e-12
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    72   8e-12
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    71   8e-12
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    71   9e-12
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    71   1e-11
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    71   1e-11
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    72   1e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    71   1e-11
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               71   1e-11
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    71   1e-11
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    71   1e-11
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    71   1e-11
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    71   1e-11
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               70   1e-11
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    71   1e-11
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    71   1e-11
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    71   2e-11
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    69   2e-11
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    70   2e-11
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    70   2e-11
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    70   2e-11
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    69   2e-11
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    70   2e-11
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    70   2e-11
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    70   2e-11
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    70   2e-11
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    70   2e-11
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    70   3e-11
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    69   3e-11
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    70   3e-11
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    70   3e-11
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    70   4e-11
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    69   4e-11
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    69   4e-11
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    69   4e-11
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    69   4e-11
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    68   4e-11
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    69   4e-11
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    69   4e-11
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    69   5e-11
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    69   5e-11
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     69   5e-11
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    69   6e-11
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    69   6e-11
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    68   6e-11
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    69   7e-11
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    67   7e-11
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    68   7e-11
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    69   7e-11
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     68   9e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    67   9e-11
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     68   1e-10
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    68   1e-10
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    68   1e-10
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    68   1e-10
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    68   1e-10
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    68   1e-10
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    67   1e-10
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    67   1e-10
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    68   1e-10
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    67   1e-10
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    67   1e-10
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    67   2e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    66   2e-10
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    67   2e-10
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    67   2e-10
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    67   2e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    67   2e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    66   2e-10
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    67   2e-10
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       67   3e-10
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    67   3e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    66   3e-10
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    65   3e-10
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    66   3e-10
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    66   3e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    65   3e-10
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    66   4e-10
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    66   4e-10
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    66   4e-10
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    66   4e-10
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    65   4e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    66   5e-10
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    66   5e-10
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    65   6e-10
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    65   6e-10
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    66   6e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    64   6e-10
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    65   6e-10
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    65   6e-10
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    65   6e-10
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    65   6e-10
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    65   7e-10
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    65   7e-10
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    65   7e-10
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    65   8e-10
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    65   8e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    65   8e-10
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    65   9e-10
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    65   1e-09
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    64   1e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    64   1e-09
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    64   1e-09
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    64   1e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    64   1e-09
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    64   2e-09
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    64   2e-09
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    64   2e-09
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    64   2e-09
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    63   2e-09
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    63   2e-09
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    63   3e-09
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    63   3e-09
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    63   3e-09
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    62   4e-09
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    63   4e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    62   4e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    62   4e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    63   4e-09
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    63   4e-09
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    63   5e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    62   5e-09
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    62   5e-09
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    62   5e-09
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    62   6e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    62   6e-09
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    62   6e-09
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    62   7e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    61   7e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    61   7e-09
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    62   8e-09
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    62   8e-09
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    62   9e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    61   1e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    61   1e-08
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    60   1e-08
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               60   1e-08
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    61   1e-08
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    61   1e-08
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    61   1e-08
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    61   2e-08
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    60   2e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    60   2e-08
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    60   2e-08
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    59   3e-08
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    60   3e-08
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               60   3e-08
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    60   3e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    59   3e-08
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    60   3e-08
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    59   3e-08
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    60   4e-08
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    60   4e-08
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    59   4e-08
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    59   4e-08
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    59   5e-08
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    59   5e-08
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    59   5e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    58   5e-08
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    59   5e-08
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    59   6e-08
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    58   6e-08
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    59   6e-08
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    58   6e-08
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    59   7e-08
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    59   7e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    58   7e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    59   7e-08
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    58   8e-08
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    57   9e-08
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    59   9e-08
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    58   1e-07
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    57   1e-07
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    58   1e-07
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    57   1e-07
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    58   1e-07
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    58   1e-07
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    58   1e-07
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    58   1e-07
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    57   1e-07
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    58   1e-07
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    58   2e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    57   2e-07
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    57   2e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    57   2e-07
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    57   2e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    57   3e-07
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    57   3e-07
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    56   3e-07
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    56   4e-07
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    55   4e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    55   5e-07
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    56   5e-07
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    56   5e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    56   5e-07
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    55   8e-07
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    55   1e-06
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    55   1e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    55   1e-06
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    54   2e-06
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    53   2e-06
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    54   3e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    53   3e-06
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    52   3e-06
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    53   4e-06
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    52   5e-06
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    53   5e-06
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     52   6e-06
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    52   6e-06
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    52   7e-06
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    51   1e-05
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    51   1e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    51   1e-05
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    51   1e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    51   1e-05
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    51   1e-05
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    52   1e-05
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    52   1e-05
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    51   1e-05
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    50   2e-05
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    50   3e-05
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    50   3e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    50   3e-05
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    50   3e-05
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    50   3e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    49   4e-05
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    47   4e-05
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    50   4e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    49   4e-05
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    49   4e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    49   5e-05
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    49   6e-05
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    48   1e-04
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    48   1e-04
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    47   1e-04
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    48   1e-04
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    48   2e-04
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    48   2e-04
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    48   2e-04
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    47   2e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    47   2e-04
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    47   3e-04
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    46   3e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    47   3e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    46   4e-04
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    46   4e-04
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    46   5e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    46   5e-04
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    46   5e-04
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     45   7e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    45   8e-04
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    45   8e-04
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    45   0.001
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    45   0.001
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    45   0.001
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    44   0.001
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    45   0.002
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    44   0.002
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    44   0.002
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    44   0.002
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    45   0.002
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    44   0.002
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    44   0.002
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     44   0.002
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    44   0.002
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    44   0.002
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    44   0.003
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    44   0.003
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    43   0.005
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    43   0.005
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    43   0.005
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.006
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    42   0.006
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    42   0.006
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    42   0.008
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    42   0.009
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    42   0.009
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    42   0.009
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    42   0.009
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    40   0.009
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    42   0.010
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    42   0.011
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    42   0.011
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    41   0.012
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    40   0.013
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    41   0.013
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    41   0.015
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    41   0.016
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    41   0.016
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    41   0.017
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    41   0.017
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    41   0.019
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    41   0.020
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    41   0.021
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    40   0.022
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    41   0.023
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    41   0.023
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    40   0.023
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    40   0.024
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    40   0.026
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    40   0.027
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    40   0.027
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    40   0.027
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.028
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    40   0.029
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    40   0.032
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    40   0.032
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     40   0.032
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    40   0.036
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    40   0.039
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    40   0.039
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    40   0.042
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    40   0.045
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    40   0.045
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    40   0.047
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    39   0.048
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.050
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    40   0.052
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    39   0.057
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    39   0.059
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    39   0.063
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.064
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    39   0.068
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    39   0.070
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    39   0.072
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    39   0.080
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.085
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    39   0.086
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    39   0.089
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    38   0.12 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    38   0.12 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    38   0.13 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    39   0.13 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    38   0.13 
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    38   0.14 
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    38   0.14 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    38   0.15 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    38   0.16 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    38   0.17 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    38   0.17 
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    38   0.18 
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    38   0.18 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    38   0.19 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    37   0.20 
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    37   0.25 
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    37   0.26 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    37   0.26 
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    37   0.27 
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    37   0.30 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.31 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    37   0.31 
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    37   0.31 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    37   0.38 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    37   0.39 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    37   0.41 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    36   0.50 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    36   0.53 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    36   0.55 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    36   0.55 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     36   0.56 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    36   0.58 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    35   0.82 
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    35   1.1  
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    35   1.3  
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    35   1.5  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    35   1.5  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    35   1.5  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    34   2.9  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    33   3.7  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    33   4.0  
KLLA0E19207g Chr5 (1709335..1711638) [2304 bp, 767 aa] {ON} simi...    32   9.1  

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score = 1937 bits (5017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 977/1135 (86%), Positives = 977/1135 (86%)

Query: 1    MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60
            MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM
Sbjct: 1    MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60

Query: 61   SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
            SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN
Sbjct: 61   SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
            LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
            ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 241  LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300
            LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS
Sbjct: 241  LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300

Query: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
            IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL
Sbjct: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360

Query: 361  YRFKCDTQKELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIXX 420
            YRFKCDTQKEL              VSTSSPNKISTTPQRRKNRESIISVTSSRKKPI  
Sbjct: 361  YRFKCDTQKELIRQQQIKKRQSISSVSTSSPNKISTTPQRRKNRESIISVTSSRKKPISF 420

Query: 421  XXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIVNQASPTPASRNKRTSIINVDKNQR 480
                                RLSKNFSSKKRLSTIVNQASPTPASRNKRTSIINVDKNQR
Sbjct: 421  NKFTASSASSSNLTTPGSSKRLSKNFSSKKRLSTIVNQASPTPASRNKRTSIINVDKNQR 480

Query: 481  RASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTS 540
            RASVF               LSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTS
Sbjct: 481  RASVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTS 540

Query: 541  SNFATLIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVXXXXX 600
            SNFATLID                                              V     
Sbjct: 541  SNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAREELERRKRKQEEKEHSRKVLEKEE 600

Query: 601  XXXXXXXXXXXXXXXXSDXXXXXXXXXXXXPDGNIRSISAPMESEEKNINHLEVDIDNIL 660
                            SD            PDGNIRSISAPMESEEKNINHLEVDIDNIL
Sbjct: 601  LKRKQQELKKQIEIDISDLEHELSKHKEEKPDGNIRSISAPMESEEKNINHLEVDIDNIL 660

Query: 661  RRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENERLTTEKKILETIRRSKFLGSS 720
            RRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENERLTTEKKILETIRRSKFLGSS
Sbjct: 661  RRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENERLTTEKKILETIRRSKFLGSS 720

Query: 721  FNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTG 780
            FNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTG
Sbjct: 721  FNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTG 780

Query: 781  DLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVH 840
            DLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVH
Sbjct: 781  DLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVH 840

Query: 841  KQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR 900
            KQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR
Sbjct: 841  KQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR 900

Query: 901  FNASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTXXXXX 960
            FNASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHT     
Sbjct: 901  FNASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTGKEEE 960

Query: 961  XXXXXXXXREDQEKDAKGAKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNISGNGX 1020
                    REDQEKDAKGAKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNISGNG 
Sbjct: 961  KEEKGEEGREDQEKDAKGAKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNISGNGS 1020

Query: 1021 XXXXXXXXXXXXXXVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSS 1080
                          VELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSS
Sbjct: 1021 FFRKFSKSSTSDKSVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSS 1080

Query: 1081 ENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
            ENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK
Sbjct: 1081 ENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/548 (85%), Positives = 485/548 (88%)

Query: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60
           MAVNGNS+ AIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFN+GN+
Sbjct: 1   MAVNGNSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNV 60

Query: 61  SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
           SGTSIVGS TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN
Sbjct: 61  SGTSIVGSNTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
           ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 
Sbjct: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRA 240

Query: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300
           LLLKVQKG+FELPSDDE+SREAQDLI KILTVDP+RRIKARDILKHPLLQKYPSIRDSKS
Sbjct: 241 LLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKS 300

Query: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
           IR LPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGI+ KL+EPGANAEKTLYALL
Sbjct: 301 IRDLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALL 360

Query: 361 YRFKCDTQKELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIXX 420
           YRFKCDTQKEL              VS S P + STTPQRR+NRESIISV+SSRKKPI  
Sbjct: 361 YRFKCDTQKELIKQQQIRKRQSIGSVSISPPKRTSTTPQRRRNRESIISVSSSRKKPISF 420

Query: 421 XXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIVNQASPTPASRNKRTSIINVDKNQR 480
                               RLSKNFSSKK+LSTIVNQ+SPTP+SRNKRTSI NVDKNQ+
Sbjct: 421 NKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPSSRNKRTSIANVDKNQK 480

Query: 481 RASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTS 540
           RAS+F               +SLIPSMKRESVTTKLMSTYAKLA DDDWEYIEKETKRTS
Sbjct: 481 RASIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540

Query: 541 SNFATLID 548
           SNFATLID
Sbjct: 541 SNFATLID 548

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/507 (74%), Positives = 428/507 (84%), Gaps = 13/507 (2%)

Query: 632  DGNIRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAV 691
            +GNIRSISAPME+EE NINHLE DIDNILRRRNFSLQTRPVSRLDPGI+FSSP+E E  V
Sbjct: 632  EGNIRSISAPMENEENNINHLEADIDNILRRRNFSLQTRPVSRLDPGIIFSSPIETEDPV 691

Query: 692  EPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSD 751
            EPK+ ENERLTTEKKILETIRRSKFLGSSFNI+KELKLS+MEYP M  PQRLSEERIVSD
Sbjct: 692  EPKKAENERLTTEKKILETIRRSKFLGSSFNIDKELKLSQMEYPGMAAPQRLSEERIVSD 751

Query: 752  PSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNK 811
             +  Y SLVLPKDA+G + L+D+ APTT +LLSNGELRKIS++RVPQFTRKSRHFSESNK
Sbjct: 752  SNGKYESLVLPKDAKGVAHLKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNK 811

Query: 812  RLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTG 871
            RLSVLSMYS+KESFTNLVDILKNGN+D++ QQ+QR+PTP+SADDSEFLFETVNEEAEYTG
Sbjct: 812  RLSVLSMYSTKESFTNLVDILKNGNLDINPQQNQRVPTPRSADDSEFLFETVNEEAEYTG 871

Query: 872  NSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDEVNKQK 931
            NSSNDERLYDVGDS IKDK+ LKLNFADRFN STNEKET+NLHLPTLPPLNG DE  KQ 
Sbjct: 872  NSSNDERLYDVGDSCIKDKNTLKLNFADRFNGSTNEKETKNLHLPTLPPLNGKDEAGKQG 931

Query: 932  DE---DVLGIQPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDAKGAKDIEPPLNK 988
            +E   + L  QPKVKSMIP+SDS SH              REDQ+   +G KD+EPPLNK
Sbjct: 932  EEQEKEDLHEQPKVKSMIPESDSLSHA-------EKEQKEREDQQ---RGGKDLEPPLNK 981

Query: 989  SVQKTRANDSGPQVKSHPREPKKDRNISGNGXXXXXXXXXXXXXXXVELYAKVSAKQLFN 1048
            SVQKTR  ++  Q K+   +PK ++N+SGNG                ELYAKVSAKQLFN
Sbjct: 982  SVQKTREKNNDTQAKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEKSTELYAKVSAKQLFN 1041

Query: 1049 GLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMSVVQFKK 1108
            GLEKLLRGW QYGLKN+KS+PNNLTLTGKLSSEN+FSLRSTLFE+SIY +GK+SVV+FKK
Sbjct: 1042 GLEKLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKVSVVEFKK 1101

Query: 1109 VSGAFKAVKKLVNEVENVLSKEGVLEK 1135
            +SG+FK VKKLV EVENVL+KEGVL+K
Sbjct: 1102 ISGSFKTVKKLVKEVENVLNKEGVLQK 1128

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/548 (85%), Positives = 484/548 (88%)

Query: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60
           MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISK VFN GN+
Sbjct: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNV 60

Query: 61  SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
           SGTSIVGS TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN DLYLVLEYAEKGELFN
Sbjct: 61  SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFN 120

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
           ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT
Sbjct: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300
           LLLKVQKG+FELPSDDE+SREAQDLI +ILTVDP+RRIK RDILKHPLLQKYPSI+DSKS
Sbjct: 241 LLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKS 300

Query: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
           IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKL+E GANAEKTLYALL
Sbjct: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALL 360

Query: 361 YRFKCDTQKELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIXX 420
           YRFKCDTQKEL              +S S   K+STTPQRRKNRES+ISV+SSRKKPI  
Sbjct: 361 YRFKCDTQKELVKQQQIKKRQSISSLSISPSKKLSTTPQRRKNRESMISVSSSRKKPISF 420

Query: 421 XXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIVNQASPTPASRNKRTSIINVDKNQR 480
                               RLSKNFSSKK+LSTIVNQ+SPTPASRNKR S+IN++KNQ+
Sbjct: 421 NKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPASRNKRASVINIEKNQK 480

Query: 481 RASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTS 540
           RASVF               +SLIPSMKRESVTTKLMSTYAKLA DDDWEYIEKETKRTS
Sbjct: 481 RASVFSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540

Query: 541 SNFATLID 548
           SNFATLID
Sbjct: 541 SNFATLID 548

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/509 (76%), Positives = 433/509 (85%), Gaps = 7/509 (1%)

Query: 631  PDGNIRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESA 690
            PDGNIRSISAPME+EEKNI+HL  DIDNILRRRNFSLQTRPVSRLDPGI+FS+P+E    
Sbjct: 631  PDGNIRSISAPMENEEKNIDHLGTDIDNILRRRNFSLQTRPVSRLDPGIVFSNPIETVYP 690

Query: 691  VEPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVS 750
            VEPKR+ENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPS++ P++LS ER+VS
Sbjct: 691  VEPKRSENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSVLAPEKLSGERVVS 750

Query: 751  DPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESN 810
            D +  Y SL+LPKDA+G SQL+D I  TT + LS+G+LRKISEVRVPQFTRKSRHFSESN
Sbjct: 751  DLNGKYESLILPKDAKGVSQLKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESN 810

Query: 811  KRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYT 870
            KRLS+LSMYS+KESFTNLVDILKN N+DV+ QQSQRIPTP+SADDSEFLFETVNEEAEYT
Sbjct: 811  KRLSLLSMYSTKESFTNLVDILKNSNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYT 870

Query: 871  GNSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDEVNKQ 930
            GNSSNDERLYDVGDSTIKDK+ALKLNFADRFN ST  KET+NLHLP+LPPL+G DE+ KQ
Sbjct: 871  GNSSNDERLYDVGDSTIKDKTALKLNFADRFNESTEYKETDNLHLPSLPPLSGDDEMRKQ 930

Query: 931  KDEDVLGIQPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDAKGAKDIEPPLNKSV 990
              E+   +QPKVKSMIPQSDSSSHT             +E+ EK+   AKDIEPPLNKSV
Sbjct: 931  NSEEDSLVQPKVKSMIPQSDSSSHTEKVEEKEGESQEVQEESEKE---AKDIEPPLNKSV 987

Query: 991  QKTRANDSGPQVKSHPR----EPKKDRNISGNGXXXXXXXXXXXXXXXVELYAKVSAKQL 1046
            QK R  + GPQ K H R    E K+DRN +GN                VELYAKVSA+QL
Sbjct: 988  QKLREKNPGPQEKDHQRDHLKEHKQDRNTTGNSSFFRKFSKSSASDKLVELYAKVSARQL 1047

Query: 1047 FNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMSVVQF 1106
            FNGLEKLLRGWTQ+GLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEI+IYP+G+MSVVQF
Sbjct: 1048 FNGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIYPKGRMSVVQF 1107

Query: 1107 KKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
            KK+SG+FKAVKKLVNEVENVL+KEGVL+K
Sbjct: 1108 KKISGSFKAVKKLVNEVENVLNKEGVLQK 1136

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/548 (85%), Positives = 486/548 (88%)

Query: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60
           MA+NGNS+PAIKDNTIGPWKLGETLGLGSTGKVQLARN STGQEAAVKVISKAVFN GN+
Sbjct: 1   MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60

Query: 61  SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
           SGTSIVGS TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN
Sbjct: 61  SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLVERGPLPE+EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121 LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
           ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT
Sbjct: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300
           LLLKVQKG+FE+PSDDE+SREAQDLI KILTVDP+RRIK RDILKHPLLQKYPSIRDSKS
Sbjct: 241 LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300

Query: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
           IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDP+GIKEKL+EPGANAEKTLYALL
Sbjct: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360

Query: 361 YRFKCDTQKELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIXX 420
           YRFKCDTQKEL              VS S   K+STTPQRR+NRES+ISVTSSRKKPI  
Sbjct: 361 YRFKCDTQKELIKQQQVKKRQSISSVSVSPSKKVSTTPQRRRNRESLISVTSSRKKPISF 420

Query: 421 XXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIVNQASPTPASRNKRTSIINVDKNQR 480
                               RLSKNFSSKK+LSTIVNQ+SPTPASRNKR S+INV+KNQ+
Sbjct: 421 NKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPASRNKRASVINVEKNQK 480

Query: 481 RASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTS 540
           RAS+F               +SLIPSMKRESVTTKLMSTYAKLA DDDWEYIEKETKRTS
Sbjct: 481 RASIFSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540

Query: 541 SNFATLID 548
           SNFATLID
Sbjct: 541 SNFATLID 548

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/515 (75%), Positives = 427/515 (82%), Gaps = 15/515 (2%)

Query: 632  DGNIRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAV 691
            DGNIRSISAPME+EEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSP E+ S V
Sbjct: 632  DGNIRSISAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSPV 691

Query: 692  EPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSD 751
            EPKRTENERLTTEKKILETIRRSKFLGSSFNI+KELKLSKMEYPS++ PQRLSEER+VSD
Sbjct: 692  EPKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSD 751

Query: 752  PSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNK 811
             +D Y SL+LPKD  G SQL+D  A T    +S+G LRKISE+RVPQFTRKSRHFSESNK
Sbjct: 752  SNDGYESLILPKDGNGVSQLKDSTATTAP--VSDGRLRKISEIRVPQFTRKSRHFSESNK 809

Query: 812  RLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTG 871
            RLSVLSMYS+KESFTNLVDILKNGN+DV+ QQSQRIPTP+SADDSEFLFETVNEEAEYTG
Sbjct: 810  RLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTG 869

Query: 872  NSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDEVNKQK 931
            NSSNDERLYDVGDSTIKDKSALKLNFADRFN S   K+T+NLHLP LPPLNG +E+ KQ 
Sbjct: 870  NSSNDERLYDVGDSTIKDKSALKLNFADRFNGSNEAKQTDNLHLPILPPLNGDNELRKQN 929

Query: 932  DEDVLGIQPKVKSMIPQSDSSSHT------XXXXXXXXXXXXXREDQEKDAKGAKDIEPP 985
             ++     PK+KSMIP+S SSSHT                    EDQEK  K   D+EPP
Sbjct: 930  SQEGDQAHPKIKSMIPESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEKREKVVDDMEPP 989

Query: 986  LNKSVQKTRANDSGPQVKSHP----REPKKDRNIS-GNGXXXXXXXXXXXXXXXVELYAK 1040
            LNKSVQK R  ++G Q K H     +E K+D+N + GNG               +ELYAK
Sbjct: 990  LNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNG--SFFRKFSKSSDKTMELYAK 1047

Query: 1041 VSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGK 1100
            +SAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSS+NIFSLRSTLFE++IYPRGK
Sbjct: 1048 ISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIYPRGK 1107

Query: 1101 MSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
            MSVVQFKKVSG+FKAVKKLVNEVENVL+KEGVL+K
Sbjct: 1108 MSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/549 (70%), Positives = 435/549 (79%), Gaps = 15/549 (2%)

Query: 5   GNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTS 64
            N++P+IK + +GPWKLGETLGLGSTGKVQLA NK+TG++AA+KVISK+VFN  +   +S
Sbjct: 4   SNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSS 63

Query: 65  IVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
           +    TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYAEKGELFNLLVE
Sbjct: 64  LT---TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 120

Query: 125 RGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEG 184
           +GPL E EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 
Sbjct: 121 KGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED 180

Query: 185 KLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK 244
           KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFDEEDGNIR LLLK
Sbjct: 181 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 240

Query: 245 VQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGL 304
           VQ G+FE+PSDDE+S EAQDL+ KILTVDP++RI+ARDILKHPLLQKYPSI+DSKSIR L
Sbjct: 241 VQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNL 300

Query: 305 PREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
           PREDTYL PLS++NS+ID TILQNLV+LWHGRD + I  KLKEPGANAEKTLYALL RFK
Sbjct: 301 PREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360

Query: 365 CDTQKELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIXXXXXX 424
            D++KE                 + SP K ++TPQRRKNR S+ISV+SS KKP       
Sbjct: 361 IDSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLS 420

Query: 425 XXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIV-----NQASPTPASRNKRTSIINVDKNQ 479
                             SK FS  K+LS I      N +SPTPA RNKRTS+IN D   
Sbjct: 421 SVVHNNLSASSSTTTTPASKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTD--- 477

Query: 480 RRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRT 539
            R S+                LS++ +MKR S+TTKL++TYAKL+ DDDWEYIEKETKRT
Sbjct: 478 -RQSIL---SKNKRASRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRT 533

Query: 540 SSNFATLID 548
           SS+FATLID
Sbjct: 534 SSDFATLID 542

 Score =  351 bits (900), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 227/535 (42%), Positives = 306/535 (57%), Gaps = 78/535 (14%)

Query: 632  DGNIRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFS--SPVEKES 689
            + N RS+S P+  E  N        DN+LR+RNFSLQTRP+SRLDPG+ FS  SP E++ 
Sbjct: 626  EDNYRSVSVPLSKETVN--------DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKP 677

Query: 690  AVEPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPP--QRLSEER 747
                +   N++L TEK ILETIRRSKFLGSSF+I +ELK +  E   M PP  Q+L+ E 
Sbjct: 678  ISPDEPVPNKKLDTEKMILETIRRSKFLGSSFDINRELKAA--EKRVMQPPTVQKLTTEN 735

Query: 748  IVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFS 807
              SD         LPK A G + L            S  E+ KIS++RVPQFTRKSRHF+
Sbjct: 736  KSSDE--------LPKHAVGTAALNS----------STAEVSKISDIRVPQFTRKSRHFT 777

Query: 808  ESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEA 867
             SN+RLSVLSMYS+++SF+NLVDILKN   +   +  QR PTP SA DSEF+FETVNEEA
Sbjct: 778  TSNRRLSVLSMYSTRQSFSNLVDILKN--TEAGTELGQRTPTPHSAGDSEFIFETVNEEA 835

Query: 868  EYTGNSSNDERLYDVGDSTIKDK-SALKLNFADRFNASTNE-----KETENLHLPTLPPL 921
            EYTGNSSND++LY+V D    +K S +KLNFADRFN    +     ++ +N  LP LPPL
Sbjct: 836  EYTGNSSNDDKLYEVADLDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQN-KLPVLPPL 894

Query: 922  NG-----------------------GDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTXXX 958
            +G                       GD+  +    D    + ++KSMIP++         
Sbjct: 895  DGKAGLGIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEA---VIEEPK 951

Query: 959  XXXXXXXXXXREDQEKDAKGAKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNISGN 1018
                      R+DQE D +   + +P +             P+ +   +E K+  +    
Sbjct: 952  NVSPIEVQKTRKDQEHDKRPVMEKKPEV-----------VAPKQRESDQEKKRSVSFFRK 1000

Query: 1019 GXXXXXXXXXXXXXXXVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKL 1078
                              L   ++A+Q+F+GL +LL GW++YGLKN++S  + +T++GKL
Sbjct: 1001 FSGSSISSNKSKAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKL 1060

Query: 1079 SSENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
            SS+NI SLRST FEI +   G+ S V  +K SG+ KAV +L  E+EN+ SKEGVL
Sbjct: 1061 SSDNILSLRSTNFEIKVTSNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/566 (65%), Positives = 427/566 (75%), Gaps = 19/566 (3%)

Query: 2   AVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMS 61
           A++  SVP +K N IGPWKLGETLGLGSTGKVQLA ++ST Q+AA+KVISKA+FN     
Sbjct: 3   AMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV 62

Query: 62  GTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
             S V + TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYA+KGELFNL
Sbjct: 63  KDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122

Query: 122 LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           LVERGPLPE EAIRFFRQI+IG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE
Sbjct: 123 LVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 182

Query: 182 TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241
           TE KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFD+EDGNIR L
Sbjct: 183 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNL 242

Query: 242 LLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSI 301
           LL+VQ G++E+P DDE+S +AQDLI +ILTVDP++RIKARDILKHPLLQKYPSI DSKSI
Sbjct: 243 LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSI 302

Query: 302 RGLPREDTYLTPLSESNSS-IDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
           R LPREDTYL PLSE  S+ ID  ILQNLV+LWHGR+   I  KL+EPGANAEKTLYALL
Sbjct: 303 RNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362

Query: 361 YRFKCDTQKE-LXXXXXXXXXXXXXXVSTSSPNKISTTPQ-----RRKNRESIISVTSSR 414
            RFK DT+ + +              V   +  K  + PQ     +R+NR S+ISV+SS 
Sbjct: 363 DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSH 422

Query: 415 KKPIXXXXXXXXXX--XXXXXXXXXXXXRLSKNFSSKKRLSTI-VNQASPTPASRNKRTS 471
           K+P+                        R+S N SS KRLS +  N  SPTPASR+KR S
Sbjct: 423 KRPVSFNKLSNVVSPGSVPSSNSNTPSKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVS 482

Query: 472 IINVDKNQRRASV---------FXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAK 522
           I+++++ +   +          +               LS  PS KR S+TTKL+STYAK
Sbjct: 483 IVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYAK 542

Query: 523 LAADDDWEYIEKETKRTSSNFATLID 548
           L+ DDDWEYIEKETKRTSS+FATL D
Sbjct: 543 LSEDDDWEYIEKETKRTSSDFATLCD 568

 Score =  365 bits (938), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 232/520 (44%), Positives = 312/520 (60%), Gaps = 47/520 (9%)

Query: 634  NIRSISAPMESEEKN-INHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAVE 692
            N RS+S P++ +  + +  L+ +ID++LR+R FSLQTRPVSRLDPG+  S   EK+    
Sbjct: 660  NGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTG 719

Query: 693  PKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDP 752
             +  +  +L  +K ILETIRRSKFLGSSF+I KELK +           + + +RI+S  
Sbjct: 720  SE--DRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTT 777

Query: 753  SDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKR 812
            +D+Y + +LPK+A   + L+DH            E RKIS+++VPQFTRKSR F +SNKR
Sbjct: 778  NDEYETQILPKNATASAPLKDHN--------HQAEPRKISDIKVPQFTRKSRQFGDSNKR 829

Query: 813  LSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQR-IPTPKSADDSEFLFETVNEEAEYTG 871
            LSVLSMYSSK+S+TNL D+L   N +    +  R  P  +S  + EFLFE V E+ E TG
Sbjct: 830  LSVLSMYSSKQSYTNLADLL---NEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTG 886

Query: 872  NSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKET---ENLHLPTLPPLNGGDEVN 928
            +SS+D RLY+V + +   K  LKLNFADRF  S  E  T   +N+ LPTLPPL+G     
Sbjct: 887  DSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDG----- 941

Query: 929  KQKDEDVLGI------------QPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDA 976
              K+   LGI            Q  VKSMI Q+D +  +                +E +A
Sbjct: 942  --KEAKGLGIYQSSSESLPEPAQHNVKSMI-QNDENQPSETAEVLSI--------KEDNA 990

Query: 977  KGAKDIEPPLNKSVQKTRANDSGPQVKSHPRE-PKKDRNISGNGXXXXXXXXXXXXXXXV 1035
            +  +  E PLN S+ K R + +    +   +E  +K RN S                   
Sbjct: 991  QVERQQEAPLNASIPKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDA 1050

Query: 1036 ELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISI 1095
            ELYA V+AKQLFNGL+ LL+GW +YGLK +KS P+ LTLTGKLSSENI SLRSTLFE+ +
Sbjct: 1051 ELYASVAAKQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVV 1110

Query: 1096 YPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
            + RGK S+V F+K SG+ K +K+LV+E+E VL KE VL K
Sbjct: 1111 WSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/565 (64%), Positives = 420/565 (74%), Gaps = 31/565 (5%)

Query: 3   VNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSG 62
           +   + P IK + IG WK+GETLGLGSTGKVQLA NK+TG +AA+KVISK +F   N+  
Sbjct: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV-- 59

Query: 63  TSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
           TS+V + TPDALPYGIEREI+IMKLLNH NVLRLYDVWETN++LY+VLEYAEKGELFNLL
Sbjct: 60  TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           VERGPLPENEAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALET
Sbjct: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
           E KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVIL+ALLTGRLPFDEEDGNIR LL
Sbjct: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIR 302
           LKVQ GQFE+P DDE+S+EAQ+LI KIL V+P  RI ARDILKHPLLQKYPSI+DSKSIR
Sbjct: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299

Query: 303 GLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYR 362
            LPREDTYL PL+E+NS+ID  ILQNLV+LWHGRDP  I+ KLKE GANAEKTLYA+L R
Sbjct: 300 NLPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNR 359

Query: 363 FKCDTQKE-------------LXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIIS 409
           FK D ++E                            V+ SS NK +TTP R+KNR S+IS
Sbjct: 360 FKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNK-NTTP-RKKNRASVIS 417

Query: 410 VTSSRKKPIXXXXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIVN------QASPTP 463
           VTSS K+PI                            + +KRLS I          SPTP
Sbjct: 418 VTSSHKRPISFQKLPTLNSTSSLAAITPSTS------ARRKRLSKISGYPVSNVNGSPTP 471

Query: 464 ASRNKRTSIINVDKNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKL 523
           ASR KR S+ N+     R+S                 +S++P+ K  ++ +KL+STYAKL
Sbjct: 472 ASRKKRNSMANIQ--AARSSTIKKTNTFKKNNRASKRVSILPNNKNGTIASKLISTYAKL 529

Query: 524 AADDDWEYIEKETKRTSSNFATLID 548
           + DD+WEY+E+ETKRTSSNFATLID
Sbjct: 530 SEDDEWEYLEQETKRTSSNFATLID 554

 Score =  306 bits (783), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 212/516 (41%), Positives = 289/516 (56%), Gaps = 50/516 (9%)

Query: 636  RSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKR 695
            RS+S P+  ++  +   E+++  +LR+RN +LQTRP SRLDPG+ F S          + 
Sbjct: 638  RSVSEPLNKKQGGV---EIEVKELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQV 694

Query: 696  TENE---RLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDP 752
             E E   +L TEK ILETIRRSKFLGSSF+I KELK +         P R     +++ P
Sbjct: 695  FEGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPGR-----VITAP 749

Query: 753  SDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKR 812
            S+   S VLPK+A   + L  H            E+RKIS+++VPQFTRKSR+FSES+KR
Sbjct: 750  SNLERSDVLPKNAIATAPLRIHS--------DQPEVRKISDIKVPQFTRKSRNFSESSKR 801

Query: 813  LSVLSMYSSKESFTNLVDIL--KNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYT 870
            LSVLSMYS+++SF NL D++  ++ N D  + + Q I TP SA  SEFLFE+VNEEAE T
Sbjct: 802  LSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQ-IATPNSAGQSEFLFESVNEEAENT 860

Query: 871  GNSSNDERLYDVGDSTIKD-KSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDEVNK 929
             N+S D +LY+V +S     K  L++N +DR+N + +E + EN  LP LPPL        
Sbjct: 861  NNTSTDGKLYEVSESPESSSKKGLRVNLSDRYNKANSEADMEN-KLPILPPL-------- 911

Query: 930  QKDEDVLGI-----QPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDAKGA---KD 981
              D ++ G+     QP+  +  PQ   S                 E +  D K     K 
Sbjct: 912  --DPEIAGLGIYQDQPEEVNAKPQEKKSKSKSAETGDISEG----EPEVSDLKAENIRKA 965

Query: 982  IEPPLNK----SVQKTRANDSGPQVKSHPREPKKDRNISGNGXXXXXXXXXXXXXXXVEL 1037
             +PP+ +      +K R ++     K +       R +SG                   +
Sbjct: 966  PQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGI 1025

Query: 1038 YAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYP 1097
            +  VSA Q++ GL  LLRGW  YGLK+IK +  N+T+TGKL+SENI SLRST+FEI I  
Sbjct: 1026 HTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIR 1085

Query: 1098 RGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
             GK S V  KK SG+ KAV +L  EV+NVL KEGV+
Sbjct: 1086 EGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/556 (65%), Positives = 432/556 (77%), Gaps = 15/556 (2%)

Query: 2   AVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMS 61
           A++ N+V  IK+N IGPWKLGETLG GSTGKV LA N++T Q+AAVKVISKAVF A N S
Sbjct: 3   AISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNS 62

Query: 62  GTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
            ++  G  T +ALPY IE+EIIIMKLLNHPNVLRL+DVWETN+DLYLVLEYAEKGELFN+
Sbjct: 63  ESN--GDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119

Query: 122 LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           LVERGPLPENEA+R FRQIIIG+SYCH+LG+VHRDLKPENLLLD+K NIKIADFGMAALE
Sbjct: 120 LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALE 179

Query: 182 TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241
           +E KLLETSCGSPHYAAPEI+SG+PY+GF+SDVWSCGVILFALLTGRLPFDEEDGNIR L
Sbjct: 180 SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239

Query: 242 LLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSI 301
           LLKVQKG+FE+P DDE+++EAQDL+ ++LTVDP +RI  R+ILKHPLLQKYPSI+DS+SI
Sbjct: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299

Query: 302 RGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLY 361
           R LPREDTYL+PL+++NS ID  ILQNLVILWHG+D   I  KL+EPGAN EKTLYALLY
Sbjct: 300 RNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLY 359

Query: 362 RFKCDTQKELXXXXXXXXXXXXXXVSTS----SPNKIST-TPQRRKNRESIISVTSSRKK 416
           RFKCDTQ+E                  S    SP+K  T TPQ++  R SII+  SS K+
Sbjct: 360 RFKCDTQREANRARRQSKIVQRNSTIRSTAPESPSKKKTYTPQKKNKRASIIA--SSSKR 417

Query: 417 PIXXXXXXXXXXXXXXXXXX-XXXXRLSKNFSSKKRLSTIV-NQASPTPASRNKRTSIIN 474
           P+                       R+S N S++KR+S +   + SPT  SR++R+SII 
Sbjct: 418 PVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGTRDSPTKTSRSRRSSIIT 477

Query: 475 VD--KNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWEYI 532
            D   N+ R SV                +SL+P++KR+SVTTKLM+TYAKL+ DDDWEYI
Sbjct: 478 KDFLGNRPRDSVI-SMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYI 536

Query: 533 EKETKRTSSNFATLID 548
           E+ETKRTSS+FATLID
Sbjct: 537 ERETKRTSSDFATLID 552

 Score =  303 bits (777), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 219/530 (41%), Positives = 292/530 (55%), Gaps = 93/530 (17%)

Query: 635  IRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMF-SSPVEKESAV-E 692
             RS+S P+ES+ K I  +E DID ILR R +SLQTRPVSRLDPGI F   P + E  V E
Sbjct: 634  FRSVSEPLESKSKKIEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPE 693

Query: 693  PKRTENERLTTEKKILETIRRSKFLGSSFNIEKELK-----------LSKMEYPSMVP-- 739
                E E   TE+KILETIRRSKFLGSSF+I+KEL+           + K   P  +P  
Sbjct: 694  TVNLEPELEETEQKILETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPET 753

Query: 740  -PQRLSEERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQ 798
             P+ + ++ +  DPS                                  LRKIS+++VPQ
Sbjct: 754  LPKAVEKKNVSMDPS----------------------------------LRKISDIKVPQ 779

Query: 799  FTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEF 858
            FTRKSRHFS SN+RLSVLSMYS+KES++NL DILKNG     K+  Q  PTPKSADDS+ 
Sbjct: 780  FTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNG--PGEKEMIQTAPTPKSADDSDQ 837

Query: 859  LFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNASTN-----EKETENL 913
            LF+T++E A+   + S +ERLY+V + +  + +  K++ AD  N+  +     E++ +++
Sbjct: 838  LFDTIDE-ADTPASVSREERLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSM 896

Query: 914  HLPTLPPLNGGDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQE 973
             LP LPPL       + K++         KSMIP++  SS                E Q+
Sbjct: 897  KLPKLPPLFEDGSTKETKEQS--------KSMIPENMQSS----------------ESQK 932

Query: 974  KDAKGAKDIEPPLNKSVQKTR-ANDSG-----PQVK----SHPREPKKDRNISGNGXXXX 1023
            +  K   D    LN  + K R  +D G     P V     S      K RN+S       
Sbjct: 933  QIEKNNSDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSF-LRKLS 991

Query: 1024 XXXXXXXXXXXVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENI 1083
                       V L   VS+KQLF+GL  LL+GWT+YGLK I     + T+TGKL+++NI
Sbjct: 992  KGSSSSKDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNI 1051

Query: 1084 FSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
             S RST F I I+ + K S V F+KVSG+ KAV++L +EV+ VLSKEGVL
Sbjct: 1052 LSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/563 (64%), Positives = 425/563 (75%), Gaps = 26/563 (4%)

Query: 10  AIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSI 69
           ++K +TIGPWKLGETLGLGSTGKVQLA N+ST Q+AA+KVISK+VF++  M   S + S 
Sbjct: 10  SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSS--MGNNSSMVSS 67

Query: 70  TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129
           TPD+L YGIEREIIIMKLLNHPNVLRLYDVWETN +LY+VLEYAEKGELFNLLVE+GPLP
Sbjct: 68  TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127

Query: 130 ENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLET 189
           ENEAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETE KLLET
Sbjct: 128 ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187

Query: 190 SCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ 249
           SCGSPHYAAPEIVSG+PY G  +DVWSCGVILFALLTGRLPFDEEDGNIR LLLKVQKG+
Sbjct: 188 SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247

Query: 250 FELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDT 309
           FE+P DDE+S+EAQDL+ KIL VDP++RIK+R+ILKHPLLQKYPSI+DSK+IR LPREDT
Sbjct: 248 FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDT 307

Query: 310 YLTPL---SESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCD 366
           YL PL      +++ID TILQNLV+LWHGR+ D I +KL+EPGANAEKTLYALLYRFK D
Sbjct: 308 YLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVD 367

Query: 367 TQKE-LXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIXXXXXXX 425
           +++E L               +  S N  +TTPQ++KNR S+ISV+SS K+P+       
Sbjct: 368 SEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST 427

Query: 426 XXXX-------XXXXXXXXXXXRLSKNFSSKK--RLSTIVNQASPTPASRNKRTSIIN-- 474
                                 R+S + SS K  ++    N  SPTPA RNKR S+ N  
Sbjct: 428 IQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNLE 487

Query: 475 ---------VDKNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAA 525
                    VD  +   +                 LS++P+ KR S+TTK++STYAKL+ 
Sbjct: 488 TSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLSE 547

Query: 526 DDDWEYIEKETKRTSSNFATLID 548
           DDDWE+IEKETKR SS+FATLID
Sbjct: 548 DDDWEFIEKETKRVSSDFATLID 570

 Score =  280 bits (717), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 206/519 (39%), Positives = 291/519 (56%), Gaps = 63/519 (12%)

Query: 634  NIRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSS--PVEKESAV 691
            N+RSIS+P+E    N N  + + D    +R+FSLQTRPVS+LDPGI   S  PV+ E  V
Sbjct: 651  NVRSISSPVE----NGNEAKSEED-ASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIV 705

Query: 692  EPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSK--MEYPSMVPPQRLSEE--- 746
            E +   ++ + ++K ILETIRRSKFLGSSFNI+KELK  K   E   M   Q+   +   
Sbjct: 706  EDEL--DKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSG 763

Query: 747  RIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHF 806
            RIVS+ ++ Y + VLPK+A  +  L+D             E RKIS+++VPQFTRKS+ F
Sbjct: 764  RIVSETNEQYETQVLPKNATAFGALKDDSEEV--------EPRKISDIQVPQFTRKSKLF 815

Query: 807  SESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEE 866
            ++SNKRLSVLS+YSS +S+TNL ++LK G +D+   +       + +++ EF FETV  E
Sbjct: 816  TDSNKRLSVLSIYSSTQSYTNLANVLKEGGVDIGVNEGSN--NVEVSEEPEFQFETVGTE 873

Query: 867  AEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDE 926
             E        E   +   + +   + +KLN+ADRF+ + N  E   + LPTLPPL G D+
Sbjct: 874  IENNKYEEEKEIENE---NNLSQGANIKLNYADRFDTAGNVNE---VKLPTLPPL-GDDK 926

Query: 927  VNKQKDEDVLGIQPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDAKGAKDIEP-- 984
            V+     D LGI             SS +             +E++ ++    K++EP  
Sbjct: 927  VS-----DGLGIY------------SSKSGSEGNESKPVPSIKENKSEETLKEKNVEPKP 969

Query: 985  PLNKSVQKTR--------ANDSGPQVKSHPREPKKDRNISGNGXXXXXXXXXXXXXXXVE 1036
            PLN  V KTR         N++       PR     R IS                  V+
Sbjct: 970  PLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKIS-----KGLTVQNDTTGYDVK 1024

Query: 1037 LYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIY 1096
            L++ VS  QL+NGL  LL+GW  YGLK IKS+    +++ +LSS+NI SLRST  ++ ++
Sbjct: 1025 LFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVF 1084

Query: 1097 PRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
              GK SV+ F+K SG+ K +K+L +EVE VL KEGVL K
Sbjct: 1085 SEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/575 (63%), Positives = 429/575 (74%), Gaps = 34/575 (5%)

Query: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAG-N 59
           +A N  ++P IK +TIGPWKLGETLGLGSTGKVQLA N++T Q+AA+K+ISK++FN   N
Sbjct: 4   LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63

Query: 60  MSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
            + TS+V + TPD+LPYGIEREIIIMKLL H NVL LYDVWETN++LY++LEYAEKGELF
Sbjct: 64  SNETSMVAN-TPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELF 122

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           NLLVE+GPLPE EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAA
Sbjct: 123 NLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 182

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           LETE KLLETSCGSPHYAAPEIVSGIPY GF SDVWSCGVILFALLTGRLPFDEEDGNIR
Sbjct: 183 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIR 242

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSK 299
            LLLKVQ GQFE+P DDE+SR+AQDLI +ILTVDP +RIK R+ILKHPLLQKYPSI+DSK
Sbjct: 243 NLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSK 302

Query: 300 SIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYAL 359
           SI+ LPREDTYL PLS++NS ID +ILQNLV+LWHGRD + I  KLKE GANAEKT+YAL
Sbjct: 303 SIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYAL 362

Query: 360 LYRFKCDTQKELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIX 419
           LYRFK + +                  ST++     +TP R+KNR S +SV+SSRK+P+ 
Sbjct: 363 LYRFKIEAENLSAKQEQVKRKQSIIKKSTAN----VSTPPRKKNRISTMSVSSSRKRPVS 418

Query: 420 XXXXXXXXXXXX------------XXXXXXXXXRLSKNFSSKKRLSTIV-------NQAS 460
                                            RLS N SS KRLS ++       N  S
Sbjct: 419 FNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHSNGNSNS 478

Query: 461 PTPASRNKRTSIINVDKNQRRASV-------FXXXXXXXXXXXXXXXLSLIPSMKRESVT 513
           PTP SR+KR S+IN+D N     +       +               L+ + + KR S+T
Sbjct: 479 PTP-SRSKRISLINLD-NSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGNGKRGSIT 536

Query: 514 TKLMSTYAKLAADDDWEYIEKETKRTSSNFATLID 548
           TKL+STYAKL+ DD+WEYIEKETKRTSS+FATLID
Sbjct: 537 TKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLID 571

 Score =  286 bits (732), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 206/519 (39%), Positives = 287/519 (55%), Gaps = 71/519 (13%)

Query: 631  PDGNIRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESA 690
            P  N RS+SAP+E E  N   +E DI+++  RRN SLQTRP SRLDPGI++S+P E  + 
Sbjct: 652  PYENPRSVSAPLERE--NPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAE--TV 707

Query: 691  VEPKRTE-NERLTTEKKILETIRRSKFLGSSFNIEKELKLSK----MEYPSMVPPQRLSE 745
              P  ++ ++ +  EKKILETIRRS+FLGSS+NI KEL+ +K     E        +++ 
Sbjct: 708  SNPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKVTS 767

Query: 746  ERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRH 805
            + IV+D           K A G   L D          +   LRKISE++VPQFTRKSRH
Sbjct: 768  QNIVAD-----------KAAIGVIPLND----------TEAGLRKISEIKVPQFTRKSRH 806

Query: 806  FSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNE 865
            FS SN+RLSVLSMYS+K+S+TNL DILK G +++   ++    T K++ + EF FE+VNE
Sbjct: 807  FSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNL-ASEANNTTTSKASTEPEFQFESVNE 865

Query: 866  EAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPL---- 921
                T N     +LY++ +    +     +N  D        K  +N+ LPTLPPL    
Sbjct: 866  G---TAN-----KLYELQE----EPEYTDVNKEDG-------KPKKNVKLPTLPPLHEKT 906

Query: 922  ---NGGDEVNKQKDEDVLGI--QPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDA 976
               NG        D+D      QPK +SMIP+   S +                  E ++
Sbjct: 907  NQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVV-------EPES 959

Query: 977  KGAKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNIS--GNGXXXXXXXXXXXXXXX 1034
            +  K I  P  K  Q  +  +  P +   P   +K RN+S                    
Sbjct: 960  QATKKINKP--KQRQPKKEEERKP-LNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFD 1016

Query: 1035 VELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEIS 1094
             E+Y  VSA QL+ GL +LL+GW++YGLK++KS  N + LTGKLS++NI SLRST+FE+ 
Sbjct: 1017 YEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMI 1076

Query: 1095 IYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
            +  +GK SVV F K+SG+ K V++L  E+E VL +EGVL
Sbjct: 1077 VESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/562 (64%), Positives = 409/562 (72%), Gaps = 17/562 (3%)

Query: 2   AVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMS 61
            +N  S P ++ + +GPWKLGETLG GSTGKVQLA N+ T Q AAVK ISKA+F+A    
Sbjct: 3   GMNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAP 62

Query: 62  GTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
           G S + + TPD LPYGIEREIIIMKLLNHPNVLRLYDVWETN  LY+VLEYAEKGELFNL
Sbjct: 63  GNSSIAASTPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNL 122

Query: 122 LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           LVE GPLPENEA+ FFRQIIIGVSYCHALGIVHRDLKPENLLLDH  NIKIADFGMAALE
Sbjct: 123 LVENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALE 182

Query: 182 TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241
           TE KLLETSCGSPHYAAPEIVSGIPY GFASD+WSCGVI FALLTGRLPFDEEDGNIR L
Sbjct: 183 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNL 242

Query: 242 LLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSI 301
           LLKVQ G+FE+P DDE+S EAQDL+ KILTVDP+ RIK R+ILKHPLLQKYP++ D+KSI
Sbjct: 243 LLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSI 302

Query: 302 RGLPREDTYLTPLSESNSS-IDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
           R LPREDTYL PLS+S SS +D  ILQNLV+LWHGR    I  KLK+PGANAEKTLYALL
Sbjct: 303 RNLPREDTYLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALL 362

Query: 361 YRFKCDTQKELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIX- 419
            RFK DT++E                     N    +P++R NR S I+ +SS K+P+  
Sbjct: 363 ARFKNDTEREAARQKQIKKRSSLNGTGAGVNNN-HVSPKKR-NRASTINASSSHKRPVSL 420

Query: 420 ---XXXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIVNQ---ASPTPASRNKRTSII 473
                                   R+S N SS KRLST+  Q    SPTPASR+KR SII
Sbjct: 421 IKLSGSSNSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTVKTQGNGGSPTPASRSKRVSII 480

Query: 474 NVDKNQRRASV-------FXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAAD 526
             DKN     V       +               LS  P+ KR SVTTKL+STYAKL+ +
Sbjct: 481 ESDKNGGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSVTTKLISTYAKLSEE 540

Query: 527 DDWEYIEKETKRTSSNFATLID 548
           DDWEYIEKETKRTSS+FATLID
Sbjct: 541 DDWEYIEKETKRTSSDFATLID 562

 Score =  311 bits (797), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 227/573 (39%), Positives = 312/573 (54%), Gaps = 92/573 (16%)

Query: 631  PDGNIRSISAPMESEEKN-INHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKES 689
            P+G +RS+SAP+E ++++ + +++ DI+ I  +R  SLQTRPVSRLDPG+ ++   E+ +
Sbjct: 641  PNG-VRSVSAPLERKKRDSMVNVQSDIEEIFGQRTMSLQTRPVSRLDPGLFYA---EESN 696

Query: 690  AVEPKRTENER-LTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERI 748
              E   TE E+ L T+K ILETIRRSKFLGSSF+I KEL+  +++  +  P +    +R 
Sbjct: 697  EPEAGDTEEEKKLRTQKNILETIRRSKFLGSSFDIGKELQNEELKKKASQPHR----DRT 752

Query: 749  VSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSE 808
            VS  ++ Y + VLP  A   + L D             E RKISE+ VPQFTRKSR FS+
Sbjct: 753  VSQTNEPYDTRVLPTQAVATAPLRDQ------------EPRKISEISVPQFTRKSRFFSD 800

Query: 809  SNKRLSVLSMYSSKESFTNLVDILKNGNI-DVHKQQSQRIPTPKSADDSEFLFETVNEEA 867
            SNKRLSVLSMYS+K S+ NL ++L + +  D     +      K   + EF FE V E +
Sbjct: 801  SNKRLSVLSMYSTKHSYNNLSNLLNDSDASDGRLNSAAEYSDVKGKKEPEFQFEAVREAS 860

Query: 868  EYTGN----SSNDERLYDVGDST---------IKDKSALKLNFADRFNA-------STNE 907
            +        S+NDERL +V  ++         +  K  +KLNFADRF+A       S + 
Sbjct: 861  DEDNGISRLSNNDERLRNVSGTSGGSGVPHDNLSSKHNMKLNFADRFSADEPTAGSSNSS 920

Query: 908  KETENLHLPTLPPLNGGDEVN--------------------------------KQKDEDV 935
              ++N+ LPTLPPL+G  E N                                ++ +E+V
Sbjct: 921  SASKNVKLPTLPPLDGTSEANGLGIYQSSSESFRDIVEPTPKSKLQDNSSNPEQEVEEEV 980

Query: 936  LGIQPKVK-SMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDAKGAKDIEPPLNKSVQKTR 994
             G +  VK S I   D++S                  QE  A       PPLN S+ K R
Sbjct: 981  AGREGSVKHSAI---DTASKERSKRTDRIDAKKPSSFQENLASAGASKGPPLNDSMPKRR 1037

Query: 995  AND----SGPQVKSHPREPKKD--------RNISGNGXXXXXXXXXXXXXXXVELYAKVS 1042
              D    S      + R P KD        RN+S                   E+   VS
Sbjct: 1038 NEDPRNGSTAAKGENGRAPLKDITTNSDKKRNVSF-FRKFSKSNEKDTTGFDGEINTTVS 1096

Query: 1043 AKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMS 1102
            AKQLF GL+ LL GWTQYGLK+++SHP  +TLTGKL+SENI SLRSTLFE+ ++ RGK+S
Sbjct: 1097 AKQLFLGLQNLLHGWTQYGLKDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVWSRGKVS 1156

Query: 1103 VVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
            VV F+K SG+ KA+++LV+EVE VL KEGV+ K
Sbjct: 1157 VVGFRKKSGSSKAMRRLVSEVEKVLLKEGVISK 1189

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/558 (63%), Positives = 417/558 (74%), Gaps = 21/558 (3%)

Query: 3   VNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSG 62
           +NGN +  +K +TIGPWKLG TLG+GSTGKV +A N++ GQ+AAVK+ISK++FNA    G
Sbjct: 1   MNGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNA---QG 57

Query: 63  TSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
           ++++G   PD LPYGIEREIIIMKLLNHPNVLRLYDVWET+ DLY+VLEY EKGELFNLL
Sbjct: 58  STMIGGNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLL 117

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           VERGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+N+K+ADFGMAALE+
Sbjct: 118 VERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALES 177

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
           + KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIR LL
Sbjct: 178 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLL 237

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIR 302
           LKVQ G+FE+P DDE+S EAQDLI +ILTVDP++RIK R+ILKHPLL+KYPSI+DSKSIR
Sbjct: 238 LKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIR 297

Query: 303 GLPREDTYLTPLS--ESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
            LPREDTYL PLS    N  +D TILQNLV+LWHGR+ + I  KL EPGAN EKT YALL
Sbjct: 298 NLPREDTYLNPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALL 357

Query: 361 YRFKCDT------QKELXXXXXXXXXXXXXXVSTSSPNKIS---TTPQRRKNRESIISVT 411
           +RFK D       Q+EL               S  SPNK     TTP  +K R SII  +
Sbjct: 358 HRFKHDNYQDQLKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTP--KKKRTSIIVAS 415

Query: 412 SSRKKPIXXXXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIV-NQASPTPASRNKRT 470
           SS K+P+                      RLSK F S KR+S +V N +SPTPA+ +KR 
Sbjct: 416 SSHKRPV--SMQKLSSQHSSPVKNGSIGKRLSKTFPSNKRISQLVSNSSSPTPAA-HKRV 472

Query: 471 SIINVDKNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWE 530
           S IN D                         SL+P+MKR S+TTKL++TYAKL+ D +WE
Sbjct: 473 SRIN-DSAAPPVPKEMLRDYKRQSKRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWE 531

Query: 531 YIEKETKRTSSNFATLID 548
           YIEKETKRTS +FATL+D
Sbjct: 532 YIEKETKRTSQDFATLMD 549

 Score =  257 bits (656), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 190/510 (37%), Positives = 276/510 (54%), Gaps = 48/510 (9%)

Query: 633  GNIRSISAPMESEEK-----NINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEK 687
             N RS+SAP+E++       +   ++ DI+ ++  RNFSLQTRPVSRLDPGI     +  
Sbjct: 638  ANGRSVSAPIETDRTANKRDSTFGIKNDINELINTRNFSLQTRPVSRLDPGI-----IAA 692

Query: 688  ESAVEPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEER 747
            ES +     E+++ + EK ILETIRRSKFLGS FN+  EL+ ++ +   +V  +R  + R
Sbjct: 693  ESRLSAN-LEDDQASKEKTILETIRRSKFLGSQFNLNVELEKAQKD---LVSKERQEQLR 748

Query: 748  IVSDPSDDYGSLVLPKDARGYSQL-EDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHF 806
              S+ +  Y    LPK+A+  + L +D + P           RK+SEV+VPQFTR+S+HF
Sbjct: 749  KYSEQTAKYEVQKLPKNAKAVATLRDDEVEP-----------RKLSEVKVPQFTRRSKHF 797

Query: 807  SESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEE 866
            S SNKR SVLS+YS+K SFTNLVD LKN N            + K A + EF+FETV E 
Sbjct: 798  SSSNKRFSVLSLYSTKTSFTNLVDHLKNDNYLEPLPGQPEYSSSKVAQEPEFMFETVEEL 857

Query: 867  AEYTGNSSNDERLYDVGDSTI-KDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGD 925
             E       + +L++V ++   K  SA +    D    STN+K+   ++LP+LPPL    
Sbjct: 858  DE-------NSKLFEVPETEEGKLASAARKESTDARKQSTNDKD---INLPSLPPLQVSH 907

Query: 926  EVNKQKDEDVLGI-QPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDAKGAKDIEP 984
            +V  +     LGI QP  ++  P                     R +  K        +P
Sbjct: 908  DVADENGALGLGIYQPNDQTQKPHKTMLIDESIDENISSTSDVSRTEVVK--------KP 959

Query: 985  PLNKSVQKTRANDSGPQVKSHPREPKKDRNISGNGXXXXXXXXXXXXXXXVELYAKVSAK 1044
            PLN  V+K   N+  P  +  P+   K +                      +L A VSA 
Sbjct: 960  PLNDVVRKNN-NERKPLEEITPKVENKRKISFFRKFSQGSEKKLGPESFDSQLKAGVSAP 1018

Query: 1045 QLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYP-RGKMSV 1103
            +++  L++LL  WT YGLK+++S PN+  ++GKL+S+NI SLRST F+I++ P  G  S+
Sbjct: 1019 KMYKALDRLLNEWTNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNGSI 1078

Query: 1104 VQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
            +QF K SG+ K   +LV E+E +L KE VL
Sbjct: 1079 IQFTKKSGSTKTFNRLVKEIEKILEKEKVL 1108

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/558 (63%), Positives = 422/558 (75%), Gaps = 50/558 (8%)

Query: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSIT 70
           +K +TIGPWKLG+TLGLGSTGKV+LA N++T Q+AA+K+ISK++F+ G +  +S+V + +
Sbjct: 10  MKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQGTVGESSMVSNSS 69

Query: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130
           PDALPYGIEREIIIMKLL HPNVL LYDVWETN+ LY++LEYAEKGELFNLLVERGPLPE
Sbjct: 70  PDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLPE 129

Query: 131 NEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190
            EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK NIKIADFGMAALET+ K+LETS
Sbjct: 130 KEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLETS 189

Query: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQF 250
           CGSPHYAAPEIVSG+PY GF SDVWSCGVILFALLTGRLPFDEEDGNIR LLLKVQ G++
Sbjct: 190 CGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEY 249

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTY 310
           E+P DDE+S+EAQDLI +ILTVDP++RIK RDILKHPLLQKYPSI+DS+SI+ LPREDTY
Sbjct: 250 EMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDTY 309

Query: 311 LTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQKE 370
           L PLSE+NS ID +ILQNLV LWHGRD D I  KL+E GA+AEKT+YALLYRFK + +K 
Sbjct: 310 LYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEAEK- 368

Query: 371 LXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIXXXXXXXXXXXX 430
                           + SSP        RRKNR S+ISV+SS K+P+            
Sbjct: 369 --------------MNTCSSP--------RRKNRISMISVSSSHKRPVSMKKISTVQNNT 406

Query: 431 XXXXXXXXXXRLSKNFSS--KKRLSTIVNQ--ASPTPASRNKRTSIINVDKNQRRA---- 482
                     RLS + SS  +KR+S I+    +SPTP SR KR S+IN+D ++ +A    
Sbjct: 407 PPSNR-----RLSISLSSTQRKRMSGILQHTNSSPTP-SRTKRISVINIDDSENKAPPPV 460

Query: 483 ------------SVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWE 530
                                         L+L+ + KR S+TTKL+STYAKL+ DD+WE
Sbjct: 461 PMEMLEDYKNNSKNVRRTIKKKKKKKNNYRLTLV-NNKRVSITTKLLSTYAKLSEDDNWE 519

Query: 531 YIEKETKRTSSNFATLID 548
           YIE+ETKRTSS+FATLID
Sbjct: 520 YIERETKRTSSDFATLID 537

 Score =  241 bits (615), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 189/523 (36%), Positives = 262/523 (50%), Gaps = 127/523 (24%)

Query: 634  NIRSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVE---KESA 690
            N RS+SAP+    K     + + + +  RR FSLQTRPVSRLDPGI++S+P E    E  
Sbjct: 604  NFRSVSAPI----KENEDEDENENELRNRRQFSLQTRPVSRLDPGILYSAPAEIPSYERV 659

Query: 691  VEPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVS 750
            V  +         ++KILETIRRSKFLGSSFNI++EL+ S+     +VP    ++E++V 
Sbjct: 660  VVNESGNKSSAQQQRKILETIRRSKFLGSSFNIQQELEFSQRNV--LVP----TKEQVV- 712

Query: 751  DPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESN 810
                D   + L                        G LRKISEV++PQFTRKSRHFS+SN
Sbjct: 713  ----DVDEVKL-----------------------EGGLRKISEVKIPQFTRKSRHFSDSN 745

Query: 811  KRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYT 870
            KRLSVLSMYS+K+S+TNL  ILK+G      ++S+  P  K+    E LFE         
Sbjct: 746  KRLSVLSMYSTKQSYTNLGHILKDGT-----EESE--PAKKTP---ELLFE--------- 786

Query: 871  GNSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDEVNKQ 930
              S  D+RLY+V +                      +++ E + LP LPPL      N  
Sbjct: 787  --SGRDDRLYEVSEEP---------------EIQEEKEDIETVTLPQLPPLKQSANTNAN 829

Query: 931  KDE---------------DVLGIQPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKD 975
             +E               ++  I  +VK +IP                      +D  KD
Sbjct: 830  ANETEINGLAIFRPKENIELEDITKEVKEVIPS---------------------QDHGKD 868

Query: 976  AKGAKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKD----RNISGNGXXXXXXXXXXXX 1031
               A +  P     V+  R  D     K    E K++    R  S N             
Sbjct: 869  KPIAIN-NPKQRLEVKPERQLDEIAPNKVGTTEKKRNVSFFRKFSNNSATIKGYDH---- 923

Query: 1032 XXXVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLF 1091
                E+Y  + ++QL+ GL KLL GWTQYGLK+++S    + +TGKL+++NI SLRSTLF
Sbjct: 924  ----EIYVNIGSRQLYTGLRKLLEGWTQYGLKDVRSDNTAMKITGKLANDNILSLRSTLF 979

Query: 1092 EISIYPRG-KMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
            E+ + P+G K S++ F KV G+ K V++L  E+E VL+KEGVL
Sbjct: 980  ELLVEPKGSKYSLIGFTKVQGSSKVVRRLFTEIEKVLNKEGVL 1022

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/566 (61%), Positives = 417/566 (73%), Gaps = 27/566 (4%)

Query: 2   AVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMS 61
           +V  +++  +K + IGPWKLG TLG GSTGKV +A+++STGQ+AAVK++SK++F  GN S
Sbjct: 9   SVVKSTLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIF--GNQS 66

Query: 62  GTS-IVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
            +S IVGS  PD LPYGIEREIIIMKLLNHPNVLRLYDVWETN+ LY+VLEY EKGELFN
Sbjct: 67  NSSTIVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFN 126

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLV+RGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAAL
Sbjct: 127 LLVDRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 186

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
           E++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCG+ILFALLTGRLPFDEEDGNIR 
Sbjct: 187 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRN 246

Query: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300
           LLLKVQ G+FE+P  +E+S EAQDLI KILTVDP  RIK+R ILKHPLLQKYPSI+DSKS
Sbjct: 247 LLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKS 306

Query: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
           IR LPREDTYL PL   + +ID TI+ NLV+LWHGRD + I  KLKEPGAN EKT YALL
Sbjct: 307 IRNLPREDTYLNPLDSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALL 366

Query: 361 YRFKCDTQKELXXXXXXXXXXXXXXVST-----SSPNKISTTPQRRKNRESIISVTSSRK 415
           +RFK D+Q+E                 T     +S   I++T  ++K R  +IS +SS K
Sbjct: 367 FRFKHDSQQEQLKQQRRSQAMQVSPKKTGLRKSNSRRSINSTTPKKKTRAPVISASSSHK 426

Query: 416 KPIXXXXXXXXXXXXXXXXX-XXXXXRLSKNFSSKKRLSTIVN-QASPTPASRNKRTSII 473
           +P+                       R S N SS KR+S ++N  +SPTPAS  KR S+ 
Sbjct: 427 RPVSFSRLSYSNGSNTDHNTPNSSGKRSSVNLSSNKRISALINPNSSPTPAS--KRASLR 484

Query: 474 NVD-----------KNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAK 522
            +D           K+  +A+                 LS +P  KR S+TTKL++TYAK
Sbjct: 485 ELDPSAPPIPVDMLKDYNKAA----PKANRKSSRISKRLSFLPGNKRGSITTKLIATYAK 540

Query: 523 LAADDDWEYIEKETKRTSSNFATLID 548
           ++ D+DWEYIEKETKRTS++FATL D
Sbjct: 541 ISEDNDWEYIEKETKRTSADFATLCD 566

 Score =  279 bits (713), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 203/531 (38%), Positives = 276/531 (51%), Gaps = 61/531 (11%)

Query: 636  RSISAPMES-----EEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESA 690
            RS+SAP+ES     +  +++ L+ DI ++L RR FSL+TRP SRLDPGI     V     
Sbjct: 658  RSVSAPVESVLKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGIYTLEEVPNSDI 717

Query: 691  VEPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKM--EYPSMVPPQRLSEERI 748
             +  R     L TEK ILETIRRSKFLGSSF+I KEL   +   E  +    QR  E+R+
Sbjct: 718  KDGGRD----LKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQRKKEDRV 773

Query: 749  VSDPSDDYGS-----LVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKS 803
            VS+ + +Y         LPK+A       D          +  + RKISEV+VPQFTR+S
Sbjct: 774  VSNATGNYSENGYEPQTLPKNAAATKISND----------AGSDPRKISEVQVPQFTRRS 823

Query: 804  RHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETV 863
            RHF+ SNKRLSVLSMYS+K SFTNL D L+ G  D+         T +   ++EF+FE+V
Sbjct: 824  RHFTASNKRLSVLSMYSTKASFTNLADHLR-GKTDLQSINGSPPSTSRMEPETEFMFESV 882

Query: 864  NEEAEYTGNSSNDERLYDVG---DSTIKDKSALKLNFADRFNASTNE-----KETENLHL 915
            + E + T ++S D RLY+V    D     +SA++LNFADRFN  T+      ++   + L
Sbjct: 883  DGEGKETADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGIKL 942

Query: 916  PTLPPLNGG--DEVNK------QKDEDVLGIQPKVKSMIPQSDSSSHTXXXXXXXXXXXX 967
            P+LPPL+    D VN         D     I  + KSMIP                    
Sbjct: 943  PSLPPLDKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIP--------VDAEQKEAAEAK 994

Query: 968  XREDQEKDAKGAKDIEPPLNKSVQKTRANDSGPQVKSHPREPKKD-----RNISGNGXXX 1022
              E ++   K  +    PLNK ++K    +     +  P   KK+     R  SG     
Sbjct: 995  PEEQKQVPPKDVESAPAPLNKVMKKNTEAEKNQPNQPAPNAVKKNNKSFFRRFSGKSDDE 1054

Query: 1023 XXXXXXXXXXXXVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSEN 1082
                        V     +   Q+FN L KLL  W  YGLK++ + P+   + GK+SS+N
Sbjct: 1055 KRPGEYDFKFDTV-----IEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDN 1109

Query: 1083 IFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
            + SLRSTLFEISI  +G+ S+V F K SG+ K  KKLV E+E +L  +  L
Sbjct: 1110 MLSLRSTLFEISIVSKGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKKAL 1160

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/575 (61%), Positives = 412/575 (71%), Gaps = 36/575 (6%)

Query: 10  AIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIV--- 66
            +  N IGPWKLGETLG GSTGKVQLA N+ T Q+AA+K+ISK+VF+    S  +     
Sbjct: 10  TVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNSAL 69

Query: 67  -------GSI--TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGE 117
                  GS+    +ALPYGIEREIIIMKLLNH NVLRLYDVWETN +LY+VLEYAEKGE
Sbjct: 70  AASDVNNGSVQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEKGE 129

Query: 118 LFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGM 177
           LFNLLVE+GPL ENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGM
Sbjct: 130 LFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFGM 189

Query: 178 AALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN 237
           AALETE KLLETSCGSPHYAAPEIVSG+PY G  +D+WSCGVILFALLTGRLPFDEEDGN
Sbjct: 190 AALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDEEDGN 249

Query: 238 IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRD 297
           IR LLLKVQKG+FE+P  DE+S EAQDLI KILTV+PK+RIK R+ILKHPLLQKYP+I+D
Sbjct: 250 IRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPNIKD 309

Query: 298 SKSIRGLPREDTYLTPLSESN---SSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEK 354
           SK+IR LPREDTYL PL+++N   + ID +ILQNL +LWHG+D + I +KLKEPGANAEK
Sbjct: 310 SKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGANAEK 369

Query: 355 TLYALLYRFKCDTQKELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSR 414
           TLY LL+RFK DT++E                S+SS +     P+RRKNR S+ISVTSS 
Sbjct: 370 TLYVLLHRFKEDTERENHKNSQLRKRQSLMKASSSSSSNQGNVPRRRKNRNSMISVTSSH 429

Query: 415 KKPIXXXXXXXXXXXX--------XXXXXXXXXXRLSKNFSSKK----RLSTIVNQASPT 462
           KKP+                              R+S + SS      RL T  N +SPT
Sbjct: 430 KKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLSSSNKRNSRLYTQSNSSSPT 489

Query: 463 PASRNKRTSIINVDKNQRRA-----SVFXXXXXXXXXXXXXXXLS----LIPSMKRESVT 513
           PA R++R+S  N+   +  A      V                LS     + + KR SVT
Sbjct: 490 PAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQNKRGSRLSKRYSFLLNNKRGSVT 549

Query: 514 TKLMSTYAKLAADDDWEYIEKETKRTSSNFATLID 548
           TK+MSTYAKLA DDDWE+IEKETKR SS+FATLID
Sbjct: 550 TKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLID 584

 Score =  253 bits (647), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 197/500 (39%), Positives = 267/500 (53%), Gaps = 80/500 (16%)

Query: 662  RRNFSLQTRPVSRLDPGIMFS--SPVEKESAVEPKRTENERLTTEKKILETIRRSKFLGS 719
            +RNFSLQTRP+SRLDPG+MFS    V+  S+V+    EN  +  +K ILETIRRSKFLGS
Sbjct: 692  QRNFSLQTRPISRLDPGLMFSKLGDVDNNSSVD----ENLTMNNQKTILETIRRSKFLGS 747

Query: 720  SFNIEKELKLSKMEYPSMVPPQ-----RLSE-ERIVSDPSDDYGSLVLPKDARGYSQLED 773
            SF+I KEL  +  E   +   Q      L E ERI S       + VL K+A G   L+D
Sbjct: 748  SFDINKELNNANEERKRLRQLQLQKQKELEEKERIASTSYVSNENQVLSKNAIGVVDLKD 807

Query: 774  HIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILK 833
                      S+ E RKISEV+VPQFTRKS++FSESNKRLSVLS YSSK+S+TNLVD++K
Sbjct: 808  --------FSSDVEPRKISEVQVPQFTRKSKYFSESNKRLSVLSFYSSKQSYTNLVDMIK 859

Query: 834  NGNIDVHKQQSQRIPTPKSADDSEFLFETVN----EEAEYTGNSSNDERLYDVGDSTI-- 887
               ++               +D  F FE       EE        +DE   +V D     
Sbjct: 860  ENPVE----------DEDVTEDPGFNFEDSQYDYLEEKNEAPLEVSDEVPKEVDDKVQEE 909

Query: 888  -KDKSALKLNFADRF-NASTNEKETENLH--LPTLPPLNGGDEVN-KQKDEDVLGIQPK- 941
             K+  ++KLNFADRF N ++N K+  +     P +   +G + +    K+E     +PK 
Sbjct: 910  EKNSVSMKLNFADRFSNVNSNTKQESSFEDKFPNILSKSGTEGLGLYSKNEKT---EPKP 966

Query: 942  VKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDAKGAKDIEPPLNKSVQKTRANDSGPQ 1001
            VKSMIP+ D  + +                          +E PLNK V KTRA +    
Sbjct: 967  VKSMIPEEDKVNSSPV------------------------VEAPLNKVVNKTRAEN---- 998

Query: 1002 VKSHPREPKKDRNISGNGX------XXXXXXXXXXXXXXVELYAKVSAKQLFNGLEKLLR 1055
             KS  + P   + +S                        V LY+ V+  QLFNGL+ LL+
Sbjct: 999  -KSTSKGPSGSQKVSNTSSFLRKISGKSSNSTVAKGAFEVNLYSSVTETQLFNGLQNLLK 1057

Query: 1056 GWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKA 1115
            GWT YGLK++K       + GKLS++NI SLRST+ E+ ++   K SV+  +K SG+ K 
Sbjct: 1058 GWTNYGLKDVKVDKQKKMIVGKLSNDNILSLRSTIVELCVFTESKFSVIGIRKKSGSSKT 1117

Query: 1116 VKKLVNEVENVLSKEGVLEK 1135
            +++L +E+E VLSKEGVL+K
Sbjct: 1118 MRRLASEIEKVLSKEGVLQK 1137

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/579 (58%), Positives = 407/579 (70%), Gaps = 43/579 (7%)

Query: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNA-GNMSGTSIVGSI 69
           +K++ IGPWKLG  LG GS GKV +A++++TGQ+AAVK++SK++F A    + ++IVGS 
Sbjct: 18  LKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSN 77

Query: 70  TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129
            PD LPYGIEREIIIMKLLNH NVLRLYDVWET ++LY+VLEY EKGELFNLLVERGPLP
Sbjct: 78  DPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPLP 137

Query: 130 ENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLET 189
           ENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++ KLLET
Sbjct: 138 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLET 197

Query: 190 SCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ 249
           SCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDE++GNIR+LLLKVQ G+
Sbjct: 198 SCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQSGE 257

Query: 250 FELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDT 309
           +E+P +DE+S EAQDLI KILTVDP RRIK R+ILKHPLLQKYPSI+DSKSIR LPREDT
Sbjct: 258 YEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPREDT 317

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQK 369
           YL PL   + SID  ILQNLV+LWHGRD + I  KL EPGAN EKT Y LL+RFK D  +
Sbjct: 318 YLNPLDHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRFKHDVHQ 377

Query: 370 ELXXXXXXXXXXXXXXVSTS-------------SPNKISTTPQ----------------- 399
           +                                SP K++                     
Sbjct: 378 QQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITSTSLSGTTTP 437

Query: 400 RRKNRESIISVTSSRKKPIXXXXXXXXXXXXXXXXX-XXXXXRLSKNFSSKKRLSTIVNQ 458
           ++KNR S+ISV+SS K+P+                       R+S + SS KRLS +   
Sbjct: 438 KKKNRVSMISVSSSHKRPVSFNKLSTAGKSDSACGTPGSSTKRMSISLSSSKRLSAMGPN 497

Query: 459 ASPTPASRNKRTSIINVDKN---------QRRASVFXXXXXXXXXXXXXXXLSLIPSMKR 509
            SPTPA  NKR S+ ++D +             S                 LS +P++KR
Sbjct: 498 TSPTPA--NKRMSVRDMDSSAPPVPMDVLNDYTSALPNRKATKRASRASKRLSFLPNIKR 555

Query: 510 ESVTTKLMSTYAKLAADDDWEYIEKETKRTSSNFATLID 548
            S+TTKL++TYAKL+ +DDWEYIEKETKRTS++FATL D
Sbjct: 556 GSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCD 594

 Score =  302 bits (774), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 222/539 (41%), Positives = 287/539 (53%), Gaps = 59/539 (10%)

Query: 636  RSISAPMES-------EEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKE 688
            R +SAP+ S       +  +I  L  DID++L+RR  SLQTRPVSRLDPGI+ +  +   
Sbjct: 691  RCVSAPIASSSAKDDGKRDSIARLSGDIDDLLKRRTVSLQTRPVSRLDPGIVAAENLGSV 750

Query: 689  SAVEPKRTENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQR----LS 744
               E    +   L TEK ILETIRRS+FLGSSF+I+KEL+ ++ +    +  Q     LS
Sbjct: 751  IYEEADGVDETTLRTEKTILETIRRSRFLGSSFDIKKELERAQRKKEEALARQHQQRILS 810

Query: 745  EERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSR 804
                 S  +D Y S  LPK+A     L D   P         E RKISE++VPQFTR+SR
Sbjct: 811  SATAASATNDAYESRALPKNAAAVDTLNDERNP---------EPRKISEIKVPQFTRRSR 861

Query: 805  HFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVN 864
            HF+ SNKRLSVLSMYS+K SFTNL D LK G  D+ +       T K   + EFLFE+V+
Sbjct: 862  HFTASNKRLSVLSMYSTKSSFTNLADHLK-GGADLQEVSGSAPSTTKITQEPEFLFESVH 920

Query: 865  EE-AEYTGNSSNDERLYDVGD----STIKDKSALKLNFADRFNASTNEKETENLHLPTLP 919
            EE +E T +++ D RLY+V D    S    K+A++LNFADRFN    +   + + LP LP
Sbjct: 921  EEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRLNFADRFNTRAGDNPAD-VKLPPLP 979

Query: 920  PLNGGDEVNKQKDEDVLGI------------------QPKVKSMIPQ--SDSSSHTXXXX 959
            PL    E N  K  + LGI                  +PKV SMIP   +  +  T    
Sbjct: 980  PL----EKNGSKKPNGLGIYQSPERPRADPNPTSMVHEPKVFSMIPDDIAGPAKSTKPAE 1035

Query: 960  XXXXXXXXXREDQEKDAKGAKDI----EPPLNKSVQKTRANDSGPQVKSHPREPKKDRNI 1015
                     ++ + K+A  + D     +PPLN  ++K   ND  P     P   KK RN 
Sbjct: 1036 SENVPTSATKKSEPKNALHSADAPEASQPPLNGMMRKN--NDRKPLEDITPAAEKK-RNR 1092

Query: 1016 SGNGXXXXXXXXXXXXXXXVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLT 1075
            S                   +L   V A Q+FN L KLL GW  YGLK ++      T+T
Sbjct: 1093 SFFRKFSRSSEEKKSDNFDAKLNTSVEAVQMFNALGKLLGGWKDYGLKEVRVQGPTKTIT 1152

Query: 1076 GKLSSENIFSLRSTLFEISIY-PRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
            GKLSS+NI SLRST+FEI +     K SVV F K SG+ K  K+LV EVE VL +E VL
Sbjct: 1153 GKLSSDNILSLRSTMFEILVRDDSSKGSVVWFVKKSGSTKTFKRLVKEVEKVLERENVL 1211

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/558 (60%), Positives = 406/558 (72%), Gaps = 27/558 (4%)

Query: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60
           M    N+V +++ + IGPWKLGETLG GSTGKV LA+N  TGQ AAVKVISK+VFNA   
Sbjct: 1   MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNA--- 57

Query: 61  SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
            G++ VGS  PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  DLY+VLEY EKGELFN
Sbjct: 58  QGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFN 117

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLV+RGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAAL
Sbjct: 118 LLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL 177

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
           E++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIR 
Sbjct: 178 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRN 237

Query: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300
           LLLKVQ G++E+P +DE+S EA+DLI +ILTV+P++RIK R+ILKHPLLQKYPSI+DSKS
Sbjct: 238 LLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKS 297

Query: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
           IR LPREDTYL PL  ++ +ID  ILQNLV+LWHGRD + I  KLKEPGAN EKT YALL
Sbjct: 298 IRNLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALL 357

Query: 361 YRFKCDTQ----------KELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISV 410
           +RFK + +          K +               S  S N I +TP  +K R S I+V
Sbjct: 358 HRFKFENEQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTP--KKKRSSAINV 415

Query: 411 TSSRKKPIXXXXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIVNQASPTPASRNKRT 470
           +S+ K+P+                         K   S ++LS ++  ++ +  SR +  
Sbjct: 416 SSAHKRPVSIQKLNDCGTLNPTSPS-------KKRSLSNRKLSAVLAGSNSSSPSRKR-- 466

Query: 471 SIINVDKNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWE 530
             ++V ++                      LS +PS KR S+TTK+++TYAKL+ D+DWE
Sbjct: 467 --MSVGQDAPPVPTAVLRDYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWE 523

Query: 531 YIEKETKRTSSNFATLID 548
           YI++E KRTSS+FATLID
Sbjct: 524 YIDREAKRTSSDFATLID 541

 Score =  171 bits (432), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 135/357 (37%), Positives = 193/357 (54%), Gaps = 63/357 (17%)

Query: 634 NIRSISAPME------SEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEK 687
           ++RSIS PME      S+  +   L+ +I+++L+RR  SL+TRP+SRLDPGI  S   E+
Sbjct: 636 HVRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLS---EE 692

Query: 688 ESAVEPKRTENE-RLTTEKKILETIRRSKFLGSSFNIEKEL---KLSKMEYPSMVPPQ-- 741
            + +E     NE RL  EK ILETIRRSKFLGS ++I+KEL   +  K+E  +M   Q  
Sbjct: 693 NTILEDDLECNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDR 752

Query: 742 -------RLSEERIVSDPS------DDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGEL 788
                     E+R VSD +      +D  S++LPK+      L+D             E 
Sbjct: 753 KLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDE----------ESEP 802

Query: 789 RKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIP 848
           RK+SEV++PQFTR+S+HFS S+KRLSVLSMYS+K S+TNL D L N ++ +   Q     
Sbjct: 803 RKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYL-NNDVQLKSLQPSAPT 861

Query: 849 TPKSADDSEFLFETVNEEAEYTGNSSNDERLYDV-----GDSTIKDKSAL-KLNFADRFN 902
           + K   + EF+FE+  +E  Y   +  D  L        GD    +   L +L+ ++  +
Sbjct: 862 SIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRS 921

Query: 903 ASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGI------------QPKVKSMIP 947
              +E++   + LP LPPL   D +NK    + LGI            QP +KSMIP
Sbjct: 922 KQYSEEDIAKVKLPILPPL---DHLNK---PNGLGIYQAPAPPKEPLGQPVMKSMIP 972

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 1035 VELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEIS 1094
            V+L   V   ++F  L KLL GWT YGLK ++S P + T+TGKLSS+NI SLRST FEI 
Sbjct: 1039 VQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIV 1098

Query: 1095 IYPRGKM-SVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
            I       S V+F K SG+ K   +LVNE+E +L KE VL
Sbjct: 1099 ILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVL 1138

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/559 (60%), Positives = 403/559 (72%), Gaps = 26/559 (4%)

Query: 1   MAVNGNS-VPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGN 59
           M    NS V ++K   IGPW LGETLG+GSTGKV +A+N  TGQ AAVK+ISK++FNA  
Sbjct: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNA-- 58

Query: 60  MSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
             G++ VGS  PD LPYGIEREI IMKLLNHPNVLRLYDVWET+TDLY+VLEY EKGELF
Sbjct: 59  -QGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           NLL+ERGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAA
Sbjct: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           LE++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDE+DGNIR
Sbjct: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSK 299
            LLLKVQ G+FE+P  DE+S EAQDLI KILTVDP  RIK R+ILKHPLL+KYPSI+DSK
Sbjct: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297

Query: 300 SIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYAL 359
           SIR LPREDTYL PL  ++ ++D TIL+NLV+LWHGRD + I  KL E G N EKT YAL
Sbjct: 298 SIRNLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357

Query: 360 LYRFKCDTQ----------KELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIIS 409
           L+RFK + +          K +               S  S N+I  TP  +K R S I+
Sbjct: 358 LHRFKYENEQQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTP--KKKRSSGIN 415

Query: 410 VTSSRKKPIXXXXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTIVNQASPTPASRNKR 469
           V+S+ K+P+                       L     S ++LS I+N  S +P+   KR
Sbjct: 416 VSSAHKRPVSIQKWGEIGGGNNGLISPSKKRSL-----SNRKLSAILNTPSSSPS--RKR 468

Query: 470 TSIINVDKNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDW 529
            SI   D      SV                 S +PS+KR+S+T+K+++TYAKL+ D+DW
Sbjct: 469 MSIAQ-DAPPMPTSVL--RDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDW 525

Query: 530 EYIEKETKRTSSNFATLID 548
           EYI+KE KRTSS+FATLID
Sbjct: 526 EYIDKEAKRTSSDFATLID 544

 Score =  208 bits (529), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 184/540 (34%), Positives = 261/540 (48%), Gaps = 87/540 (16%)

Query: 636  RSISAPME-----SEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESA 690
            RS+S P +     S+  ++  L+  I+ +L +R  S+QTRP+SRLDPGIM +  V  E  
Sbjct: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIM-AQEVAHELD 724

Query: 691  VEPKRTENER-LTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVP---------P 740
             + +   +ER L  EK ILETIRRS FLGS F+I KELK +K E               P
Sbjct: 725  YDDEEILSERTLRREKTILETIRRSNFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKLP 784

Query: 741  QRLS--EERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSN-GELRKISEVRVP 797
             R+S  ++R VSD +    ++    D    + L  H   T G L  +  E +K+SEVR+P
Sbjct: 785  DRISYHDQRFVSDGT----TITSAHDGYDTTSLTRHT--TVGVLRDDESEPKKLSEVRIP 838

Query: 798  QFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSE 857
            + TR+SRH S S+KR SVLSMYS+  S+TNL D +K+   DV  +      + K     E
Sbjct: 839  EVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKS---DVQLKPLNDTASSKVTQQPE 895

Query: 858  FLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRF--------------NA 903
            F+FE+  +  E    SSND     +      + + +KLN+ADRF                
Sbjct: 896  FMFESTIDNVERI--SSNDNS--HISSMEAPNNTVIKLNYADRFYKPVEVIELDDTDNTQ 951

Query: 904  STNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTXXXXXXXX 963
               E++   + LP LPPL   +++NK  +   LGI               H+        
Sbjct: 952  PDTEEDITKVKLPALPPL---EKLNKSPNG--LGIY-------------QHS-------- 985

Query: 964  XXXXXREDQEKDAKGA-----KDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNISG- 1017
                 RED +   +       K+ E P   + QK      G ++    REP  D    G 
Sbjct: 986  ---SPREDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKELGI--REPLTDLAQQGV 1040

Query: 1018 ----NGXXXXXXXXXXXXXXXVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLT 1073
                                  +L   V+  ++F  L+KLL GWT YGLK ++S P+   
Sbjct: 1041 PKKRPSFFRKFSKEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSM 1100

Query: 1074 LTGKLSSENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133
            +TGKLSS+NI SLRST F++ +      S V+F K SG+ K   +LVNE+E +L KE VL
Sbjct: 1101 ITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFARLVNEIEKILEKEKVL 1160

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/502 (65%), Positives = 374/502 (74%), Gaps = 39/502 (7%)

Query: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSIT 70
           +K NT+GPWKLGETLGLGSTGKVQLA N STGQ+AA+KVISKAVFN  N +  S    +T
Sbjct: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDN-ANASDSALLT 70

Query: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130
           PD+LPYGIEREIIIMKLLNHPNVLRLYDVWET+++LY+VLEYAEKGELFNLLVERGPLPE
Sbjct: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130

Query: 131 NEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190
           NEAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE KLLETS
Sbjct: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 190

Query: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQF 250
           CGSPHYAAPEI+SG+PY G  +DVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ GQF
Sbjct: 191 CGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 250

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTY 310
           E+P +DE+SREAQDLI KILTVDPK+RIK R+ILKHPL+QKYPSI+DSK+IR LPREDTY
Sbjct: 251 EMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTY 310

Query: 311 LTPLSESN---SSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDT 367
           L PLS+ N     ID  ILQNLV+LWHGRD   I +KLKEPGANAEKTLYALL RFK DT
Sbjct: 311 LNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370

Query: 368 QKELXXXXXXXXXXXXXXVSTSSPNK------------ISTTPQRRKNRESIISVTSSRK 415
           +KE+               + S  N             +  TP +RKNR S++SV+S+ K
Sbjct: 371 EKEIKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430

Query: 416 KPIX--------------------XXXXXXXXXXXXXXXXXXXXXRLSKNFSSKKRLSTI 455
           +P+                                          R+S N SS KR+S +
Sbjct: 431 RPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQL 490

Query: 456 VN---QASPTPASRNKRTSIIN 474
           +      SPTP++  KR SIIN
Sbjct: 491 LANDLNTSPTPSNCTKRMSIIN 512

 Score =  181 bits (459), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 136/338 (40%), Positives = 192/338 (56%), Gaps = 47/338 (13%)

Query: 636  RSISAPMESEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKR 695
            RS+SAP+E  EK+ +    D     ++RNFSL+TRPVSRLDPG+M+SS     SA  P  
Sbjct: 762  RSVSAPLEKTEKSRDS-PFDYS---KQRNFSLRTRPVSRLDPGLMYSSGT-GSSAYNPSH 816

Query: 696  TENE--------RLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRL---- 743
            +  +        R+ T+K ILETIRRSKFLGSSF+++KEL++ +    + +  Q      
Sbjct: 817  STEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEMVEELESNRIKQQAFQDSH 876

Query: 744  ------------------SEERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSN 785
                              S +RIVS  +D Y + +LPK   G +Q       T G   S+
Sbjct: 877  LEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQ-------TIGLNDSS 929

Query: 786  GELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQ 845
             + R +SE++VPQFTRKS+ FSESNKRLSVLS+YSS+ESFTNLVD+LK   I+V  + ++
Sbjct: 930  VQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINV--EPTE 987

Query: 846  RIPTPKSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNAST 905
            R PT KS  + EFLFE+ + +     +S+ D+ + +  +S     + L+L+F DRFN   
Sbjct: 988  RSPTTKSQ-EPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFNRQL 1046

Query: 906  NEKETENLHLPTLPPLNGGDEVNKQKDEDVLGIQPKVK 943
            + ++TE       P  +  DE  K  D  V    PK K
Sbjct: 1047 STEDTEKTK--NSPSGHIKDEPKKDDDNGVDLSTPKAK 1082

 Score =  120 bits (300), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 1/101 (0%)

Query: 1036 ELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISI 1095
            +L A V+A Q+F GL+ L RGW++YGLKNIKS P +L  TGK+SSENI S +ST+FE+ I
Sbjct: 1291 QLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEI 1350

Query: 1096 YPRG-KMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
                 K  +++FKK SG+ K+V++LVNEVENVL KEGVL K
Sbjct: 1351 ISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391

 Score = 79.3 bits (194), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/47 (76%), Positives = 43/47 (91%)

Query: 502 SLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTSSNFATLID 548
           S+ P+M+R S+TTKL+STYA+LA DDDWE+IEKETKR SSNFATLID
Sbjct: 615 SVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLID 661

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/546 (57%), Positives = 380/546 (69%), Gaps = 53/546 (9%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           +TIGPWKLGETLG+GS GKV+LA+++ T  + AVK+ISK++FN     G    GS+    
Sbjct: 16  STIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNYGNH--GSV---- 69

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LPY IEREI+IMKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+RG LPE EA
Sbjct: 70  LPYNIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREA 129

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
           ++ FRQIII VSYCHALGIVHRDLKPENLLLD  YNIK+ADFGMAAL+T+  LLETSCGS
Sbjct: 130 MKCFRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGS 189

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           PHYAAPEIVSG+PY+GF+SDVWSCGVILFALLTGRLPFDEE+GNIRTLLLKVQ+GQFE+P
Sbjct: 190 PHYAAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMP 249

Query: 254 SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313
            D E+S++AQDLI KIL VDP +RIK RDIL HPLL++Y +I+DSKSI+ LPREDTYL P
Sbjct: 250 DDTEISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYP 309

Query: 314 LSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQKELXX 373
           L+++ ++ID +ILQNLV+LWHGR  D IK KLK  G N EKTLYALLYRFK ++ +E   
Sbjct: 310 LADAGAAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNK 369

Query: 374 -XXXXXXXXXXXXVSTSSP----NKISTTPQRRKNRESIISVTSSRKKPIXXXXXXXXXX 428
                         STSS       + +TP++R ++                        
Sbjct: 370 RRRHKTKKTKNRKFSTSSSLVKGRNLESTPRKRTSKTH---------------------- 407

Query: 429 XXXXXXXXXXXXRLSKNFSS-KKRLSTIVN----QASPTPASRNKRTSIINVDKNQR-RA 482
                         S NFSS KKR S I++     +SP P   +K  S+ N         
Sbjct: 408 --------------SNNFSSGKKRSSFILSPNSINSSPIPLRNSKGISLRNATSGGSPVV 453

Query: 483 SVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTSSN 542
            V                 S +P++K  SVT++L+S Y KL  +DDWE IEK+TKRTSSN
Sbjct: 454 PVILLNSFKRNSKLSSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSN 513

Query: 543 FATLID 548
           FATLID
Sbjct: 514 FATLID 519

 Score = 97.8 bits (242), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 126/261 (48%), Gaps = 60/261 (22%)

Query: 638 ISAPMESEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRT 696
           +S+P+ + E +   L  DID +L  R   S  TRP+S+LDPG+M   P    +  + K  
Sbjct: 570 VSSPLINYEFSQQELLQDIDTLLTNRYQLSAYTRPISKLDPGLM---PAAGTTPHDIKEQ 626

Query: 697 ENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDY 756
                 TE KI+ETI RSKFLGS  N+ +                               
Sbjct: 627 TALIRDTEVKIIETIHRSKFLGSLLNVRE------------------------------- 655

Query: 757 GSLVLPKDARGYSQLEDHIAP-------TTGDLLSNG--ELRKISEVRVPQFTRKSRHFS 807
                     G S+ +D +AP       +T  L+ +   E+RKIS+V VP FTRKSRHF+
Sbjct: 656 ----------GMSKDDDELAPIEESSIISTTPLIYDDRTEVRKISDVEVPHFTRKSRHFT 705

Query: 808 ESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQS-QRIPTPKSADDSEFL---FETV 863
            ++ R SVLS+YSS++SF +L  I KN   D   Q+S     + K    +E L    E +
Sbjct: 706 AASNRRSVLSLYSSRDSFKDLSQISKNEYSDSPSQRSVDDTSSSKKVGHTESLASVAEHI 765

Query: 864 NEEAEYTGNS--SNDERLYDV 882
           ++++    NS  ++D  LYDV
Sbjct: 766 DDDSYNDHNSGMNSDNVLYDV 786

 Score = 97.8 bits (242), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 70/102 (68%), Gaps = 1/102 (0%)

Query: 1035 VELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEIS 1094
            +E++AK+  K+LF GL KLL GW QYGLK +      + + GKL +++I SLRSTLFEI 
Sbjct: 916  LEIHAKIPNKRLFEGLHKLLEGWKQYGLKKLGFDAAKMIIKGKLVNDSILSLRSTLFEII 975

Query: 1095 IYPRG-KMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
            + P G   S+++F K +G+ K + KL  E++ +L KEGVL+K
Sbjct: 976  VLPNGDDRSLIKFNKKTGSSKVLTKLATEIQIILQKEGVLDK 1017

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/559 (56%), Positives = 387/559 (69%), Gaps = 71/559 (12%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           N IGPWKLGETLG GSTGKVQLAR++ TGQ+ AVKVI K++F +    G +         
Sbjct: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNN------DSV 69

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LP+ IEREI+IMKLL+HPNVL LYDVWET+ +LYL+LEYAEKGELFNLLV+RGPLPE EA
Sbjct: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
           I+ F+QIII +SYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGS
Sbjct: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKGQFE+P
Sbjct: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249

Query: 254 SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313
           ++ E+S +AQDLI +IL VDP +RIK RDIL HPLL+KY +I+DSKSI+ LPRE+TYL P
Sbjct: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309

Query: 314 LSESNS----SIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQK 369
           L+++++    +ID +ILQNLVILWHGR  + I +KL++ G N EKTLYALLYRFK ++ K
Sbjct: 310 LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369

Query: 370 ELXXXXXXXXXXXXXXVSTSSPNKISTTPQRRKNRESIISVTSSRKKPIXXXXXXXXXXX 429
           E                 T    ++ST      +  +  S+ S+ +K             
Sbjct: 370 ETNKRSRSKINK------TKKSKRVSTLSSSSSSAFNHQSLDSAPRKHASRGH------- 416

Query: 430 XXXXXXXXXXXRLSKNF-SSKKRLSTIVNQ----ASPTPASRNKRT-------------- 470
                        SKNF SS+KR S I++      SP P   +KR               
Sbjct: 417 -------------SKNFPSSRKRSSFILSSNSTDCSPIPLRSSKRISISSAVPGNTLQVP 463

Query: 471 -SIINVDKNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDW 529
            S + + +N +R+S                 LS +P++ R S+TT L+S Y  L  DDDW
Sbjct: 464 DSSLKLKRNSKRSS---------------KRLSYMPNLGRGSLTTNLLSNYTNLIDDDDW 508

Query: 530 EYIEKETKRTSSNFATLID 548
           EYI+K+TKRTSSNFATLID
Sbjct: 509 EYIDKDTKRTSSNFATLID 527

 Score = 98.2 bits (243), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 72/102 (70%), Gaps = 1/102 (0%)

Query: 1035 VELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEIS 1094
            +++ AK+S K+L+ GL KLL GW QYGLKN+  +  ++ ++GKL ++ I SLRSTLFEI 
Sbjct: 931  LDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIV 990

Query: 1095 IYPRGK-MSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135
            I P G   S+++F K +G+ K + K   E++ +L KEGVL++
Sbjct: 991  ILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVLDE 1032

 Score = 92.8 bits (229), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 112/241 (46%), Gaps = 43/241 (17%)

Query: 638 ISAPMESEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRT 696
           +S+P+ + E +   L  DID +L  R   S  TRP+SRLDPG+   +PV        K  
Sbjct: 586 VSSPLMNYEFSQKELLQDIDTLLTNRYQLSSYTRPISRLDPGL---TPVTGAIPHSIKEK 642

Query: 697 ENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDY 756
                 TE KI+ETIR+S+FLGS  N+                      E I  D +   
Sbjct: 643 TALLQDTEMKIIETIRKSEFLGSLLNVR---------------------EGISQDNNQLA 681

Query: 757 GSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVL 816
              V PK +       D +           E+RKIS+V VP FTRKS+HF+ +N R SVL
Sbjct: 682 SIEVSPKISTTPLMYNDQV-----------EIRKISDVEVPHFTRKSKHFTTANNRRSVL 730

Query: 817 SMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSND 876
           S+YS KES  +L  I KN   D   Q S       +A  SE +   V EE     NS +D
Sbjct: 731 SLYSLKESLEDLNQISKNEEPDSPPQGST-----DNASKSELV--DVIEEVTEQKNSQHD 783

Query: 877 E 877
           +
Sbjct: 784 Q 784

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  556 bits (1433), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 256/360 (71%), Positives = 305/360 (84%), Gaps = 10/360 (2%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           NTIGPW+LGETLG GSTG+VQLA+++ TG + AVKVISK +F+  +  G   +      A
Sbjct: 8   NTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXL------A 61

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LPY IEREI++MKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+RGPLPE EA
Sbjct: 62  LPYNIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEA 121

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
           ++ FRQIII +SYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+ +LLETSCGS
Sbjct: 122 VKCFRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGS 181

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDE++GN+R LLLKVQ+GQFE+P
Sbjct: 182 PHYAAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMP 241

Query: 254 SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313
              E+S++AQ+LI +IL VDP +R+K RDIL HPLL+KY +IRDSKSIR LPRE+TYL P
Sbjct: 242 DATEISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYP 301

Query: 314 LSE----SNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQK 369
           L++    +N++ID +ILQNLV+LWHGR  D I   LK+ G N EKTLYALLYRFK +  K
Sbjct: 302 LADAGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFKQEANK 361

 Score =  176 bits (446), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 162/512 (31%), Positives = 249/512 (48%), Gaps = 79/512 (15%)

Query: 638  ISAPMESEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRT 696
            +S+P+ + E +   L  DI+ +L  R   S  TRP+S+LDPG+M   P  +    + K  
Sbjct: 576  VSSPLINYEYSQQELLQDINTLLTNRCQLSAYTRPISKLDPGLM---PTPETIPYDIKEK 632

Query: 697  ENERLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDY 756
             +  L TE KILETIR+SK L SS N+ KE+       PS+                   
Sbjct: 633  TDLLLDTEMKILETIRKSKILDSSLNLRKEVSRDADRLPSVE------------------ 674

Query: 757  GSLVLPKDARGYSQLEDHIAPTTGDLLSNG--ELRKISEVRVPQFTRKSRHFSESNKRLS 814
                           E  IA TT  + +N   E+ KIS+++VP FTRKS+ F+ +N R S
Sbjct: 675  ---------------ESPIASTTPLVYNNDSKEVCKISDIQVPHFTRKSKCFTPTNNRRS 719

Query: 815  VLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSS 874
            VLS+YSS+ SF  L  IL + +   +       P  +  D +E +    N E      ++
Sbjct: 720  VLSLYSSRHSFKGLSRILNSKDPSANPYSHINGPLSEEIDLTEDIANMKNIENN----NN 775

Query: 875  NDERLYDVGDSTIKDKSALKLNFAD-----------RFNASTNEKETENLHLPTLPPLNG 923
            N+ RLYDV +S I  +     +  D           + + S N + T  + LP+L     
Sbjct: 776  NNNRLYDVSESAILLQGNDDDDDDDDNENDDGSQSIQSSVSNNTEPTTFVKLPSLSSF-- 833

Query: 924  GDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTXXXXXXXXXXXXXREDQEKDAKGAKDIE 983
                 ++K+   LGI  +  S+ P  +SS                 ED ++D  G  +I+
Sbjct: 834  -----QEKNASGLGIYQREPSIEPSIESSIEPLPNVTIAI------EDVDED--GENEIQ 880

Query: 984  PPLNKSVQKTRANDSGPQVKSHPREPKKDRNISGNGXXXXXXXXXXXXXXXVELYAKVSA 1043
               ++++  + +ND+  +        ++  N+S                  +E++AK+ A
Sbjct: 881  ---HENITTSLSNDNIKKNDDTKDTIREYSNVS------FLKKFSKGKILELEIHAKIPA 931

Query: 1044 KQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYP-RGKMS 1102
            ++LF GL KLL GW QYGLKN+     N+ +TGKL ++NI SLRSTLFEI + P R   S
Sbjct: 932  ERLFEGLHKLLEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEIIVLPNRDDRS 991

Query: 1103 VVQFKKVSGAFKAVKKLVNEVENVLSKEGVLE 1134
            +++F K +G+ K +KKL  E++ VL KEGVL+
Sbjct: 992  LIKFNKKTGSTKTLKKLGYEIQIVLQKEGVLD 1023

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 56/98 (57%), Gaps = 1/98 (1%)

Query: 452 LSTIVNQASPTPASRNKRTSIIN-VDKNQRRASVFXXXXXXXXXXXXXXXLSLIPSMKRE 510
           L++  +  SP P+  +KR+S  N    N     V                LS +P++KR 
Sbjct: 420 LASNSSNGSPMPSRNSKRSSFFNTASANVPPVPVKLLNSYKRNSKRSSKRLSYVPNVKRG 479

Query: 511 SVTTKLMSTYAKLAADDDWEYIEKETKRTSSNFATLID 548
           S+T+K +S Y  L  +DDWEYIEK+TKRTSSNFATLID
Sbjct: 480 SLTSKSLSKYTNLIDEDDWEYIEKDTKRTSSNFATLID 517

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  402 bits (1032), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 205/355 (57%), Positives = 248/355 (69%), Gaps = 23/355 (6%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           +TIGPWKLG+TLG GS+G+V+LA+N  TG+ AAVK++ K               S  P+A
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPK-------------TKSSRPNA 99

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LPYGIEREIIIMKL++HPNV+ LY+VWE   +L+LVLEY + GELF+ LV RG L E EA
Sbjct: 100 LPYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEA 159

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           I +FRQII G +YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+T  KLLETSCG
Sbjct: 160 IHYFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCG 219

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G++++
Sbjct: 220 SPHYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQM 277

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS---IRGLPREDT 309
           P    +S EAQDLI +IL VDP +RI   DIL HPL+ KY   R SKS   +  L     
Sbjct: 278 P--QAISLEAQDLISRILVVDPNKRITINDILSHPLITKYDYKR-SKSNSDLHILSHTSP 334

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
            +  +  S   +D TILQNL ILWHG   D I ++L EP    EKT Y+LL  ++
Sbjct: 335 QICTI-RSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ 388

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  404 bits (1038), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 201/355 (56%), Positives = 255/355 (71%), Gaps = 14/355 (3%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           +T+GPWKLG+TLG GS+G+V+LA+N  TG+ AA+K++ K V  + N S  S   +     
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAAN---GN 112

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LPYGIEREIIIMKL++HPN++ LY+VWE  ++L+LVLEY E GELF+ LV +G LPE EA
Sbjct: 113 LPYGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEA 172

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           + +FRQII GV+YCH   I HRDLKPENLL+D K + IKIADFGMAALET  KLLETSCG
Sbjct: 173 VHYFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCG 232

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G++ +
Sbjct: 233 SPHYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHM 290

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS---IRGLPREDT 309
           P +  +S EAQDLI KIL VDP+ RI   ++L+HPL+ KY   R SKS   +  L R   
Sbjct: 291 PQN--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKAR-SKSNSDLHLLSRTPQ 347

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
            +T   +S   ID +IL NL ILWHG   + I  +L + G   EK  Y+LL++++
Sbjct: 348 LVT--LQSKEDIDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  402 bits (1033), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 203/355 (57%), Positives = 251/355 (70%), Gaps = 20/355 (5%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           +T+GPWKLG+TLG GS+G+V+LA+N  TG+ AA+K++ K      N   TS         
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHNNTQLTS--------- 109

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LPYGIEREIIIMKL++HPNV+ LY+VWE   +LYLVLEY E GELF+ L+ RG LPE EA
Sbjct: 110 LPYGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEA 169

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           + +F+QI+ GVSYCH   I HRDLKPENLLLD K  ++KIADFGMAALET  KLLETSCG
Sbjct: 170 VHYFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCG 229

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQ G++++
Sbjct: 230 SPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQM 287

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLT 312
           P +  +S EA+DLI KIL VDP  RI   ++L+HPLL KY   R SKS   L   D+  T
Sbjct: 288 PQN--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDS--T 342

Query: 313 P---LSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
           P   + ES   ID +IL NL ILWHG   + +  KL + G   EK  Y+LL R++
Sbjct: 343 PNIVVLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  400 bits (1027), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/358 (56%), Positives = 250/358 (69%), Gaps = 25/358 (6%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           +T+GPWKLG+TLG GS+G+V+LA+N  +G+ AA+K++ K          T         A
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVT---------A 106

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LPYGIEREIIIMKL+ HPN++ LY+VWE  ++LYLVLEY E GELF+ L+ RG LPE EA
Sbjct: 107 LPYGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEA 166

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           I +F+QI+ GVSYCH   I HRDLKPENLLLD K   +KIADFGMAALET  +LLETSCG
Sbjct: 167 IHYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCG 226

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D N+R LLLKVQ G++++
Sbjct: 227 SPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQM 284

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGL------PR 306
           PS+  VS+EA+DLI KIL VDP++RI    IL+HPLL KY    D+    GL      P 
Sbjct: 285 PSN--VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKY----DNPGKGGLACPLEKPE 338

Query: 307 EDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
           E   +  +  S   ID TIL NL ILWHG   + + +KL + G   EK  YALL R++
Sbjct: 339 ERPKVLDI-HSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  396 bits (1017), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 203/387 (52%), Positives = 258/387 (66%), Gaps = 21/387 (5%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           +T+GPWKLG+TLG GS+G+V+LA+N  TG+ +A+K++ K    +  +             
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIK-----------Q 116

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LPYGIEREIIIMKL++HPNV+ LY+VWE  ++LYLVLEY E GELF+ LV +G LPE+EA
Sbjct: 117 LPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEA 176

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLD-HKYNIKIADFGMAALETEGKLLETSCG 192
           I +F+QI+  V+YCH   I HRDLKPENLLLD  K +IKIADFGMAALET  KLLETSCG
Sbjct: 177 IHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETSCG 236

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQ G++++
Sbjct: 237 SPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQM 294

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS---IRGLPREDT 309
           P    +S EA+DLI +IL VDP RRI    IL+H LL KY     SKS   +  L R   
Sbjct: 295 PQ--WLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLNLLNRTPN 352

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQK 369
            ++  SE +  ID TIL NL ILWHG     +  +L +PG   EK  Y+LL+ ++   QK
Sbjct: 353 IVSFSSERD--IDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQEKQQK 410

Query: 370 ELXXXXXXXXXXXXXXVSTSSPNKIST 396
            +               S+ SP  IS+
Sbjct: 411 SMQKDLIPVPTLKTSSASSVSPLNISS 437

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  395 bits (1016), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/363 (57%), Positives = 255/363 (70%), Gaps = 25/363 (6%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           +TIGPWKLG+TLG GS+G+V+LA+N  TG+ AA+K++ K        + +S  GS     
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK--------TKSSRTGS----- 99

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
           LPYGIEREIIIMKL++HPNV+ LY+VWE   +L+LVLEY + GELF+ LV RG LPE EA
Sbjct: 100 LPYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEA 159

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           I +FRQII G +YCH   I HRDLKPENLLLD K   IKIADFGMAAL+T  KLLETSCG
Sbjct: 160 IHYFRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCG 219

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G++++
Sbjct: 220 SPHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQM 277

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS---IRGLPREDT 309
           P    VS  AQDLI +IL VDP +RI   +IL HPLL KY + R SKS   +  L     
Sbjct: 278 P--QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGNKR-SKSNSDLHILSHSKP 334

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL--YRFKCDT 367
            ++ + +S S +D TILQNL ILWHG   + I + L +P    EKT Y+LL  Y+ +   
Sbjct: 335 QISTI-KSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQQRQSK 393

Query: 368 QKE 370
           QKE
Sbjct: 394 QKE 396

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  389 bits (999), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/383 (52%), Positives = 261/383 (68%), Gaps = 38/383 (9%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISK-------------AVFNAGNM 60
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K             + F+A + 
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 61  SGTSIV----------GSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVL 110
           S ++I           GS      PYGIEREI+IMKL++HPNV+ LY+VWE  ++LYLVL
Sbjct: 156 SNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVL 215

Query: 111 EYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YN 169
           EY + GELF+ LV +G L E EA+ +F+QII GVSYCH+  I HRDLKPENLLLD K  +
Sbjct: 216 EYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKS 275

Query: 170 IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRL 229
           IKIADFGMAALE   KLL+TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG L
Sbjct: 276 IKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHL 335

Query: 230 PFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
           PF+  D NI+ LLLKVQ G+F +PS   +S EAQDLI +IL +DP +RI    IL HPL+
Sbjct: 336 PFN--DDNIKKLLLKVQAGKFRMPS--TLSPEAQDLISRILVIDPSKRITTDRILNHPLI 391

Query: 290 QKY-PSIRDSKSIRGLPREDTYL------TPLS-ESNSSIDATILQNLVILWHGRDPDGI 341
            KY P+ ++   + G    D ++       P+S  S + IDA+IL+NL ILWHG   + I
Sbjct: 392 LKYEPAGKN--MVSGKSNSDLHVLEHISPQPISLTSRNDIDASILKNLQILWHGTSRELI 449

Query: 342 KEKLKEPGANAEKTLYALLYRFK 364
             KL +   + EK  Y+LL+++K
Sbjct: 450 IAKLLQTPMSEEKLFYSLLWQYK 472

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  389 bits (999), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/389 (50%), Positives = 262/389 (67%), Gaps = 42/389 (10%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVI--SKAVFNAGN-------MSGTS 64
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++   KA  +  N        S + 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSM 135

Query: 65  IVGSITPDAL------------PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
           +  +++  ++            PYGIEREI+IMKL++H NV+ L++VWE  ++LYLVLEY
Sbjct: 136 VTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV +G LPE EAI +F+QI+ GVSYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           IADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           +  D NI+ LLLKVQ G++++PS+  +S EA+DLI KIL +DP++RI  ++ILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371

Query: 292 YPSI---------RDSKSIRGLPREDTYL----TP---LSESNSSIDATILQNLVILWHG 335
           Y  +         R     RG    D +L    +P      S   ID +IL++L ILWHG
Sbjct: 372 YDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHG 431

Query: 336 RDPDGIKEKLKEPGANAEKTLYALLYRFK 364
              + I  KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  387 bits (993), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/392 (51%), Positives = 255/392 (65%), Gaps = 45/392 (11%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISK--------------------A 53
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K                     
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSN 133

Query: 54  VFNAGNMSGTS-----IVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYL 108
                 M  T+       G       PYGIEREI+IMKL++H NVL LY+VWE  ++LYL
Sbjct: 134 SSQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYL 193

Query: 109 VLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKY 168
           VLEY + GELF+ LV RG L E EA+ +F+QII GVSYCHA  I HRDLKPENLLLD K 
Sbjct: 194 VLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKN 253

Query: 169 N-IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTG 227
           + IKIADFGMAALE   KLL+TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG
Sbjct: 254 STIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTG 313

Query: 228 RLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHP 287
            LPF+  D +I+ LLLKVQ G++++P +  +S+EAQDLI KILTV+P +R+   +IL+HP
Sbjct: 314 HLPFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRHP 369

Query: 288 LLQKYPSIRDSKSIRGLPRE--------DTYLTPLSESNS-------SIDATILQNLVIL 332
           L+ KY S+  +K  + L +         D +L    E+ +        ID TIL NL IL
Sbjct: 370 LIVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQIL 429

Query: 333 WHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
           WHG   + I  KL +P  + EK  Y+LL ++K
Sbjct: 430 WHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  388 bits (997), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 261/389 (67%), Gaps = 42/389 (10%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISK------------------AVF 55
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K                  +  
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSM 135

Query: 56  NAGNMSGTSIVG---SITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
              N+S  SIV    S      PYGIEREI+IMKL++H NV+ L++VWE  ++LYLVLEY
Sbjct: 136 VTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV +G LPE EAI +F+QI+ GVSYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           IADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           +  D NI+ LLLKVQ G++++P +  +S EA+DLI KIL +DP +RI  ++ILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLIKK 371

Query: 292 YPSIRDSKSIRGLPREDT----------YLTPLSE------SNSSIDATILQNLVILWHG 335
           Y  +  +K +R + R++            L  +S       S S ID +IL++L ILWHG
Sbjct: 372 YDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHG 431

Query: 336 RDPDGIKEKLKEPGANAEKTLYALLYRFK 364
              + I  KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  387 bits (993), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/377 (54%), Positives = 257/377 (68%), Gaps = 31/377 (8%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAG-------NMSGTSIV 66
           +T+GPWKLG+TLG GS+G+V+LA+N   GQ AA+K++ K     G       N + T++ 
Sbjct: 83  DTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLT 142

Query: 67  GSITPDAL--------PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGEL 118
            + + +          PYGIEREI+IMKL++H NV+ L++VWE   DL+LVLEY + GEL
Sbjct: 143 TNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGEL 202

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN-IKIADFGM 177
           F+ LV +G LPE EA+ +F+QII GV++CH+  I HRDLKPENLLLD K   IKIADFGM
Sbjct: 203 FDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGM 262

Query: 178 AALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN 237
           AALE   KLLETSCGSPHYA+PEIV G PY G  SDVWSCG+ILFALLTG LPF+  D N
Sbjct: 263 AALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN--DDN 320

Query: 238 IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRD 297
           IR LLLKVQ G+F LP +  +S EAQDLI KIL V+P++RIK  DILKHPL+ KY     
Sbjct: 321 IRKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFK 378

Query: 298 SK-------SIRGLPREDTYLTPLS---ESNSSIDATILQNLVILWHGRDPDGIKEKLKE 347
            K       S   L  E   LTP +    S + ID +IL+NL ILWHG   + I  KL +
Sbjct: 379 VKFNQVPNPSATNLNSEH-MLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAKLLQ 437

Query: 348 PGANAEKTLYALLYRFK 364
              +AEK  Y+LL+++K
Sbjct: 438 YPMSAEKIFYSLLWQYK 454

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  389 bits (1000), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/381 (50%), Positives = 255/381 (66%), Gaps = 34/381 (8%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVI--------------SKAVFNAGN 59
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++              +K++ ++ +
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPD 127

Query: 60  MSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
              T+      P    YGIEREI+IMKL++HPNV+ LY+VWE  ++LYLVLEY + GELF
Sbjct: 128 KPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELF 187

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMA 178
           + LV RG LPE EA+ +F+QII GV+YCHA  I HRDLKPENLLLD K   IKIADFGMA
Sbjct: 188 DYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMA 247

Query: 179 ALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNI 238
           ALE   KLL TSCGSPHYA+PEIV G  Y G  +DVWSCG+ILFALLTG LPF+ +  NI
Sbjct: 248 ALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NI 305

Query: 239 RTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI--- 295
           + LLLKVQ G + +PSD  +S +A+DLI KIL VDP +R+   +IL H L+ KY  +   
Sbjct: 306 KKLLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLT 363

Query: 296 -RDSKSIRGLPREDT-----YLTPLS------ESNSSIDATILQNLVILWHGRDPDGIKE 343
            R+  +   + R+ +     ++  LS      ++   ID +IL NL ILWHG     I +
Sbjct: 364 NRNYNNNLSMARDKSNSNLNFINNLSNVDILLQNPCDIDTSILSNLQILWHGESKHAIID 423

Query: 344 KLKEPGANAEKTLYALLYRFK 364
           KL +P  N EK  Y+LL ++K
Sbjct: 424 KLLQPNMNEEKLFYSLLLKYK 444

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  384 bits (986), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/390 (51%), Positives = 263/390 (67%), Gaps = 44/390 (11%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISK-----------AVFNA----- 57
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K            V N+     
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 58  --GNMSGTSIVG---SITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
              N+S  SIV    S      PYGIEREI+IMKL++H NV+ L++VWE  ++LYLVLEY
Sbjct: 136 VTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV RG LPE EAI +F+QI+ GVSYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIK 255

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           IADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           +  D NI+ LLLKVQ G++++P +  +S EA++LI KIL +DP++RI  ++IL+HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPLIKK 371

Query: 292 YPSIRDSKSI---------RGLPREDTYL--------TPLSESNSSIDATILQNLVILWH 334
           Y ++  +K +         RG    D +L          L+  N  ID +IL++L ILWH
Sbjct: 372 YDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKN-EIDESILRSLQILWH 430

Query: 335 GRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
           G   + I  KL +   + EK  Y+LL R+K
Sbjct: 431 GVSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  383 bits (983), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/389 (49%), Positives = 264/389 (67%), Gaps = 42/389 (10%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVI--SKAVFNAGN-------MSGTS 64
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++   KA  +  N        S + 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 65  IVGSITPDAL------------PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
           I  +++  ++            PYGIEREI+IMKL++H NV+ L++VWE  ++LYLVLEY
Sbjct: 136 ITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV +G LPE EAI +F+QI+ GVS+CH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIK 255

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           IADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           +  D NI+ LLLKVQ G++++P +  +S EA+DLI KIL ++P++RI  ++IL HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPLIKK 371

Query: 292 YPSIRDSKSIRGLPREDT----------YLTPLS------ESNSSIDATILQNLVILWHG 335
           Y ++  +K IR + R++            L  +S       S   ID +IL++L ILWHG
Sbjct: 372 YDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHG 431

Query: 336 RDPDGIKEKLKEPGANAEKTLYALLYRFK 364
              + I  KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  380 bits (975), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 256/380 (67%), Gaps = 33/380 (8%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPD 72
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K  +F   N +   +    + D
Sbjct: 87  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSND 146

Query: 73  ALP--------------YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGEL 118
             P              YGIEREI+IMKL++HPNV+ LY+VWE  ++L+LVLEY + GEL
Sbjct: 147 ESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGEL 206

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN-IKIADFGM 177
           F+ LV RG L E EA+ +F+QII GVSYCH+  I HRDLKPENLLLD K N IKIADFGM
Sbjct: 207 FDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGM 266

Query: 178 AALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN 237
           AALE   KLL TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D +
Sbjct: 267 AALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDS 324

Query: 238 IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIR- 296
           I+ LLLKVQ G+F++P +  +S EA+DLI +IL VDP++RI+  DIL HPL++KY   + 
Sbjct: 325 IKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKYEDNKT 382

Query: 297 DSKSIRGLPREDTYLTPLS------------ESNSSIDATILQNLVILWHGRDPDGIKEK 344
           DS ++    +     + L             ++ + ID +IL+NL ILWHG   + I  K
Sbjct: 383 DSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELIISK 442

Query: 345 LKEPGANAEKTLYALLYRFK 364
           L +   + EK  Y+LL ++K
Sbjct: 443 LLQTPMSEEKLFYSLLLQYK 462

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  380 bits (977), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/402 (48%), Positives = 256/402 (63%), Gaps = 57/402 (14%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-------------------- 53
           +T+GPWKLG+TLG GS+G+V+LA+N  TG+ AA+K++ K                     
Sbjct: 89  DTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLF 148

Query: 54  -----------VFNAGNMSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWET 102
                        NA N   T+I  S      PYGIEREI+IMKLL+HPNV+ LY+VWE 
Sbjct: 149 LSYSSIHNTTNTHNARNTDNTAIENS--GGGNPYGIEREIVIMKLLSHPNVMALYEVWEN 206

Query: 103 NTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENL 162
           N +LYLVLEY + GELF+ LV +G L E+EA+ +F+QII G+SYCH+  I HRDLKPENL
Sbjct: 207 NNELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENL 266

Query: 163 LLDHKYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL 221
           LLD K   IKIADFGMAAL+   +LL+TSCGSPHYA+PEIV G  Y G  SD+WSCG+IL
Sbjct: 267 LLDKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIIL 326

Query: 222 FALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKAR 281
           FALLTG LPF+  D NI+ LL+KVQ G++++PS   +S+EA++LI +IL VDP +RI   
Sbjct: 327 FALLTGHLPFN--DDNIKKLLIKVQNGRYQMPS--YISQEAKNLISRILVVDPSKRISTE 382

Query: 282 DILKHPLLQKYP--------SIRDSKSIRGLPREDTYLTPLS-----------ESNSSID 322
            IL HPLL KY          +  +  I    + ++ L  LS            + S ID
Sbjct: 383 QILSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVKLRARSDID 442

Query: 323 ATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
            +IL+NL ILWHG   D I  KL +   + EK +Y+LL+++K
Sbjct: 443 ESILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK 484

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  379 bits (973), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/407 (50%), Positives = 264/407 (64%), Gaps = 41/407 (10%)

Query: 2   AVNGNSVPAIKD---NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFN-- 56
           ++N N+  + K    +T+GPWKLG+TLG GS+G+V+LA+N   G  AA+K++ K  +N  
Sbjct: 73  SINSNNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRR 132

Query: 57  ---------AGNMSGTSI---------VGSITPDAL-PYGIEREIIIMKLLNHPNVLRLY 97
                     G  SGT           + + T  AL PYGIEREI+IMKL++HPNV+ L 
Sbjct: 133 MRDQKMKTAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLL 192

Query: 98  DVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDL 157
           +VWE  ++LYLVLEY + GELF+ LV +G L E EA+ +F QII GVSYCH+  I HRDL
Sbjct: 193 EVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDL 252

Query: 158 KPENLLLDHKYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWS 216
           KPENLLLD K   IKIADFGMAALE   KLLETSCGSPHYA+PEIV G PY G  SDVWS
Sbjct: 253 KPENLLLDKKNKVIKIADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWS 312

Query: 217 CGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKR 276
           CG+ILFALLTG LPF+  D NI+ LLLKVQ G+F+LP    ++ +A+DLI +IL  +P++
Sbjct: 313 CGIILFALLTGHLPFN--DDNIKKLLLKVQAGRFQLPP--YLTNDAKDLITRILVTNPEK 368

Query: 277 RIKARDILKHPLLQKY----PSIRDSKSI-RGLPRED----TYLTPLS---ESNSSIDAT 324
           R+   +IL HPL++KY      IR    + RG    D     Y TP +    S   ID +
Sbjct: 369 RLTINEILNHPLIKKYRNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQS 428

Query: 325 ILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQKEL 371
           IL++L ILWHG     + E+L   GA  EK  Y+LL+++K    K +
Sbjct: 429 ILKSLQILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYKLKHSKPI 475

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  378 bits (971), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/398 (50%), Positives = 253/398 (63%), Gaps = 51/398 (12%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAV-----------------FN 56
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K                   F+
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFS 155

Query: 57  AGNMS-----------GTSI-VGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNT 104
           A   +           GT+   G     A PYGIEREI+IMKL++H N+L LY+VWE  +
Sbjct: 156 ATMNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKS 215

Query: 105 DLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL 164
           +LYLVLEY + GELF+ LV RG L E EA+ +F+QI+ GVSYCH+  I HRDLKPENLLL
Sbjct: 216 ELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLL 275

Query: 165 DHK-YNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFA 223
           D K  +IKIADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG+ILFA
Sbjct: 276 DKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFA 335

Query: 224 LLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDI 283
           LLTG LPF+  D NI+ LLLKVQ G+F +P +  +S EA+DL+ KIL V+P +RI   +I
Sbjct: 336 LLTGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEEI 391

Query: 284 LKHPLLQKY----------PSIRDSKSIRGLPREDTYLTPLSESN-------SSIDATIL 326
           L HPLL KY           S+      +G    D ++   S SN         ID +I+
Sbjct: 392 LNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSIV 451

Query: 327 QNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
            NL ILWHG   + I  KL +P  + EK  Y+LL  +K
Sbjct: 452 SNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  349 bits (895), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/363 (51%), Positives = 234/363 (64%), Gaps = 26/363 (7%)

Query: 205 IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQD 264
           +PY GF SDVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ GQFE+P  DE+S EAQD
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 265 LICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESNSSIDAT 324
           LI KILTVDP  RIK+R+ILKHPLLQKYPSI+DSKSIR LPREDTYL PL   N SID +
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129

Query: 325 ILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQKELXXXXXXXXXXXXX 384
           I+ NLV+LWHGRD + I  +LKEPGAN EKT YALL+RFK D+ +E              
Sbjct: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189

Query: 385 XVSTSSPNKIS------TTPQRRKNRESIISVTSSRKKPIXXXXXXXXXXXXXXXX-XXX 437
              ++  N +S       TP ++KN+  +IS +SS K+P+                    
Sbjct: 190 PKRSNMRNSVSRRSITNVTP-KKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTS 248

Query: 438 XXXRLSKNFSSKKRLSTIVN-QASPTPASRNKRTSIINVD-----------KNQRRASVF 485
              R S N SS KR+S ++N   SPTP   +KR+S+ ++D           K+  +++  
Sbjct: 249 ASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDASAPPIPMDMLKDYNKSA-- 304

Query: 486 XXXXXXXXXXXXXXXLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTSSNFAT 545
                          LS +P  KR S+TTKL++TYAK++ D+DWEYIEKET+RTS++FAT
Sbjct: 305 --PKVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFAT 362

Query: 546 LID 548
           L D
Sbjct: 363 LCD 365

 Score =  274 bits (701), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 214/542 (39%), Positives = 286/542 (52%), Gaps = 78/542 (14%)

Query: 634  NIRSISAPMESEEK-----NINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKE 688
            ++RS+SAP ES  K     +  +L+ DI  +L RR FSL+TRP SRLDPGI  S   +  
Sbjct: 455  HVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTSEEEDFG 514

Query: 689  SAVEPKRTENERLTTEKKILETIRRSKFLGSSFNIEKEL-KLSKMEYPSMVPPQRLSEER 747
            S     +     L+TEK ILETIRRSKFLGSSF+I KEL +  +++       +R  EER
Sbjct: 515  S-----KNHGADLSTEKTILETIRRSKFLGSSFDINKELARERRLKEERAALAKRKDEER 569

Query: 748  IVSDPS------DDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTR 801
            + S+ +      + Y S  LPK   G S +E           ++ E RKISEV VPQFTR
Sbjct: 570  VASNATTANVVGNGYESQTLPKRKMG-SAME-----------ASSEPRKISEVEVPQFTR 617

Query: 802  KSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFE 861
            +SRHF+ SNKRLSVLSMYS+K SFTNL D LK G  DV   Q+      K   ++EF+FE
Sbjct: 618  RSRHFTASNKRLSVLSMYSTKTSFTNLADHLK-GKADVQLIQTSPPSASKMDQEAEFMFE 676

Query: 862  TVNEEAEYTGNSSNDERLYDVGDSTIKD----KSALKLNFADRFNASTN--EKETEN--- 912
            +V++E + T ++S D RLY+V ++  KD    K A+KLNFADRFN  T+   ++T++   
Sbjct: 677  SVDKEGKETADTSADSRLYEVAET--KDAKNAKPAVKLNFADRFNRPTSPPSQDTDSSAA 734

Query: 913  LHLPTLPPLNGGDEVNKQKDEDVLGI------------QPKVKSMIPQSDSSSHTXXXXX 960
            + LP LPPL+     NK      LG+            QP  KSM+     S  T     
Sbjct: 735  IKLPALPPLDK----NKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESEITTEPRN 790

Query: 961  XXXXXXXXREDQEKDAKGAKDIE----PPLNKSVQKTRANDSGPQVKSHPREPKKD---- 1012
                      + E+ AK +  +      PLN  ++K    D  P     P   KK     
Sbjct: 791  TVT-------ETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEKKANKSF 843

Query: 1013 -RNISGNGXXXXXXXXXXXXXXXVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNN 1071
             R  S  G               V     +   Q+FN L KLL  W  YGLK++ + P+ 
Sbjct: 844  FRKFSSKGSDEKKSGDYDFRFKTV-----IEETQMFNALSKLLAAWKDYGLKDVIASPSL 898

Query: 1072 LTLTGKLSSENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSKEG 1131
              + GKLSS+NI SLRSTLF I++  RG+ S V+F K SG+ K  KKLV E+E +L  + 
Sbjct: 899  KQIRGKLSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNKTFKKLVKEIEKILESKK 958

Query: 1132 VL 1133
             L
Sbjct: 959  AL 960

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  353 bits (905), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 257/426 (60%), Gaps = 81/426 (19%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAV---FNAG-------------- 58
           IGPWKLG+TLG GS+G+V+LA+NK TGQ AA+K++ K+    FN                
Sbjct: 93  IGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKSKSTKFNNAKKNGNGKDNTYDNK 152

Query: 59  ---------NMSGTSIV--------GSITPDALP------------------YGIEREII 83
                    N S  S++         SI  + L                   YGIEREI+
Sbjct: 153 PHLSYSSLHNRSNHSVLHNPSFLMDNSIIKNELGSDLDDDGNDSRNKDNSNRYGIEREIV 212

Query: 84  IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           IMKL++HPNV+ LY+VWE   +LYLVLEY + GELF+ LV +G L E EA+R+F+QII G
Sbjct: 213 IMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVRYFKQIIRG 272

Query: 144 VSYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
           V YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+    LL+TSCGSPHYA+PEIV
Sbjct: 273 VQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSPHYASPEIV 332

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREA 262
            G  Y G  SDVWSCG+ILFALLTG LPF+  D +I+ LL+KVQ G++++P  + +S++A
Sbjct: 333 MGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMP--NYLSKDA 388

Query: 263 QDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPRE-------------DT 309
           +DLI +IL V+PK R+    IL+HPL+ KY +    K    L ++             +T
Sbjct: 389 KDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNNLMRGKSNT 448

Query: 310 YLTPLSE-----------SNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYA 358
            L  L             S + ID +IL+NL ILW+G   + +  KL +   + EK +Y+
Sbjct: 449 DLAILQNIPDKTDIIQLRSRNDIDDSILRNLQILWNGVPRETLISKLIQDPVSEEKLIYS 508

Query: 359 LLYRFK 364
           LL+++K
Sbjct: 509 LLWQYK 514

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  325 bits (834), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 211/298 (70%), Gaps = 13/298 (4%)

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
           YGIEREI+IMKL++HPNV+ LY+VWE  ++LYL+LEY + GELF+ LV RG LPE EAI 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLL-LDHKYNIKIADFGMAALETEGKLLETSCGSP 194
           +F+QII GVSYCH+  I HRDLKPENLL    K +IKIADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS 254
           HYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G++++P 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMPK 374

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY-PSIRDSKSIRGLPREDTYL-- 311
           +  +S EA+DLI +IL V P +R+   +IL HPL+ KY  S +    ++G    D +L  
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 312 --TPLS---ESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFK 364
             +P +    S   ID +IL+NL ILWHG   D I  KL +   + EK  Y+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 34/39 (87%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISK 52
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  240 bits (613), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 108/120 (90%), Positives = 117/120 (97%)

Query: 85  MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGV 144
           MKLL+H NVLRLYDVWETN++LY+VLEY EKGELFNLLVERGPLPENEA+RFFRQIIIG+
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSG 204
           SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++ KLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  254 bits (650), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 137/294 (46%), Positives = 192/294 (65%), Gaps = 25/294 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +T Q+ A+K+I+K V +  +M G             
Sbjct: 27  IGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGR------------ 74

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA+  ELF+ +V+R  + ENE  R
Sbjct: 75  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEGRR 131

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+G  L+TSCGSP+
Sbjct: 132 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGSPN 191

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ LL  RLPFD+E  +I TL   +  G + +P  
Sbjct: 192 YAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIP-- 247

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPL----LQKY--PSIRDSKSIRG 303
           + +S  A  LI K+L V+P  RI   DI++ P     L +Y  PS +D+  I G
Sbjct: 248 NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFKVDLPEYLVPSEKDAIKING 301

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  251 bits (641), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 185/281 (65%), Gaps = 20/281 (7%)

Query: 6   NSVPAIKDNT-IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTS 64
           N V ++ D + +G +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G  
Sbjct: 25  NKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR- 83

Query: 65  IVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
                        IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+
Sbjct: 84  -------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQ 129

Query: 125 RGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEG 184
           R  + E EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G
Sbjct: 130 RNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 189

Query: 185 KLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK 244
             L+TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   
Sbjct: 190 NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKN 247

Query: 245 VQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILK 285
           +  G + LP    +S  A DLI ++L V+P  RI   +I++
Sbjct: 248 ISNGVYTLPK--FLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  251 bits (641), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 129/277 (46%), Positives = 185/277 (66%), Gaps = 20/277 (7%)

Query: 10  AIKDNT-IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGS 68
           A+ D + IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I++ V +  +M G      
Sbjct: 32  ALSDGSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLSKSDMQGR----- 86

Query: 69  ITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
                    IEREI  ++LL HP+++RLYDV ++  ++ +++EYA   ELF+ +V+R  +
Sbjct: 87  ---------IEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKM 136

Query: 129 PENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE 188
            ENEA +FF+QII  V YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+G  L+
Sbjct: 137 SENEARKFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLK 196

Query: 189 TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG 248
           TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G
Sbjct: 197 TSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNG 254

Query: 249 QFELPSDDEVSREAQDLICKILTVDPKRRIKARDILK 285
            + LP  + +S  A  LI K+L V+P  RI   +I++
Sbjct: 255 IYTLP--NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  249 bits (636), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 181/270 (67%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR------------ 90

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E+EA R
Sbjct: 91  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARR 147

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 148 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 207

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 208 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPK- 264

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S+ A  LI K+L V+P  RI  ++I++
Sbjct: 265 -FLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  248 bits (633), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 180/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + STGQ+ A+K+I+K V    +M G             
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGR------------ 79

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  +PE EA R
Sbjct: 80  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARR 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 137 FFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 197 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTIP-- 252

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
           + +S+ A  LI K+L V+P  RI   +I++
Sbjct: 253 NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  248 bits (634), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 51  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR------------ 98

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E+EA R
Sbjct: 99  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEDEARR 155

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 156 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 215

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + LP  
Sbjct: 216 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSLPK- 272

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A  LI ++L V+P  RI   +I++
Sbjct: 273 -FLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  248 bits (633), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 178/270 (65%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR------------ 99

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 100 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 156

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 157 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 216

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + LP  
Sbjct: 217 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 273

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A  LI ++L V+P  RI   +I++
Sbjct: 274 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  247 bits (631), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 178/270 (65%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR------------ 99

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 100 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 156

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 157 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 216

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + LP  
Sbjct: 217 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 273

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A  LI ++L V+P  RI   +I++
Sbjct: 274 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  248 bits (633), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/277 (46%), Positives = 183/277 (66%), Gaps = 20/277 (7%)

Query: 10  AIKDNT-IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGS 68
            +KD + IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I++ V    +M G      
Sbjct: 34  GLKDGSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGR----- 88

Query: 69  ITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
                    IEREI  ++LL HP++++LYDV ++  ++ +V+EYA+  ELF+ +V+R  +
Sbjct: 89  ---------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKM 138

Query: 129 PENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE 188
            E EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+
Sbjct: 139 SEQEARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLK 198

Query: 189 TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG 248
           TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G
Sbjct: 199 TSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNG 256

Query: 249 QFELPSDDEVSREAQDLICKILTVDPKRRIKARDILK 285
            + LP    +S  A  LI K+L V+P  RI   +I++
Sbjct: 257 IYTLPR--FLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  246 bits (627), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +T Q  A+K+I+K +    +M G             
Sbjct: 39  IGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGR------------ 86

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  D+ +V+EYA+  ELF+ +V+R  + ENEA +
Sbjct: 87  --IEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEARK 143

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD + N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 144 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGSPN 203

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD  D +I  L   +  G + LP  
Sbjct: 204 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTLPK- 260

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A +LI ++L V+P  RI   +I++
Sbjct: 261 -FLSPGAANLIKRMLIVNPLNRISMNEIME 289

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  246 bits (629), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 178/270 (65%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 53  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR------------ 100

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 101 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 157

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 158 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 217

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + LP  
Sbjct: 218 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 274

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A  LI ++L V+P  RI   +I++
Sbjct: 275 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  245 bits (626), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/274 (46%), Positives = 180/274 (65%), Gaps = 19/274 (6%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITP 71
           +D  IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G         
Sbjct: 24  QDQRIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR-------- 75

Query: 72  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEN 131
                 IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + EN
Sbjct: 76  ------IEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSEN 128

Query: 132 EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSC 191
           EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L TSC
Sbjct: 129 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSC 188

Query: 192 GSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFE 251
           GSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + 
Sbjct: 189 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYT 246

Query: 252 LPSDDEVSREAQDLICKILTVDPKRRIKARDILK 285
           LP    +S  A +LI ++L V+P  RI   +I++
Sbjct: 247 LPK--FLSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  246 bits (628), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K +    +M G             
Sbjct: 46  IGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAKSDMQGR------------ 93

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+E+A   ELF+ +++R  + ENEA R
Sbjct: 94  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEARR 150

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 151 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPN 210

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + LP  
Sbjct: 211 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILPK- 267

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A  LI ++L V+P  RI   +I++
Sbjct: 268 -FLSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  245 bits (625), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 180/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + STGQ+ A+K+I+K V    +M G             
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR------------ 83

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + ENEA R
Sbjct: 84  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARR 140

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 141 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 200

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 201 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPK- 257

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S+ A +LI ++L V+P  RI   +I++
Sbjct: 258 -FLSQGAANLIKRMLIVNPLNRITIHEIME 286

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  246 bits (628), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 126/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 58  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR------------ 105

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + ENEA R
Sbjct: 106 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEARR 162

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 163 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 222

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 223 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPK- 279

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S+ A  LI ++L V+P  RI   +I++
Sbjct: 280 -FLSQGASSLIKRMLIVNPLNRISISEIMQ 308

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  244 bits (624), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 176/269 (65%), Gaps = 19/269 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +T Q+ A+K+I+K V    +M G             
Sbjct: 65  IGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGR------------ 112

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             +EREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF  +V+R  + ENEA +
Sbjct: 113 --VEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEARK 169

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 170 FFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGSPN 229

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD  D +I  L   +  G + LP  
Sbjct: 230 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTLPK- 286

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDIL 284
             +S  A +LI K+L V+P  RI   +I+
Sbjct: 287 -FLSEGAANLIKKMLIVNPLNRISMTEII 314

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  244 bits (623), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/283 (45%), Positives = 182/283 (64%), Gaps = 20/283 (7%)

Query: 9   PAIKDNT-IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVG 67
           P + D + IG +++ +TLG GS GKV+LA + +T Q+ A+K+I+K V    +M G     
Sbjct: 34  PRLSDGSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKSDMQGR---- 89

Query: 68  SITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGP 127
                     IEREI  ++LL HP++++LYDV ++  ++ +V+E+A   ELF+ +++R  
Sbjct: 90  ----------IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDK 138

Query: 128 LPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLL 187
           + E EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L
Sbjct: 139 MSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFL 198

Query: 188 ETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQK 247
           +TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  
Sbjct: 199 KTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISN 256

Query: 248 GQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           G + LP    +S  A +LI K+L V+P  RI   +I K    Q
Sbjct: 257 GVYILPK--FLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  243 bits (619), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 180/274 (65%), Gaps = 19/274 (6%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITP 71
           +D  IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G         
Sbjct: 23  QDQRIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR-------- 74

Query: 72  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEN 131
                 IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E 
Sbjct: 75  ------IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSER 127

Query: 132 EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSC 191
           EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSC
Sbjct: 128 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 187

Query: 192 GSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFE 251
           GSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + 
Sbjct: 188 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYT 245

Query: 252 LPSDDEVSREAQDLICKILTVDPKRRIKARDILK 285
           LP    +S  A +LI ++L V+P  RI   +I++
Sbjct: 246 LPK--FLSPGAANLIKRMLIVNPLNRITIHEIME 277

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  242 bits (617), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 126/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 29  IGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR------------ 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E+EA R
Sbjct: 77  --IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARR 133

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 134 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 193

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + LP  
Sbjct: 194 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 250

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A +LI ++L V+P  RI   +I++
Sbjct: 251 -FLSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  241 bits (616), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 178/270 (65%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + ST Q+ A+K+I+K V    +M G             
Sbjct: 40  IGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR------------ 87

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + ENEA R
Sbjct: 88  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARR 144

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 145 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 204

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 205 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPK- 261

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A +LI K+L V+P  RI   +I++
Sbjct: 262 -FLSPGAANLIKKMLIVNPLNRITIHEIME 290

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  242 bits (617), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 126/270 (46%), Positives = 177/270 (65%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 39  IGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR------------ 86

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 87  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEARR 143

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 144 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 203

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + LP  
Sbjct: 204 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 260

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILK 285
             +S  A  LI ++L V+P  RI   +I++
Sbjct: 261 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  240 bits (613), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 185/298 (62%), Gaps = 33/298 (11%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    +M G             
Sbjct: 48  IGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR------------ 95

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 96  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEEARR 152

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 153 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 212

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + LP  
Sbjct: 213 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 269

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313
             +S  A  LI ++L V+P  RI   +I++           D     GLP   TYL P
Sbjct: 270 -FLSEGAAGLIKRMLIVNPLNRISILEIMQ-----------DDWFKVGLP---TYLIP 312

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  205 bits (521), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/303 (40%), Positives = 172/303 (56%), Gaps = 26/303 (8%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGS--- 68
           K  T GP+ +G TLG G  GKV+LA +KS  Q+           NAGN   T  V     
Sbjct: 41  KHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQC-----DNTEGNAGNKPMTFKVPKQVA 95

Query: 69  --------ITPD-ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                   IT D +    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +
Sbjct: 96  IKLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFY 155

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA- 178
             +  +  L EN A R F Q+I  V Y H+ G+VHRDLK ENLLLD++ N+ I DFG   
Sbjct: 156 KFIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVN 215

Query: 179 ALETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--- 234
               +  +++TSCGSP YAAPE +VS  PY    +D WSCG+ILFA+L G LP+D++   
Sbjct: 216 EFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKN 275

Query: 235 -DGN-IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
            DG+ I  L   +     + P  + ++   +DL+ KIL +DPK+RI  R I KHP L+ +
Sbjct: 276 PDGHDISRLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESH 333

Query: 293 PSI 295
            + 
Sbjct: 334 STF 336

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  204 bits (520), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 171/300 (57%), Gaps = 40/300 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG------QEAAVKVISKAVFNAGNMSGTSI 65
           K  T GP+ +G TLG G  GKV+L  +K++       ++ A+K+I +             
Sbjct: 33  KHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR------------- 79

Query: 66  VGSITPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                 D +P   E+EI I      +K LNHPN++RL +V + +  + +VLEYA  GE +
Sbjct: 80  ------DTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFY 133

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA- 178
             + ++  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG   
Sbjct: 134 KYIQKKRRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVN 193

Query: 179 ALETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--- 234
               E +L++TSCGSP YAAPE +V+  PY+   +DVWSCGVIL+A+L G LP+D++   
Sbjct: 194 EFLPENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPEN 253

Query: 235 -DG-NIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
            DG +I  L   + +   + P  D ++   +DL+ +IL  DPKRRI     LKH  LQ +
Sbjct: 254 PDGDDIGKLYRYITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  202 bits (513), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 118/319 (36%), Positives = 179/319 (56%), Gaps = 31/319 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIV--GSITPD 72
           + GP+ +G TLG G  GKV++      G        +K +++        ++   SI+ D
Sbjct: 38  SFGPYLIGSTLGQGGFGKVKMGWTTPMG--------NKGIYDVPKQVAIKLIKRDSISND 89

Query: 73  -ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEN 131
            +    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +R  L E+
Sbjct: 90  KSKEVKIYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKRRVLKEH 149

Query: 132 EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETS 190
            A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      ++ +L+ TS
Sbjct: 150 VACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQNELMTTS 209

Query: 191 CGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRTLLLK 244
           CGSP YAAPE+V S  PYQG  +D+WSCG+ILFA+L G LP+D++  N     I  L   
Sbjct: 210 CGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIAKLYYY 269

Query: 245 VQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPS---------- 294
           +     + P  + ++   +DL+ +IL  DP+RR+  R+I  H  L+K+            
Sbjct: 270 ITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQPEEWD 327

Query: 295 -IRDSKSIRGLPREDTYLT 312
            I  SK+I  LP+ + + +
Sbjct: 328 RISQSKNITRLPKHNKHYS 346

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  201 bits (512), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 166/288 (57%), Gaps = 29/288 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQ-----EAAVKVISK-AVFNAGNMSGTSIVGS 68
           T GP+ +G TLG G  GKV+L   K+T +     + A+K+I + A+ N            
Sbjct: 36  TFGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDAILNYSEKETK----- 90

Query: 69  ITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
                    I REI  +K L HPN+++L +V + +  + +VLE+A  GE +  + ++  L
Sbjct: 91  ---------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRL 141

Query: 129 PENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLL 187
            E  A R F Q++ GV Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L+
Sbjct: 142 KETPACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELM 201

Query: 188 ETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE----DG-NIRTL 241
           +TSCGSP YAAPE +V+  PY+   +DVWSCG+IL+A+L G LP+D++    DG +I  L
Sbjct: 202 KTSCGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKL 261

Query: 242 LLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            L + K   + P  + ++   +DL+ KIL  DP +R+  R+I KH  L
Sbjct: 262 YLYITKTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  201 bits (510), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 170/299 (56%), Gaps = 39/299 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG-----QEAAVKVISKAVFNAGNMSGTSIV 66
           K  T GP+ LG TLG G  G+V+L  +K+T      ++ A+K+I +              
Sbjct: 37  KHVTFGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRR-------------- 82

Query: 67  GSITPDALPYG------IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
                D +P        I REI  +K L+HPN+++L +V + +  + +VLEYA  GE + 
Sbjct: 83  -----DTIPKNSDKEIKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYK 137

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-A 179
            + ++  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG    
Sbjct: 138 YIQKKRRLKEAVACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNE 197

Query: 180 LETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE---- 234
                +L++TSCGSP YAAPE +VS  PY+   +D+WSCGVIL+A+L G LP+D++    
Sbjct: 198 FFAHSELMKTSCGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNP 257

Query: 235 DGN-IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
           DGN I  L   + +   + P  + ++   +DL+ +IL  DPKRRI  R I KH  ++ +
Sbjct: 258 DGNDIGKLYQYITRTPLKFP--EYITPLPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  202 bits (514), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/299 (37%), Positives = 170/299 (56%), Gaps = 39/299 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG-----QEAAVKVISKAVFNAGNMSGTSIV 66
           K  T GP+ +G TLG G  GKV+L  +K+TG     ++ A+K+I +              
Sbjct: 37  KQVTFGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRR-------------- 82

Query: 67  GSITPDALPYG------IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
                D +P        I REI  +K L HPN++RL +V + +  + +VLEYA  GE + 
Sbjct: 83  -----DTVPKNSDKEVKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYR 137

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-A 179
            + ++  L E+ A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG    
Sbjct: 138 YIQKKRRLKEHAACRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNE 197

Query: 180 LETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN- 237
              + +L++TSCGSP YAAPE +V+  PY+   +D+WSCGVI++A+L G LP+D++  N 
Sbjct: 198 FNHKNELMKTSCGSPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENP 257

Query: 238 ----IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
               I  L   + K   + P  + ++   +DL+ +IL  +PK+R+  R + +H  LQ +
Sbjct: 258 EGDDIAKLYHYITKTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  201 bits (512), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/300 (38%), Positives = 170/300 (56%), Gaps = 40/300 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG------QEAAVKVISKAVFNAGNMSGTSI 65
           K  T GP+ +G TLG G  GKV++  +K++       ++ A+K+I +             
Sbjct: 33  KHVTFGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRR------------- 79

Query: 66  VGSITPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                 D +P   E+E+ I      +K LNHPN++RL +V + +  + +VLEYA  GE +
Sbjct: 80  ------DTIPKNSEKEVKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFY 133

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA- 178
             + ++  L E+ A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG   
Sbjct: 134 KYIQKKRRLKESAACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVN 193

Query: 179 ALETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--- 234
               E +L++TSCGSP YAAPE +V+  PY+   +D+WSCGVI++A+L G LP+D++   
Sbjct: 194 EFLPENELMKTSCGSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPEN 253

Query: 235 -DG-NIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
            DG +I  L   + +   + P  D ++   +DL+  IL  DPK+RI     L H  LQ +
Sbjct: 254 PDGDDIGKLYRYITRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  201 bits (510), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 174/303 (57%), Gaps = 40/303 (13%)

Query: 9   PAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTG------QEAAVKVISKAVFNAGNMSG 62
           P  +  T GP+ +G TLG G  GKV+L  +K+        ++ A+K+I +          
Sbjct: 29  PRKRHVTFGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRR---------- 78

Query: 63  TSIVGSITPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKG 116
                    D++P   E+E+ I      +K L+HPN+++L +V + +  + +VLEYA  G
Sbjct: 79  ---------DSIPKNSEKEVKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGG 129

Query: 117 ELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFG 176
           E +  +  +  L E  A R F Q++ GV+Y H+ G+VHRDLK ENLLLD   N+ I DFG
Sbjct: 130 EFYKYIQRKRRLKEAIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFG 189

Query: 177 MA-ALETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE 234
                 +  +L++TSCGSP YAAPE +VS  PY+   SDVWSCGVIL+A+L G LP+D++
Sbjct: 190 FVNEFVSHNELMKTSCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDD 249

Query: 235 ----DGN-IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
               DGN I  L   + +   + P  + ++  ++DL+ +IL  DPK+RI  R I KH  L
Sbjct: 250 PKNPDGNDIVRLYYYITRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWL 307

Query: 290 QKY 292
           + +
Sbjct: 308 KPH 310

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  201 bits (510), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/298 (38%), Positives = 169/298 (56%), Gaps = 32/298 (10%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNK------STG----QEAAVKVISKAVFNAGNMS 61
           K  T GP+ +G TLG G  GKV+L   K      S+G    ++ A+K+I +   +  +  
Sbjct: 41  KHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSK 100

Query: 62  GTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
              I              REI  +K L HPN+++L +V + +  + +VLEYA  GE +  
Sbjct: 101 EIKIY-------------REINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKY 147

Query: 122 LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-L 180
           +  +  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG  +  
Sbjct: 148 IQRKKRLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEF 207

Query: 181 ETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-- 237
            + G+L++TSCGSP YAAPE +VS  PY+   +D+WSCGVIL+A+L G LP+D++ GN  
Sbjct: 208 YSHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPD 267

Query: 238 ---IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
              I  L   + +   + P  D ++   +DL+ +IL  DP+RRI  + I KH  L+ +
Sbjct: 268 GDDISRLYHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  200 bits (509), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 168/295 (56%), Gaps = 34/295 (11%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKS----------TGQEAAVKVISKAVFNAGNMSGTSI 65
            GP+ +G T+G G  GKV+L  +K+            ++ A+K+I +             
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKR------------- 112

Query: 66  VGSITPDALP-YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
             +I+ D+     I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +  
Sbjct: 113 -DAISKDSSKELKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQR 171

Query: 125 RGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETE 183
           +  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      + 
Sbjct: 172 KKRLKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSH 231

Query: 184 GKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN----- 237
            +L++TSCGSP YAAPE+V S  PY+   +D+WSCG+IL+A+L G LP+D++ GN     
Sbjct: 232 NELMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDD 291

Query: 238 IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
           I  L   + K   + P  D ++   +DL+ KIL  DP+RRI  + I KH  L+ +
Sbjct: 292 ISRLYYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  198 bits (504), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 126/383 (32%), Positives = 206/383 (53%), Gaps = 43/383 (11%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA--VF------------NAGNM 60
           ++G W   ET+G GS GKV+LARN+ T +  A+K++++A  +F            N   M
Sbjct: 93  SLGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIM 152

Query: 61  SGTSIVG-------SITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYA 113
           +   I+         I+ D       RE  + ++L HP++ RL++++  +   Y++ EY 
Sbjct: 153 NEKDILDRQKRLEKEISRDRRTI---REASLGQILYHPHICRLFEMYTLSNHFYMLFEYV 209

Query: 114 EKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIA 173
             G+L + +++ G L E+ A  F RQI+  + Y HA  IVHRDLK EN+++    NIKI 
Sbjct: 210 SGGQLLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKII 269

Query: 174 DFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDE 233
           DFG++ L  + K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+
Sbjct: 270 DFGLSNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDD 329

Query: 234 EDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK-Y 292
           E+ N+  L  K+++G+   P    +S E   L+  +L VDP +R     ++KH  + K Y
Sbjct: 330 ENSNV--LHEKIKQGRVFYPQ--FLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDY 385

Query: 293 PSIRDSKSIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKL----KEP 348
            SI D+     LP+      PL  ++ SID  +++ +  L    D +  ++KL     + 
Sbjct: 386 DSIPDAH----LPKR----VPL--TSESIDMKVIKEMKHLEFIEDIEQTEKKLLKLISQE 435

Query: 349 GANAEKTLYALLYRFKCDTQKEL 371
                +  Y  L +  C  +KE 
Sbjct: 436 RYQRLRNEYWHLKKLPCYNEKEF 458

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  196 bits (498), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 164/298 (55%), Gaps = 32/298 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAR-----NKSTG-----QEAAVKVISKAVFNAGNMSGTS 64
           T GP+ LG TLG G  GKV+L       N ST      ++ AVK+I +   +        
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKEVK 96

Query: 65  IVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
           I              REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +
Sbjct: 97  IY-------------REINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 125 RGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETE 183
           +  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      + 
Sbjct: 144 KRRLKETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 184 GKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN----- 237
            +L++TSCGSP YAAPE +VS  PY+   +D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSD 263

Query: 238 IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
           I  L   +     + P  D +    +DL+ +IL  DPKRRI  + I KH  L+ + S 
Sbjct: 264 IGRLYNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  196 bits (498), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 109/287 (37%), Positives = 165/287 (57%), Gaps = 20/287 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA--RNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPD 72
           T GP+ +G TLG G  GKV+L   RN ++ QE + +V  K +          IV +   +
Sbjct: 40  TFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLI------RRDKIVKNSEKE 93

Query: 73  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENE 132
                I REI  +K L HPN+++L +V + +  + +VLEYA  GE +  +  +  L E  
Sbjct: 94  I---KIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLKETA 150

Query: 133 AIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETSC 191
             R F Q++ GV+Y H+ G+VHRDLK ENLLLD   N+ I DFG       +  L++TSC
Sbjct: 151 GCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMKTSC 210

Query: 192 GSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDE-----EDGNIRTLLLKV 245
           GSP YAAPE+V S  PY+   +D+WSCG+IL+A+L G LP+D+     E  +I  L   +
Sbjct: 211 GSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFI 270

Query: 246 QKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
            +   + P  + +S   +DL+ ++L  DP++R+  R I +H  L+ +
Sbjct: 271 TRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  194 bits (492), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 161/295 (54%), Gaps = 30/295 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQL--------ARNKSTGQEAAVKVISKAVFNAGNMSGTSIVG 67
            G + LG TLG G  GKV+L        A   S  ++ A+K+I +     G+     I  
Sbjct: 43  FGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKKGSDKEIKIY- 101

Query: 68  SITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGP 127
                       REI  +KLL HPN++RL +V + +  + +VLE+A  GE +  L  +  
Sbjct: 102 ------------REINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRR 149

Query: 128 LPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKL 186
           L E  A + F Q+I GV+Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L
Sbjct: 150 LKEPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNEL 209

Query: 187 LETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRT 240
           ++ SCGSP YAAPE+V S  PY+    D+WSCG+IL+A+L G LP+D++  N     I  
Sbjct: 210 MKRSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGK 269

Query: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
           L   + K   + P+   +S  A+DLI KILT +P RRI    I KH  L+ + S 
Sbjct: 270 LYQYITKTALKFPA--YISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  197 bits (500), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 168/289 (58%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA--VFNAGNMSGTSIVGSITPD 72
           ++G W   ET+G GS GKV+LA+++ TG+  A+K++++A   F     +    V +    
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 73  ALPYGIEREI----------IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++  HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +F R +   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +  
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYD 283

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 284 TRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 341

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            K+++G+ E P    +S E   L+ K+L VDP RR   + +++HP + K
Sbjct: 342 EKIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  191 bits (485), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 163/296 (55%), Gaps = 30/296 (10%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNK--------STGQEAAVKVISKAVFNAGNMSGT 63
           K  T GP+ LG T+G G  GKV+   ++        + G++ A+K+I +           
Sbjct: 48  KQPTFGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQEL 107

Query: 64  SIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLV 123
            +              REI  +KLL+HPN+++L DV + +  + +VLEYA  GE +  L 
Sbjct: 108 KVY-------------REINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQ 154

Query: 124 ERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
            +  L E  A   F Q+I GV+Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T
Sbjct: 155 RKKRLKEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEIST 214

Query: 183 EGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEE----DG- 236
             KL++T CGSP YAAPE+V S  PY    +D+WS GVIL+A+L G LP+D++    DG 
Sbjct: 215 NNKLMKTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGS 274

Query: 237 NIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
           NI  L   + K   + P  D +   A+DLI KIL + PK R+    + +H  L+ +
Sbjct: 275 NIMRLYEYITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  196 bits (498), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 166/287 (57%), Gaps = 22/287 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVI---SKAVFNAGNM----------- 60
           ++G W+  ET+G GS GKV+LA+++ T +  AVK++   +KA  +   M           
Sbjct: 114 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 173

Query: 61  -SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                +   I+ D       RE  + ++L HP++ RL+++   +   Y++ EY   G+L 
Sbjct: 174 ERQKKLEKEISRDKRTI---REASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLL 230

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 231 DYIIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSN 290

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           L    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++ 
Sbjct: 291 LYDSRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV- 349

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            L  K+++G+ E P    +S E   L+ K+L VDPKRR   + +++H
Sbjct: 350 -LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  194 bits (493), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 163/298 (54%), Gaps = 32/298 (10%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG----------QEAAVKVISKAVFNAGNMS 61
           K  T GP+ LG TLG G  GKV+L   KS            ++ AVK+I +   +     
Sbjct: 34  KHVTFGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKK 93

Query: 62  GTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
              I              REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  
Sbjct: 94  EVKIY-------------REINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRY 140

Query: 122 LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-AL 180
           + +R  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG     
Sbjct: 141 IQKRRRLKEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEF 200

Query: 181 ETEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-- 237
            +  +L++TSCGSP YAAPE+V S  PY+   +D+WSCGVIL+A+L G LP+D++  N  
Sbjct: 201 CSRNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPE 260

Query: 238 ---IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
              I  L   +     + P  D +    +DL+ +IL  DPKRRI  + I KH  L+ +
Sbjct: 261 GSDIGRLYNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  193 bits (490), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 164/291 (56%), Gaps = 18/291 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIV--GSITPD 72
           T GP+ LG TLG G  GKV+L   K+          S + F+        ++   SI+ D
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNS------SNSTFDFPKQVAIKLIKRDSISND 90

Query: 73  ALP-YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEN 131
                 I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + ++  L E 
Sbjct: 91  YRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKEM 150

Query: 132 EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETS 190
            A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      +  +L++TS
Sbjct: 151 NACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTS 210

Query: 191 CGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRTLLLK 244
           CGSP YAAPE+V S  PY+   +D+WSCGVIL+A+L G LP+D++  N     I  L   
Sbjct: 211 CGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNY 270

Query: 245 VQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
           +     + P  D +    +DL+ ++L  DPK+RI  + I KH  L+ + S 
Sbjct: 271 INSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  194 bits (494), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 103/287 (35%), Positives = 166/287 (57%), Gaps = 22/287 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVI---SKAVFNAGNM----------- 60
           ++G W+  ET+G GS GKV+LAR++ T +  AVK++   +KA  +   M           
Sbjct: 114 SLGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 173

Query: 61  -SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                +   I+ D       RE  + ++L HP++ RL+++   +   Y++ EY   G+L 
Sbjct: 174 ERQKKLEKEISRDKRTI---REASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLL 230

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 231 DYIIQHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSN 290

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           L    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++ 
Sbjct: 291 LYDSRKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV- 349

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            L  K+++G+ E P    +S E   L+ K+L VDPKRR   + +++H
Sbjct: 350 -LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  192 bits (488), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 178/335 (53%), Gaps = 56/335 (16%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           T GP+ +G T+G G  GKV+L  +KS         IS    ++ + +G  +    TP AL
Sbjct: 57  TFGPYIIGSTIGQGEFGKVKLGWSKS---------ISNKQSHSPSANGLGLYA--TP-AL 104

Query: 75  P------------------------YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVL 110
           P                          I REI  +K L HPN+++L +V + +  + +VL
Sbjct: 105 PIEVPKQVAIKLIRRDTISKDPRREIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVL 164

Query: 111 EYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNI 170
           EYA  GE +  +  +  L E  A + F Q+I GV+Y H+ G++HRDLK EN+LLD   N+
Sbjct: 165 EYASGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENL 224

Query: 171 KIADFGMA-ALETEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGR 228
            I DFG      T  +L++TSCGSP YAAPE+V S  PY+    D+WSCG+ILFA+L G 
Sbjct: 225 IITDFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGY 284

Query: 229 LPFDEE-----DGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDI 283
           LP+D++       NI  L   +     + P  + ++   +DL+ +IL  DPK+R+  R I
Sbjct: 285 LPWDDDPENPSGENIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYI 342

Query: 284 LKH-------PLL----QKYPSIRDSKSIRGLPRE 307
           LKH       P L    +++ +I  S+SI  LP+ 
Sbjct: 343 LKHQWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  192 bits (487), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 167/297 (56%), Gaps = 29/297 (9%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLA---RNKST--GQEAAVKVISKAVFNAGNMSGTSIV 66
           K  T GP+ +G TLG G  GKV+L    +N+ST   ++ A+K+I +              
Sbjct: 27  KHVTFGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRR-------------- 72

Query: 67  GSITPD-ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
            SI  D      I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  + ++
Sbjct: 73  DSILQDREKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKK 132

Query: 126 GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E  A + F Q++ GV Y H+ G+VHRDLK ENLLLD   N+ I DFG         
Sbjct: 133 RRLKEPIACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNN 192

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L++TSCGSP YAAPE +V+  PY+   +DVWSCG+ILFA+L G LP+D++  N     I
Sbjct: 193 ELMKTSCGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDI 252

Query: 239 RTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
             L   +     + PS   +S   +DL+ KIL  +P +R+  R+I  H  L+ + S 
Sbjct: 253 AKLYNYITTSPLKFPS--YISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  192 bits (487), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 165/294 (56%), Gaps = 29/294 (9%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG-----QEAAVKVISKAVFNAGNMSGTSIV 66
           K  T GP+ +G TLG G  GKV+L   K++      ++ A+K+I +              
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRR-------------- 84

Query: 67  GSITPDA-LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
            +I  DA     I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +
Sbjct: 85  DTIKKDADKEVKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRK 144

Query: 126 GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E+ A R F Q+I GV+Y H  G+VHRDLK ENLLLD   N+ I DFG       + 
Sbjct: 145 RRLKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDN 204

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L+ TSCGSP YAAPE +VS  PY+   +DVWSCGVIL+A+L G LP+D++  N     I
Sbjct: 205 ELMNTSCGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 239 RTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
             L   + +   + P  + ++   +DL+ +IL  +P+RR+  R I +H  L+ +
Sbjct: 265 ARLYQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  193 bits (491), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 165/287 (57%), Gaps = 22/287 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVI---SKAVFNAGNM----------- 60
           ++G W+  ET+G GS GKV+LA++  T +  AVK++   +KA  +   M           
Sbjct: 127 SLGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 186

Query: 61  -SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                +   I+ D       RE  + ++L HP++ RL+++   +   Y++ EY   G+L 
Sbjct: 187 ERQKKLEKEISRDKRTI---REASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLL 243

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 244 DYIIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSN 303

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           L    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++ 
Sbjct: 304 LYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV- 362

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            L  K+++G+ E P    +S E   L+ K+L VDPKRR   + +++H
Sbjct: 363 -LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  189 bits (479), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 162/287 (56%), Gaps = 16/287 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA--RNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPD 72
           T GP+ +G TLG G  GKV+L   R  STG E    V  +       +   +IV +   +
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKL--IRRDTIVKNSEKE 97

Query: 73  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENE 132
                I REI  +K L HPNV+RL +V + +  + +VLEYA  GE +  +  +  L E+ 
Sbjct: 98  I---KIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKEST 154

Query: 133 AIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETSC 191
           A R F Q+I GV+Y H+  +VHRDLK ENLLLD   N+ I DFG       + + ++TSC
Sbjct: 155 ACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSC 214

Query: 192 GSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRTLLLKV 245
           GSP YAAPE+V S  PY    +DVWSCG+IL+A+L G LP+D++  N     I  L   +
Sbjct: 215 GSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYI 274

Query: 246 QKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
            +   + P  + ++   +DL+ KIL  DP +R+  + I +H  L+ +
Sbjct: 275 TRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  191 bits (486), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 163/301 (54%), Gaps = 32/301 (10%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG----------QEAAVKVISKAVFNAGNMS 61
           K  T GP+ LG TLG G  GKV+L   K+            ++ AVK+I +   +     
Sbjct: 34  KHVTFGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKK 93

Query: 62  GTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
              I              REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  
Sbjct: 94  EVKIY-------------REINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKY 140

Query: 122 LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-AL 180
           + ++  L E  A R F Q++ GV Y H+ G+VHRDLK ENLLLD   N+ I DFG     
Sbjct: 141 IQKKRRLKETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEF 200

Query: 181 ETEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-- 237
            +  +L++TSCGSP YAAPE+V S  PY+   +D+WSCGVIL+A+L G LP+D++  N  
Sbjct: 201 CSRNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPE 260

Query: 238 ---IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPS 294
              I  L   +     + P  D +    +DL+ +IL  DPK+R+  + I KH  L  + S
Sbjct: 261 GSDIGRLYNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSHFS 318

Query: 295 I 295
            
Sbjct: 319 F 319

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  190 bits (482), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 160/290 (55%), Gaps = 31/290 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKST---------GQEAAVKVISKAVFNAGNMSGTSIV 66
            GP+ +G TLG G  GKV++  + ++          ++ A+K+I +     G+     I 
Sbjct: 35  FGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIF 94

Query: 67  GSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERG 126
                        REI  +K L HPN++RL +V + +  + +VLEYA  GE +  +  + 
Sbjct: 95  -------------REINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKR 141

Query: 127 PLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGK 185
            L E  A R F Q+I GVSY H+ GIVHRDLK ENLLLD   N+ I DFG       + +
Sbjct: 142 RLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNE 201

Query: 186 LLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IR 239
           L++TSCGSP YAAPE+V +  PY+   +D+WSCG+IL+ +L G LP+D++  N     I 
Sbjct: 202 LMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIV 261

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            L   + K   + P  + ++   +DL+  IL  +P RR+ +R I KH  L
Sbjct: 262 RLYHYITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKHEWL 309

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  193 bits (491), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 166/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           ++G W   ET+G GS GKV+LAR+  T +  A+K++++A  +      +        +AL
Sbjct: 150 SLGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEASLPPPKSEEEAL 209

Query: 75  PY--GIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 210 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLDYI 269

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +F R I   + Y H   IVHRDLK EN+++    +IKI DFG++ L  
Sbjct: 270 IQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNLYD 329

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS GV+L+ L  G++PFD+E+ ++  L 
Sbjct: 330 SKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LH 387

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            K+++G+ + P    +S E   L+ K+L VDPK+R   + I+ HP + +
Sbjct: 388 EKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  191 bits (486), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 149/282 (52%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA ++ T Q        K V   G+ S  ++V         
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQ--------KVVLKTGDKSDPNVV--------- 81

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
               RE+   +  ++P + +LY+V  T T +++ LEY    EL++ L+ +  LP  E   
Sbjct: 82  ----REVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAE 137

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  
Sbjct: 138 LFAQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTV 197

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++   PY GF  D+WS GVIL+ LL G LPFDE+D      LL  QK   + P  
Sbjct: 198 YMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVI 252

Query: 256 DE--VSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
           DE     EAQ+LI ++L+ DP  R     IL HP LQ Y ++
Sbjct: 253 DERITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  192 bits (489), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 166/287 (57%), Gaps = 22/287 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVI---SKAVFNAGNM----------- 60
           ++G W+  ET+G GS GKV+LA+++ T +  AVK++   +KA  +   M           
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 61  -SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                +   I+ D       RE  + ++L HP++ RL+++   +   Y++ EY   G+L 
Sbjct: 176 ERQKKLEKEISRDKRTI---REASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLL 232

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 233 DYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSN 292

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++ 
Sbjct: 293 IYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV- 351

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            L  K+++G+ E P    +S E   L+ K+L VDPKRR   + +++H
Sbjct: 352 -LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  186 bits (473), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 163/287 (56%), Gaps = 16/287 (5%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
            G + LG+TLG G  GKV+L    +   +      SK + N  +M     +  I  D L 
Sbjct: 56  FGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSK-LGNYSHMPKQVAIKLIRRDTLS 114

Query: 76  YGIE------REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129
              E      REI  +K+L HPN+++L +V + +  + +VLEYA  GE +  +  +  L 
Sbjct: 115 ASKESEIKLYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIKFKKRLK 174

Query: 130 ENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE-GKLLE 188
           E++A   F Q+I GVSY H+ G+VHRDLK ENLLLD   N+ I DFG     T+  KL+ 
Sbjct: 175 ESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFGFVNEVTKTNKLMH 234

Query: 189 TSCGSPHYAAPEIVSGI-PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR-----TLL 242
           T CGSP YAAPE+V+ + PY    +D+WSCGVIL+A+L G LP+D++  NI       L 
Sbjct: 235 TPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDDPKNINGTDIVKLY 294

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
             ++    + P  + ++   +DL+ ++L +DP +R+  + IL+H  +
Sbjct: 295 KYIENQPLKFP--EYINMVPRDLLRRMLEIDPAKRMSMKHILQHAWI 339

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  191 bits (485), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 165/290 (56%), Gaps = 23/290 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA--VFNAGNMSGTSIVGSITPD 72
           ++G W   ET+G GS GKV+LA+N+ T +  A+K++++A  +F +   +     G   P 
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKH-NGYTIPL 125

Query: 73  ALPYGIER----------------EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKG 116
           +    IER                E  + ++L HP++ RLY++   +   Y++ EY   G
Sbjct: 126 SEKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGG 185

Query: 117 ELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFG 176
           +L + +++ G L E+ A  F RQI   + Y H+  IVHRDLK EN+++    NIK+ DFG
Sbjct: 186 QLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFG 245

Query: 177 MAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDG 236
           ++ L  +   L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 246 LSNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 305

Query: 237 NIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
           N+  L  K+++G+   P    +S E   L+ K+L VDP +R     ++ H
Sbjct: 306 NV--LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  190 bits (482), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 157/290 (54%), Gaps = 29/290 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           T GP+ +G TLG G  GKV+L  + S  +E +  V  K V                 D +
Sbjct: 61  TFGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRR---------------DTI 105

Query: 75  P------YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
           P        I REI  +K LNHPN++RL +V + +  + +VL+YA  GE +  + ++  L
Sbjct: 106 PKHSEKEVKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRL 165

Query: 129 PENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE 188
            E  A R F Q+I GV Y H  G+ HRDLK ENLLLD   N+ I DFG      +  L++
Sbjct: 166 KEPPACRLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMK 225

Query: 189 TSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDE-----EDGNIRTLL 242
           TSCGSP YAAPE +V+  PY+   +DVWSCGVIL+A+L G LP+D+     E  +I  L 
Sbjct: 226 TSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLY 285

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
             + K   + P  + +    +DL+ +IL  +P  R+   +I  H  L+ +
Sbjct: 286 HYITKSALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  191 bits (484), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 164/294 (55%), Gaps = 40/294 (13%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTG------QEAAVKVISKAVFNAGNMSGTSIVGS 68
           T GP+ +G TLG G  GKV+L   K++       ++ A+K+I +                
Sbjct: 68  TFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRR---------------- 111

Query: 69  ITPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
              DA+  G E+EI I      +K L HPN++RL +V + +  + +VLEYA  GE +  +
Sbjct: 112 ---DAIVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYI 168

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALE 181
            ++  L E+ A   F Q++ GV Y H  G+VHRDLK ENLLLD   N+ I DFG      
Sbjct: 169 QKKRRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLIITDFGFVNEFS 228

Query: 182 TEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEE----DG 236
              +L++TSCGSP YAAPE+V S  PY+   +D+WSCG+ILFA+L G LP+D++    DG
Sbjct: 229 KFSELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDG 288

Query: 237 N-IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
           N I  L   +     + P  + +S  A+DL+  IL   P++R   + ILKH  L
Sbjct: 289 NDIAKLYKYITTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQILKHQWL 340

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  188 bits (478), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 180/344 (52%), Gaps = 45/344 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG-----QEAAVKVISKAVFNAGNMSGTSIV 66
           K  T GP+ +G TLG G  GKV+L   K+       ++ A+K+I +              
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRR-------------- 84

Query: 67  GSITPDA-LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
            SI  DA     I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +
Sbjct: 85  DSIKKDADKEVKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRK 144

Query: 126 GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E+ A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG       + 
Sbjct: 145 RRLKESSACRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDN 204

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L+ TSCGSP YAAPE +VS   Y+   +DVWSCGVIL+A+L G LP+D++  N     I
Sbjct: 205 ELMRTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 239 RTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY------ 292
             L   + +   + P  + ++   +DL+ +IL  +P+RR+  R I +H  L+ +      
Sbjct: 265 ARLYQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPHHAFLSI 322

Query: 293 -PSIRDSK--------SIRG-LPREDTYLTPLSESNSSIDATIL 326
            P+  D +        S RG + R  TY +P S    S D   L
Sbjct: 323 QPNYWDEQLRKERPQLSTRGDVGRHTTYSSPTSPDPKSRDRNSL 366

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  190 bits (483), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 187/348 (53%), Gaps = 32/348 (9%)

Query: 4   NGNSVPAIKDNT-------IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA--- 53
           N N+ P I + T       +G W   ET+G GS GKV+LA++  T +  A+K++++A   
Sbjct: 142 NRNTAPIISNETKQFHRRSLGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKA 201

Query: 54  -VFNAGNMSGTSIVGSITPDALPYGIE--------REIIIMKLLNHPNVLRLYDVWETNT 104
            +    +M        I         E        RE  + ++L HP++ RL+++   + 
Sbjct: 202 FLHKEQSMPPPKNEQEIAERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSN 261

Query: 105 DLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL 164
             Y++ EY   G+L + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++
Sbjct: 262 HFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMI 321

Query: 165 DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFAL 224
            +   IKI DFG++ +    K L T CGS ++AAPE++   PY G   DVWS G++L+ L
Sbjct: 322 SNSGEIKIIDFGLSNVFDNRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVL 381

Query: 225 LTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDIL 284
           + G++PFD+E+ ++  L  K+++G+ E P  + +S E   L+ K++ VDP +R   R ++
Sbjct: 382 VCGKVPFDDENSSV--LHEKIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVV 437

Query: 285 KHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESNSSIDATILQNLVIL 332
           +HP + +     D   +  LPR    LTP      +ID  +L+ +  L
Sbjct: 438 EHPWMTRG---YDFPPLSYLPRR-IPLTP-----EAIDNNVLREMFRL 476

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  190 bits (482), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 170/294 (57%), Gaps = 19/294 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           ++G W   ET+G GS GKV+LAR+  T +  A+K++++A+    +   +        + L
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVL 217

Query: 75  PYG--IEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 218 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 277

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 278 IQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFD 337

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 338 RKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 395

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK---YP 293
            K+++G+ + P  + +S E   L+ K+L VDP RR   + +++HP + +   YP
Sbjct: 396 EKIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  189 bits (479), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 160/297 (53%), Gaps = 37/297 (12%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQL----ARNKSTGQEAAVKVISKAVFNAGNMSGTSIVG 67
           K  T GP+ +G TLG G  GKV+L    AR     +  A+K+I +               
Sbjct: 38  KQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR--------------- 82

Query: 68  SITPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
               D +P   E+EI I      +KLL+HPN++RL +V + +  + +VL+YA  GE +  
Sbjct: 83  ----DTVPKNSEKEIKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKY 138

Query: 122 LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           + ++  L E  A R F Q+I GV Y H  G+ HRDLK ENLLLD   N+ I DFG     
Sbjct: 139 IQKKRRLKEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEF 198

Query: 182 TEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN--- 237
            +  L+ TSCGSP YAAPE +VS  PY    +DVWSCGVIL+A+L G LP+D++  N   
Sbjct: 199 HKNDLMRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEG 258

Query: 238 --IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
             I  L   +     + P  + +    +DL+ +IL  +P+ R+   DI +H  LQ +
Sbjct: 259 EDIAKLYQYITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  189 bits (479), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 165/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           ++G W   ET+G GS GKV+LAR++ T +  A+K++++A  +  +            +AL
Sbjct: 75  SLGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQMTPPKSEQEAL 134

Query: 75  --PYGIEREI----------IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 135 ERKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 194

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E  A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 195 IQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNMYD 254

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 255 PKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV--LH 312

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            K+++G+ E P    +S E   L+ K+L VDP +R   + ++ H  +Q+
Sbjct: 313 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  189 bits (480), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 170/296 (57%), Gaps = 18/296 (6%)

Query: 4   NGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGT 63
           +G  +      ++G W   ET+G GS GKV+LA+++ T +  A+K++++A  NA      
Sbjct: 63  SGTELKQFHRKSLGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRAT-NAFLHKEQ 121

Query: 64  SIVGSITPDAL---PYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVL 110
           S+      + +      +E+EI           + ++L HP++ RL+++   +   Y++ 
Sbjct: 122 SLPPPKKEEEILERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLF 181

Query: 111 EYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNI 170
           EY   G+L + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     I
Sbjct: 182 EYVSGGQLLDYIIQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEI 241

Query: 171 KIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLP 230
           KI DFG++ L  + K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++P
Sbjct: 242 KIIDFGLSNLFDKSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVP 301

Query: 231 FDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
           FD+E+ ++  L  K+++G+ E P    +S E   L+ K+L VDP RR   + +++H
Sbjct: 302 FDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  186 bits (473), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 165/294 (56%), Gaps = 29/294 (9%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG-----QEAAVKVISKAVFNAGNMSGTSIV 66
           K  T GP+ +G TLG G  GKV+L  +K++      ++ A+K+I +              
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRR-------------- 84

Query: 67  GSITPDA-LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
            +I  DA     I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +
Sbjct: 85  DTIKKDADKEVKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRK 144

Query: 126 GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E+ A R F Q+I GV+Y H  G+VHRDLK ENLL+D   N+ I DFG       + 
Sbjct: 145 RRLKESSACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDN 204

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L+ TSCGSP YAAPE +VS   Y+   +DVWSCGVIL+A+L G LP+D++  N     I
Sbjct: 205 ELMRTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 239 RTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
             L   + +   + P  + ++   +DL+ +IL  +P+RR+  R I +H  L+ +
Sbjct: 265 ARLYQYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  188 bits (478), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 164/284 (57%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           ++G W   ET+G GS GKV+LA++  T +  A+KV+++A     +   T        + L
Sbjct: 179 SLGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRATKGFLHKEQTLPPPQTEQEIL 238

Query: 75  PY--GIEREI----------IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 239 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 298

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 299 IQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYD 358

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             + L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 359 TTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 416

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            K+++G+ + P    +S E   L+ K+L VDPK+R   R +++H
Sbjct: 417 EKIKQGKVDYPQ--HLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  188 bits (478), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 161/284 (56%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA--VFNAGNMSGTSIVGSITPD 72
           ++G W   ET+G GS GKV+LA++  T +  A+K++++A   F     S  +        
Sbjct: 141 SLGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIM 200

Query: 73  ALPYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 201 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 260

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A RF R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L  
Sbjct: 261 IQHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYD 320

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 321 NRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 378

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            K+++G+ E      +S E   L+ K+L VDPKRR   + ++ H
Sbjct: 379 EKIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  186 bits (473), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 153/279 (54%), Gaps = 24/279 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +K+ + +G GS GKV LA ++ T Q        K V   GN +  ++V         
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQ--------KVVLKTGNKNDPNVV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
               RE+   +  + P++ +LY+V  T + +++ LEY    EL+  L+ +  +   E+ +
Sbjct: 77  ----REVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGK 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD K   KI DFG         +LET CG+  
Sbjct: 133 LFAQIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFDEED   +T    + +  F   +D
Sbjct: 193 YMAPELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEED-ETKTKWKIINEEPFY--ND 249

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPS 294
           D VS++A+DLI ++L  DP +R +   +L HP LQ Y S
Sbjct: 250 DVVSKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  185 bits (469), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 165/294 (56%), Gaps = 29/294 (9%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNKSTG-----QEAAVKVISKAVFNAGNMSGTSIV 66
           K  T GP+ +G TLG G  GKV+L   K++      ++ A+K+I +              
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRR-------------- 84

Query: 67  GSITPDA-LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
            +I  DA     I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +
Sbjct: 85  DTIKKDADKEIKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRK 144

Query: 126 GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E+ A R F Q+I GV+Y H  G+VHRDLK ENLLLD   N+ I DFG       + 
Sbjct: 145 RRLKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDN 204

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L++TSCGSP YAAPE +VS   Y+   +DVWSCGVIL+A+L G LP+D++  N     I
Sbjct: 205 ELMKTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 239 RTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
             L   + +   + P  + ++   +DL+ +IL  +P+RRI  + I +H  L+ +
Sbjct: 265 ARLYKYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  187 bits (474), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 163/293 (55%), Gaps = 22/293 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           ++G W   ET+G GS GKV+LA+++ T +  A+K++++A      M    + G   P   
Sbjct: 50  SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT--KSFMHKQQLQGLPPPATE 107

Query: 75  PYGIE----------------REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGEL 118
              +E                RE  + ++L HP++ RL+++   +   Y++ EY   G+L
Sbjct: 108 EELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQL 167

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
            + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++
Sbjct: 168 LDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLS 227

Query: 179 ALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNI 238
            +    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+E+ ++
Sbjct: 228 NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV 287

Query: 239 RTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
             L  K+++G+ E P    +S +   L+ K+L VDP +R   + ++ H  +QK
Sbjct: 288 --LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  186 bits (473), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 166/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA--VFNAGNMSGTSIVGSITPD 72
           ++G W+  ET+G GS GKV+L +++ T +   +K++++A   +     S  S        
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVL 162

Query: 73  ALPYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 163 ERQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 222

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 223 IQHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 282

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L 
Sbjct: 283 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 340

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            K++KG+ + PS   +S EA  L+ K++ VDP RR   + ++ HP + +
Sbjct: 341 EKIKKGKVDYPS--HLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  186 bits (473), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 163/288 (56%), Gaps = 16/288 (5%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA----VFNAGNMSGTSIVGSITP 71
           +G W   ET+G GS GKV+LA++  T +  A+K++++A    +    N+        I  
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQNLPPPKSEQEILQ 165

Query: 72  DALPYGIE--------REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLV 123
                  E        RE  + ++L HP++ RL+++   +   Y++ EY   G+L + ++
Sbjct: 166 RQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 225

Query: 124 ERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 183
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +   
Sbjct: 226 QHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVYDP 285

Query: 184 GKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLL 243
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  ++  L  
Sbjct: 286 RKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV--LHE 343

Query: 244 KVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           K+++G  E P  + +S E   L+ K+L VDP+RR   + +++HP + +
Sbjct: 344 KIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNR 389

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  186 bits (472), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 166/292 (56%), Gaps = 22/292 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGT----------- 63
           ++G W+  ET+G GS GKV+L +++ T +   +K++++A     +   T           
Sbjct: 102 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEIL 161

Query: 64  ----SIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                +   I  D       RE  + ++L HP++ RL+++   +   Y++ EY   G+L 
Sbjct: 162 ERQKRLEKEIARDK---RTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 218

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 219 DYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSN 278

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I 
Sbjct: 279 IFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI- 337

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            L  K++KG+ + PS   +S EA  L+ +++ +DP +R   ++++ HP + +
Sbjct: 338 -LHEKIKKGKVDYPS--HLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  186 bits (472), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 164/299 (54%), Gaps = 34/299 (11%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           ++G W   ET+G GS GKV+LA+++ T +  A+K++++A          S +       L
Sbjct: 111 SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT--------KSFIHKQQQQQL 162

Query: 75  P------------YGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
           P              +E+EI           + ++L HP++ RL+++   +   Y++ EY
Sbjct: 163 PPPSNEEELMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEY 222

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKI 172
              G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     I+I
Sbjct: 223 VSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRI 282

Query: 173 ADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFD 232
            DFG++ L    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD
Sbjct: 283 IDFGLSNLYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFD 342

Query: 233 EEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           +E+ ++  L  K+++G+ E P    +S +   L+ K+L VDP +R   + ++ H  +QK
Sbjct: 343 DENASV--LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  185 bits (470), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 168/301 (55%), Gaps = 25/301 (8%)

Query: 7   SVPAIKD---NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVF-------- 55
           S P IK     ++G W   ET+G GS GKV+LAR+  T +  A+K++++A          
Sbjct: 86  SKPEIKQFHRKSLGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQS 145

Query: 56  -----NAGNM--SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYL 108
                N   M      +   I+ D       RE  + ++L HP++ RL+++   +   Y+
Sbjct: 146 LAPPKNENEMLERQKKLEKEISRDKRTI---REASLGQVLYHPHICRLFEMCTMSNHFYM 202

Query: 109 VLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKY 168
           + EY   G+L + +++ G L E+ A +F R +   + Y HA  IVHRDLK EN+++    
Sbjct: 203 LFEYVSGGQLLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSG 262

Query: 169 NIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGR 228
            IKI DFG++ +    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G+
Sbjct: 263 EIKIIDFGLSNVFDTRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGK 322

Query: 229 LPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPL 288
           +PFD+E+ ++  L  K+++G+ E P  + +S E   L+ K+L VDP +R     +++HP 
Sbjct: 323 VPFDDENSSV--LHEKIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPW 378

Query: 289 L 289
           +
Sbjct: 379 M 379

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  185 bits (470), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 167/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA--VFNAGNMSGTSIVGSITPD 72
           ++G W+  ET+G GS GKV+L +++ T +   +K++++A   +     S  S        
Sbjct: 95  SLGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEIL 154

Query: 73  ALPYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 155 ERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 214

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 215 IQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 274

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L 
Sbjct: 275 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 332

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            K++KG+ + PS   +S E   L+ +++ VDP RR   +++++HP + +
Sbjct: 333 EKIKKGKVDYPS--HLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  181 bits (458), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 153/293 (52%), Gaps = 33/293 (11%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNK-----------STGQEAAVKVISKAVFNAGNMSGT 63
           T GP+ +G TLG G  GKV++   +            T ++ A+K+I +      +   T
Sbjct: 46  TFGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRDTIVRNSDKET 105

Query: 64  SIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLV 123
            I              REI  +K L HPN++ L ++ + +  + +VLEYA  GE +  + 
Sbjct: 106 KIY-------------REINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQ 152

Query: 124 ERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
            +  L E  A R F Q++ GV Y H+ G+VHRDLK ENLLLD   N+ I DFG       
Sbjct: 153 RKRRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSN 212

Query: 183 EGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN---- 237
           E  L++TSCGSP YAAPE +VS   Y G   D+WSCGVIL+A+L G LP+D++  N    
Sbjct: 213 ENVLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGD 272

Query: 238 -IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            I  L   +     + P  D V+   +DL+ +IL  DP+RR     I  H  L
Sbjct: 273 DISKLYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  184 bits (466), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 161/297 (54%), Gaps = 40/297 (13%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQ-------EAAVKVISKAVFNAGNMSGTSIVGS 68
            GP+ L  TLG G  GKV+L  +K++ Q       + A+K+I ++               
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSI------------- 127

Query: 69  ITPDALPYG------IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                LP G      + REI  +K L HPN+++L DV + +  + +VLEYA  GE +  +
Sbjct: 128 -----LPKGSNKEIKVYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYI 182

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALE 181
             +  L E  A + F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      
Sbjct: 183 QRKKRLKEINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFF 242

Query: 182 TEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEE----DG 236
              +L+ T CGSP YAAPE+V S  PY+   +D+WSCG+IL+A+L G LP+D++    DG
Sbjct: 243 QTNELMLTPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDG 302

Query: 237 N-IRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
           N I  L   +     + P  + +    +DL+ KIL  + K+RI  R I+ H  L+ +
Sbjct: 303 NDIARLYYYITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 160/292 (54%), Gaps = 22/292 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVF---------------NAGN 59
           ++  W   ET+G GS GKV+LA+NK++ +  A+K++ +A                 N   
Sbjct: 63  SLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAK 122

Query: 60  MSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                +   I+ D       RE  + ++L HPNV +LY++   +   Y+  E+   G+L 
Sbjct: 123 ERQKRLNKEISRDKRTV---REASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLL 179

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L EN A +  R I+  + Y HA  IVHRDLK EN++L     IK+ DFG++ 
Sbjct: 180 DYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSN 239

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           +    K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  N  
Sbjct: 240 MYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSS 297

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            L  K++KG+   P    +S +   L+ KIL VDP++R   + ++ H  + K
Sbjct: 298 ALHEKIKKGKVTYPQ--FLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  184 bits (466), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 166/297 (55%), Gaps = 32/297 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVI---SKAVFNAGNMSGTSIVGSITP 71
           ++G W+  ET+G GS GKV+L ++  T +   +K++   SKA  +  +        S+ P
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQH--------SLPP 154

Query: 72  D-----------------ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAE 114
                             A      RE  + ++L HP++ RL+++   +   Y++ EY  
Sbjct: 155 PKNENELLERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVS 214

Query: 115 KGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIAD 174
            G+L + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++ +   IKI D
Sbjct: 215 GGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIID 274

Query: 175 FGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE 234
           FG++ +    K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E
Sbjct: 275 FGLSNIFDSKKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDE 334

Query: 235 DGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           + +I  L  K++KG+ + PS   +S +A  L+ +++ VDP +R   +++  HP + +
Sbjct: 335 NSSI--LHEKIKKGKVDYPS--HLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  183 bits (464), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 161/289 (55%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           ++G W   ET+G GS GKV+LA+++ T +  A+K++++A  +  +            + +
Sbjct: 94  SLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELM 153

Query: 75  PYGIE------------REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
               +            RE  + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 154 ERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 213

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E  A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 214 IQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYD 273

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS GV+++ L+ G++PFD+E+ ++  L 
Sbjct: 274 NKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV--LH 331

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            K++KG+ E P    +S E   L+ K+L VDP +R   + +  H  +Q+
Sbjct: 332 EKIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  182 bits (462), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 104/341 (30%), Positives = 180/341 (52%), Gaps = 47/341 (13%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
           ++G W   ET+G GS GKV+LA+++ T +  A+K++++A          +++   +    
Sbjct: 180 SLGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRAT--------KALIHKESQQPP 231

Query: 75  PYGIE--------------------REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAE 114
           P   E                    RE  + ++L HP++ RL+++   +   Y++ EY  
Sbjct: 232 PRTQEEVLERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVS 291

Query: 115 KGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIAD 174
            G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     IKI D
Sbjct: 292 GGQLLDYIIQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIID 351

Query: 175 FGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE 234
           FG++ +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E
Sbjct: 352 FGLSNMFNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDE 411

Query: 235 DGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK--- 291
           + ++  L  K+++G+ E P    +S E   L+ K+L VDP +R   + ++ H  +Q+   
Sbjct: 412 NSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQRGYD 467

Query: 292 YPSIRDSKSIRGLPREDTYLTPLSESNSSIDATILQNLVIL 332
           +P+          P    +  PL+    ++D T++Q +  L
Sbjct: 468 FPA----------PSYIPHRVPLTA--DALDPTVIQEMYRL 496

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  181 bits (458), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 159/287 (55%), Gaps = 22/287 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAV--FNAGNMSGTS-------- 64
           ++G W    T+G GS GKV+LAR++      AVK++++A   F     S  +        
Sbjct: 114 SLGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQSAPAPQSKADIK 173

Query: 65  -----IVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                +   I  D       RE  + ++L+H N+ +LY +   +   Y++ EY   G+L 
Sbjct: 174 ERERLLAKEIARDTRTV---REASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLL 230

Query: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E  A  F R I  G++Y HA  +VHRDLK EN++L     IKI DFG++ 
Sbjct: 231 DYIIQHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSN 290

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           L      L T CGS ++AAPE++   PY G   D+WS GVIL+ L+ G++PFD+E+ N  
Sbjct: 291 LFDPRAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSN-- 348

Query: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            L  K+++G+   P+   +S E   L+ K+LTV+PKRR   ++I+ H
Sbjct: 349 ALHEKIKRGKVSYPA--TLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  180 bits (456), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 152/279 (54%), Gaps = 24/279 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA+++ T         +K V  + + +  +IV         
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTH--------TKVVLKSSDKNDPNIV--------- 77

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
               RE+   +  ++P + +LY+V  T T +++ LEY    EL++ ++    +P +E ++
Sbjct: 78  ----REVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQ 133

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+ GV Y H+L  VHRDLK EN+LLD   + K+ DFG          LET CG+  
Sbjct: 134 LFAQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTV 193

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFDE+D       +  Q  Q    ++
Sbjct: 194 YMAPELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NE 250

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPS 294
           + V+ +A+DLI ++L  +P  R     ILKHP LQ + S
Sbjct: 251 NIVTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  179 bits (455), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 176/351 (50%), Gaps = 44/351 (12%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA +K T ++  +K   K+  N                   
Sbjct: 34  VGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKSDPN------------------- 74

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             + RE+   +  + P + +LY+V  T T +++ LEY    EL+  L+    +P +E  +
Sbjct: 75  --LVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAK 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 133 LFAQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFDE+D   +T    V    F   +D
Sbjct: 193 YMAPELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDD-ETKTKWKIV--NDFPNFND 249

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLS 315
           + VS EA+DLI ++L   P  R     IL HP LQ Y  I  S++ + + R+   +T   
Sbjct: 250 NFVSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQRLGMTQF- 308

Query: 316 ESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCD 366
              S ++  +L+                +LK+ G +A+ ++ A + + KCD
Sbjct: 309 --RSRLERKLLK----------------RLKQSGFDAQ-SIKASIQKKKCD 340

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  179 bits (453), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 158/294 (53%), Gaps = 37/294 (12%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEA---AVKVISKAVFNAGNMSGTSIVGSITP 71
           T GP+ +G TLG G  GKV+L  +KS   E+   A+K+I +                   
Sbjct: 52  TFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRR------------------- 92

Query: 72  DALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
           D +P   E+E+ I      +K L HPN++ L +V + +  + +VL YA  GE +  + ++
Sbjct: 93  DTIPKNSEKEVKIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKK 152

Query: 126 GPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E  A R F Q+I GV Y H  G+ HRDLK ENLLLD   N+ I DFG      +  
Sbjct: 153 RRLKEPAACRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRN 212

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRL-----PFDEEDGNI 238
            L++TSCGSP YAAPE +V+   Y+   +DVWSCGVIL+A+L G L     P + +  +I
Sbjct: 213 DLMKTSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDI 272

Query: 239 RTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
             L   + K   + P  + ++   +D++ +IL  DP +RI    ILKH  LQ +
Sbjct: 273 AKLYNYITKTSLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  179 bits (453), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 161/284 (56%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDAL 74
            +G W   ET+G GS GKV++A++  T +  A+K+I++A     +            +AL
Sbjct: 136 ALGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLPPPQNEQEAL 195

Query: 75  PYG--IEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + + L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 196 ERQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 255

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 256 IQHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMFD 315

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
               L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 316 PRTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 373

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            K+++G+ + P    +S E   L+ K+L VDP++R   + +++H
Sbjct: 374 EKIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  176 bits (446), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 158/301 (52%), Gaps = 30/301 (9%)

Query: 9   PAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGS 68
           P +K+  +G +K+ + +G GS GKV LA ++ T          K V    N S  +IV  
Sbjct: 30  PDLKE--VGNYKILDQIGEGSFGKVYLASHRLTH--------CKVVLKTSNKSDPNIV-- 77

Query: 69  ITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
                      RE+   +  ++P + +LY+V  T + +++  EY    +L++ ++    +
Sbjct: 78  -----------REVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRV 126

Query: 129 PENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE 188
           P +  I  F QI+  V Y H+L  VHRDLK EN+LLD   N K+ DFG          LE
Sbjct: 127 PSSACIELFTQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLE 186

Query: 189 TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG 248
           T CG+  Y APE++    Y GF  D+WS GVIL+ +L G +PFDE+D           K 
Sbjct: 187 TICGTTVYMAPELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDETKTEW-----KI 241

Query: 249 QFELP--SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPR 306
             E+P  +D  +S +A+DL+ K+L+ DP  R   ++IL HP LQ Y S+   K+ R L +
Sbjct: 242 MNEMPVFNDTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRK 301

Query: 307 E 307
           +
Sbjct: 302 Q 302

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  168 bits (426), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 154/272 (56%), Gaps = 24/272 (8%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG GS G V+ AR  STG   AVK++ K       + G  +   +  D        
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKA-----LKGNDVQLQMLYD-------- 94

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E++I++ LNHPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   QI
Sbjct: 95  ELMILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQI 154

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPENLL LD   N  + + DFG+A  L+ +G L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGY 214

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ----FEL 252
            APE+++   + G   D+WS GVI + LL G  PF  E  ++   L +   GQ    F  
Sbjct: 215 VAPEVLTSNGH-GKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHK 271

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDIL 284
           P  + +S+EA+  I ++LT+ PK+R  A D+L
Sbjct: 272 PYWNNISKEAKLFILRVLTISPKKRPTATDLL 303

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  166 bits (420), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 151/294 (51%), Gaps = 29/294 (9%)

Query: 6   NSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSI 65
           NS   IK  T   + +G  LG G  GKV   R+K +G   A+KV+ K             
Sbjct: 100 NSNLRIKSFTKDDFDIGLKLGKGKFGKVFCVRHKESGFICALKVMQKT------------ 147

Query: 66  VGSITPDALPYGIEREII----IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
                 D L Y +ER+ I    I   LNHPN+ +LY  +     +YL++EY   GEL+  
Sbjct: 148 ------DILQYKLERQFIREVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKT 201

Query: 122 LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           L   GP     A  +  QI   + Y H   I+HRD+KPEN+L+     +K+ DFG + + 
Sbjct: 202 LEIHGPFENAVATNYVYQIASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIIN 261

Query: 182 TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241
            +G    T CG+  Y +PEIV    Y     D+W+ G++ + LL G  PF+E   N + L
Sbjct: 262 PKGLRRRTFCGTIDYLSPEIVDYKEYD-HNVDIWALGIVAYELLVGSPPFEE---NTKDL 317

Query: 242 LL-KVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPS 294
              ++++G    P   +V+ EA+D I +IL ++PK+R+  ++I+ HP + KY S
Sbjct: 318 TYERIRRGDIVFPK--QVTPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  167 bits (422), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 159/296 (53%), Gaps = 31/296 (10%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           ++ G+T+G G+ G V+ A   STG+E AVK+I K       + G  I   +  D      
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKA-----LEGNDIQLQMLYD------ 89

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L HPN++     +E+   +Y+V + A  GELF+ +++RG   E +A+    
Sbjct: 90  --ELAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVV 147

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEGKLLETSCGSP 194
           QI+  V Y H+  +VHRDLKPEN+L      K  I IADFG+A  LE EG L+  + GS 
Sbjct: 148 QILKAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSL 207

Query: 195 HYAAPEIV--SGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQF 250
            Y APE++  SG    G   D+WS G+I + LL G  PF  E  DG +  ++   +   F
Sbjct: 208 GYVAPEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAF 264

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPR 306
             P  DE+S EA+  I + +T+DP +R  A ++LK P +        SK  +G  R
Sbjct: 265 HSPYWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWIT-------SKGFKGAER 313

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  173 bits (439), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 150/282 (53%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +++ + +G GS GKV LA +K T Q        K V   G  S  ++V         
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQ--------KVVLKTGAKSDPNVV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
               RE+   +   +P + +LY+V  T T +++ LEY    EL++ L+ +  +P +E  R
Sbjct: 77  ----REVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRR 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  
Sbjct: 133 LFAQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS- 254
           Y APE++    Y G+  D WS G+IL+ +L G +PFDE+D  +RT L    K   E P+ 
Sbjct: 193 YMAPELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGL----KIMHEEPAV 247

Query: 255 -DDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
            D+  S +A+DLI ++L  +  +R    ++L+HP LQ Y ++
Sbjct: 248 LDEYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  172 bits (436), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 149/279 (53%), Gaps = 28/279 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA ++ T ++  +K  SK                  P+ + 
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSKT----------------DPNVV- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
               RE+   +  +HP + +LY++  T T +++ LEY    EL++ L+    +P +E  R
Sbjct: 77  ----REVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSR 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD + N K+ADFG          LET CG+  
Sbjct: 133 LFAQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  D+WS GVIL+ L+ G +PFDEED   RT    +     E P  
Sbjct: 193 YMAPELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEED-ETRTEWKIIN----EEPDY 247

Query: 256 DE--VSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
           +E   +  + +LI  +L  DPK+R    +ILKH  L+ Y
Sbjct: 248 NEKIFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  164 bits (416), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 150/270 (55%), Gaps = 20/270 (7%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG G+ G V+ AR  S+G+  AVK++ K       + G S+   +  D        
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKILLKKA-----LKGQSVQLQMLYD-------- 94

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ LNHPN++R  D +E+    Y+V + A  GELF+ ++E+G   E +A+   +QI
Sbjct: 95  ELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQI 154

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSPHY 196
           + GV Y H   IVHRDLKPEN+L  +K +   + I DFG+A  L+ + +L+  + GS  Y
Sbjct: 155 LQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGY 214

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  DG I           F  P 
Sbjct: 215 VAPEVLTSSGH-GKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPY 273

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDIL 284
            + VS+ A++ I   LTV PKRR  A D++
Sbjct: 274 WNNVSKTAKEFILWALTVSPKRRPTATDLI 303

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  172 bits (436), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 108/345 (31%), Positives = 177/345 (51%), Gaps = 29/345 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ E +G GS GKV LA ++ T ++    VI  +V N  N                
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKV---VIKSSVKNDPN---------------- 83

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             I RE+   +   +  + +LY++  T + +++ LEY    EL++ +++   +P  E I+
Sbjct: 84  --IVREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQ 141

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD   N K+ DFG      E   LET CG+  
Sbjct: 142 LFSQIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTV 201

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE+    PY GF  D+WS GVIL+ +L+G +PFDE+D       +  ++ ++   + 
Sbjct: 202 YMAPELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NS 258

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLS 315
             ++ E +DL+ K+L  D   R   R+IL+H  LQ Y +   +++   + R+    T   
Sbjct: 259 KFMTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPYGTTVLTQTDNLIARQRKGATNF- 317

Query: 316 ESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
             +S ++  +L+ L     G D   IK+ + +   ++   L+ LL
Sbjct: 318 --HSKLERRVLKRLNRC--GFDTQSIKQSVIKKKCDSLAGLWCLL 358

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  171 bits (433), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 154/292 (52%), Gaps = 24/292 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           IG +K+ + +G GS GKV LA ++ T Q        K V   GN    ++V         
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQ--------KVVLKTGNKRDPNVV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
               RE+   +  + P + +LY+V  T + +++VLEY    EL+  L++   L   E+ +
Sbjct: 77  ----REVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKK 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+  
Sbjct: 133 LFSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  D+WS G+IL+ ++ G +PFDE+D +I+T  LK+   + +  + 
Sbjct: 193 YMAPELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD-DIKT-KLKIVNDELDF-NQ 249

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPRE 307
           + +S +A DLI  +L  +P  RI    +L HP LQ +  +   K+ + L ++
Sbjct: 250 EWISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDKVLLKQ 301

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 113/350 (32%), Positives = 175/350 (50%), Gaps = 39/350 (11%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA +K T ++  +K                     T D   
Sbjct: 34  VGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLK---------------------TSDKND 72

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             + RE+   +  ++  + RLY+V  T T +++ LEY    EL+  L+    +  +E  R
Sbjct: 73  PNVVREVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSR 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  + Y H+L  VHRDLK EN+LLD K N K+ DFG          L+T CG+  
Sbjct: 133 LFAQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP-- 253
           Y APE+     Y GF  D+W+ GVIL+ ++ G +PFDE+D   +T    V     E+P  
Sbjct: 193 YMAPELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDD-EAKTKWKIVN----EMPEI 247

Query: 254 SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY--PSIRDSKSI-RGLPREDTY 310
           ++D VS +A+DLI ++L  DP  R     IL HP LQ Y  P +  ++ I R   R   +
Sbjct: 248 NEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIPLMEKTQKILRKQRRGSVH 307

Query: 311 LTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
                  +S ++  +L+ L  +  G D   +K  +++   +A   L+ LL
Sbjct: 308 F------HSKLERKLLKRLKQM--GFDTQSMKASVQKKKCDALSGLWLLL 349

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  169 bits (428), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 145/282 (51%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA +K T Q        K V   G     ++V         
Sbjct: 34  VGNYKILKQVGEGSFGKVYLANHKLTHQ--------KVVLKTGEKKDPNVV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
               RE+   +  + P + +LY+V  T + +++ LEY    EL++ L+++  +P +E  +
Sbjct: 77  ----REVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSK 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD +    + DFG          LET CG+  
Sbjct: 133 LFAQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS- 254
           Y APE++    Y G+  D WS G+IL+ +L G +PFDEED  +  L     K   E+P  
Sbjct: 193 YMAPELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTGL-----KIMNEMPPI 247

Query: 255 -DDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
            D   +  A+DLI K+L   P  R     +L+HP LQ Y +I
Sbjct: 248 VDAYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  162 bits (411), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 152/275 (55%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG G+ G V+ AR  +TG++ AVK++ K      N+    +               
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALKGNNVQLQMLYD------------- 100

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +A+    Q+
Sbjct: 101 ELAILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQL 160

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEGKLLETSCGSPHY 196
           I  VSY H+  IVHRDLKPEN+L LD+  N  + IADFG+A  L++   L+    GS  Y
Sbjct: 161 ISAVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGY 220

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI + LL+G   F  E  +G +          +F  P 
Sbjct: 221 VAPEVLTREGH-GKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPY 279

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            D +S+EA+D I + LT+DP  R  A ++L+ P +
Sbjct: 280 WDNISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  169 bits (429), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 146/282 (51%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +++   +G GS GKV LA +  T ++  +K  +K+  N                   
Sbjct: 34  VGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKSDPN------------------- 74

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             + RE+   +    P + +LY++  T T +++ LEY    EL+  L+    +P +E  R
Sbjct: 75  --VVREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSR 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   + Y H+L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  
Sbjct: 133 LFAQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  DVWS GVIL+ LL G +PFDEE    +    K+     E+PS 
Sbjct: 193 YMAPELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSF 247

Query: 256 DE--VSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
           D   +  +A DL+ K+L  DP  R   +++L+HP LQ Y ++
Sbjct: 248 DSTLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  168 bits (426), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 104/345 (30%), Positives = 173/345 (50%), Gaps = 29/345 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +++ + +G GS GKV LA ++ T Q+  +K+ SK   N                   
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSKNDPN------------------- 74

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             + RE+   +  ++  + +LY+V  T   +++ LEY    EL+  L+ +  +P +E   
Sbjct: 75  --VVREVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSH 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H++  VHRDLK EN+LLD K   K+ DFG         +LET CG+  
Sbjct: 133 LFSQIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++   PY+G+  D WS G+IL+ ++ G +PFDEED +I+T    V    F    D
Sbjct: 193 YMAPELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DD 249

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLS 315
           + +    +DLI ++L  DP +R     +L+HP +  + S    K+ + + R+        
Sbjct: 250 NFIDANGKDLIMQLLQKDPSQRPSLTQVLQHPFMFPHGSSILEKTDKTIKRQSQGCKHF- 308

Query: 316 ESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360
             +S ++  +L+ L     G D   IK+ + +   +A    + LL
Sbjct: 309 --HSKLERRLLKKLK--QSGFDTQAIKQSVNKKKCDALAGTWQLL 349

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  161 bits (408), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 160/309 (51%), Gaps = 28/309 (9%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG GS G V+ AR  STG++ AVK++ K       + G  +   +  D        
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKA-----LQGNEVHLQMLYD-------- 86

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HP+++   D +E+    Y+V + A  GELF+ ++ RG   EN+A++   Q+
Sbjct: 87  ELSILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQL 146

Query: 141 IIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L        ++ IADFG+A  L+    ++  + GS  Y
Sbjct: 147 LDAVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGY 206

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++ +   G A D+WS GVI + LL+G   F  E  +G +           F  P 
Sbjct: 207 VAPEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPY 265

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK--------YPSIRDSKSIRGLPR 306
            D++S EA+  I   LT++P+ R  A  +L HP +           PS+R+    R   R
Sbjct: 266 WDKISDEAKKFILSALTIEPEERPTAEQLLSHPWITSTMSHDADLLPSVREGFDARKKFR 325

Query: 307 EDTYLTPLS 315
           E   +  L+
Sbjct: 326 EAVEIVKLN 334

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  168 bits (425), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 146/281 (51%), Gaps = 28/281 (9%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73
           N +G +K+ + +G GS GKV LA +K T ++  +K                     + D 
Sbjct: 34  NEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLK---------------------SSDK 72

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
               + REI   +  + P + +LY+V  T T +++V+EY    EL++ L+ +  +  +E+
Sbjct: 73  TDPNVVREIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDES 132

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
            R F QI+  V Y H+L  VHRDLK EN+LLD   N K+ DFG     ++   LET CG+
Sbjct: 133 ARIFAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGT 192

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFE-- 251
             Y APE++    Y G+  D+W+ G++L+ ++ G +PFDE+D     L +      ++  
Sbjct: 193 TVYMAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNK 252

Query: 252 LPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
             +DD +     DL+ ++L+ DP  R     IL HP L  Y
Sbjct: 253 YFNDDSI-----DLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  167 bits (424), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 155/290 (53%), Gaps = 36/290 (12%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
           + E +G G+   V+ A  ++TG+  AVK+ISK     GNM G               + R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKV-IGNMDG---------------VTR 243

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ +++ LNHP ++RL   +E     Y+V+E+   G+L + +   G + E+      RQI
Sbjct: 244 ELEVLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 141 IIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAA 198
           +  V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y A
Sbjct: 304 LTAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 199 PEIVSGIPYQG----------FAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-V 245
           PE++ G               ++S  D+WS G +++ +LTG LPF    G+ +  L K +
Sbjct: 364 PEVIRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQI 420

Query: 246 QKGQF-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYP 293
            +G + E P  D  +S EA+D I  +L VDP  R+ A   L HP ++  P
Sbjct: 421 GRGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  167 bits (423), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 104/307 (33%), Positives = 164/307 (53%), Gaps = 42/307 (13%)

Query: 3   VNG-NSVPA----IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNA 57
           +NG N +P+    +KD +I      E +G G+   V+ A  +STG+  AVK+I+K     
Sbjct: 180 LNGLNGIPSQQGILKDFSIND----EVVGQGAFATVKKAVERSTGRTFAVKIINKRKV-M 234

Query: 58  GNMSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGE 117
           GN+SG               + RE+ I++ L+HP ++RL   +E     YLV+E+   G+
Sbjct: 235 GNLSG---------------VTRELEILRKLDHPRIVRLKGFYEDEESYYLVMEFVSGGD 279

Query: 118 LFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADF 175
           L + +   G + E+      RQI+  V+Y H  GI HRD+KP+N+L+  D    +KI DF
Sbjct: 280 LMDFVAAHGSVGEDAGREITRQILEAVAYMHEKGISHRDIKPDNILIEQDDPVLVKITDF 339

Query: 176 GMAALETEGKLLETSCGSPHYAAPEIVSG----------IPYQGFASDVWSCGVILFALL 225
           G+A ++  G  ++T CG+  Y APE++SG          I Y     D+WS G +++ +L
Sbjct: 340 GLAKVQGNGTFMKTFCGTLAYVAPEVISGKNAATENDDRIEYSSLV-DMWSIGCLVYVIL 398

Query: 226 TGRLPFDEEDGNIRTLLLKVQKGQF-ELP-SDDEVSREAQDLICKILTVDPKRRIKARDI 283
           T  LPF       + L  ++ +G + E P  D  VS EA+D I  ++ VDP  R+ A+D 
Sbjct: 399 TAHLPF--SGSTQQELYEQINRGSYHEGPLKDYRVSEEARDFIESLIQVDPNNRLTAKDA 456

Query: 284 LKHPLLQ 290
           LKH  ++
Sbjct: 457 LKHEWIK 463

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  167 bits (422), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 144/277 (51%), Gaps = 24/277 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA +  T Q+  +K+ SK   N                   
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSKNDPN------------------- 74

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             + RE+   +  ++ ++ +LY+V  T   +++ LEY    EL+  L+ +  +P  E   
Sbjct: 75  --VVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSE 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H++  VHRDLK EN+LLD K + K+ DFG         +LET CG+  
Sbjct: 133 LFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++   PY+G+  D WS G+IL+ ++ G +PFDE D  ++T    V         +
Sbjct: 193 YMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVD-EVKTKYKIVHYN--PTYDN 249

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292
           D +    ++LI ++L  DP +R     +L+HP LQ Y
Sbjct: 250 DYIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  166 bits (420), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 153/291 (52%), Gaps = 38/291 (13%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
           + E +G G+   V+ A  ++TG+  AVK+ISK     GNM G               + R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKV-IGNMDG---------------VTR 243

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ +++ LNHP ++RL   +E     Y+V+E+   G+L + +   G + E+      RQI
Sbjct: 244 ELEVLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 141 IIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAA 198
           +  V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y A
Sbjct: 304 LAAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 199 PEIVSGI-------------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK- 244
           PE++ G               Y     D+WS G +++ +LTG LPF    G+ +  L K 
Sbjct: 364 PEVIRGKDSSVSPDECEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQDQLYKQ 419

Query: 245 VQKGQF-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYP 293
           + +G + E P  D  +S EA+D I  +L VDP  R+ A   L HP ++  P
Sbjct: 420 IGRGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIKMNP 470

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  165 bits (418), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 157/298 (52%), Gaps = 39/298 (13%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  ++TG+  AVK+I+K     GNM G S               RE+
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKRKV-VGNMDGVS---------------REL 235

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ LNHP ++ L   +E   + Y+V+E+   G+L + +   G + E       RQI+ 
Sbjct: 236 EVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILE 295

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            + Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++  G +++T CG+  Y APE
Sbjct: 296 AIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPE 355

Query: 201 IVSGIP--------------YQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLL-KV 245
           ++ G                Y     D+WS G ++F +LTG LPF    G+ +  L  ++
Sbjct: 356 VIGGFTGATGEEETEEERIEYSSLV-DMWSMGCLVFVILTGHLPF---SGSTQEQLYEQI 411

Query: 246 QKGQF-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSI 301
           +KG + E P  D  +S EA+D I  +L VD  +R+   D L HP +++  S  D+ S+
Sbjct: 412 RKGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  166 bits (419), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 157/307 (51%), Gaps = 42/307 (13%)

Query: 5   GNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTS 64
            N     KD +I    + E +G G+   V+ A  ++TG+  AVK+ISK     GNM G  
Sbjct: 188 ANKTGIFKDFSI----IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKV-IGNMDG-- 240

Query: 65  IVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
                        + RE+ +++ LNHP ++RL   +E     Y+V+E+   G+L + +  
Sbjct: 241 -------------VTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAA 287

Query: 125 RGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALET 182
            G + E+      RQI+  + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++ 
Sbjct: 288 HGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQG 347

Query: 183 EGKLLETSCGSPHYAAPEIVSGI-------------PYQGFASDVWSCGVILFALLTGRL 229
            G  ++T CG+  Y APE++ G               Y     D+WS G +++ +LTG L
Sbjct: 348 NGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLV-DMWSMGCLVYVILTGHL 406

Query: 230 PFDEEDGNIRTLLLK-VQKGQF-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKH 286
           PF    G+ +  L K + +G + E P  D  +S EA+D I  +L VDP  R  A   L H
Sbjct: 407 PF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNH 463

Query: 287 PLLQKYP 293
           P ++  P
Sbjct: 464 PWIKMSP 470

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  166 bits (419), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 153/289 (52%), Gaps = 40/289 (13%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  +STG+  AVK+ISK      NM G S               RE+
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMDGVS---------------REL 250

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ L+HP ++RL   +E + + Y+++E+   G+L + +   G + E+      RQI+ 
Sbjct: 251 EVLQRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILE 310

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 311 AIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPE 370

Query: 201 IVSGI----------------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK 244
           I+SG                  Y     D+WS G +++ +LTG LPF    G+ +  L K
Sbjct: 371 IISGKNDGELRENADANSERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQKQLYK 426

Query: 245 -VQKGQF-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
            + +G + E P  D  +S EA+D I  +L V P  R+ A   L+HP ++
Sbjct: 427 QISRGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  165 bits (417), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 155/296 (52%), Gaps = 38/296 (12%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
           + E +G G+   V+ A  ++TG+  AVK+ISK     GNM G               + R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKV-IGNMDG---------------VTR 243

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ +++ L+HP ++RL   +E     Y+V+E+   G+L + +   G + E+      RQI
Sbjct: 244 ELEVLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 141 IIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAA 198
           +  V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y A
Sbjct: 304 LEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 199 PEIVSGI-------------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK- 244
           PE++ G               Y     D+WS G +++ +LTG LPF    G+ +  L K 
Sbjct: 364 PEVIRGKDSSVSPDEYEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQDQLYKQ 419

Query: 245 VQKGQF-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDS 298
           + +G + E P  D  +S EA+D I  +L VDP  R+ A   L HP ++  P +  S
Sbjct: 420 IGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  165 bits (418), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 150/294 (51%), Gaps = 28/294 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA ++ T ++  +K                     T D   
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             I RE+   +  + P + +LY+V  T T +++ LEY    EL++ L+    +   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  D+WS GVIL+ L+TG LPFD++D  ++T    V     E P+ 
Sbjct: 197 YMAPELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNY 251

Query: 256 DE--VSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPRE 307
           D   +  +A+DLI ++L  +PK R     +L H  LQ Y S+   ++ + L R+
Sbjct: 252 DSTLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  164 bits (415), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 150/281 (53%), Gaps = 33/281 (11%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  + TG+  AVK+I+K     GNM G               + RE+
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKRKV-MGNMDG---------------VTREL 235

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ LNHP ++ L   +E     YLV+E+   G+L + +   G + E+      RQ++ 
Sbjct: 236 EVLRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 295

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y HA+GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 296 AVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPE 355

Query: 201 IVSGI--------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQF- 250
           ++SG          Y     D+WS G +++ +LTG LPF    G+ +  L K +  G + 
Sbjct: 356 VISGKNSEEKEGNKYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYH 411

Query: 251 ELP-SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           E P  D  +S +A+D I   L V+P+ R+ A   LKHP ++
Sbjct: 412 EGPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  164 bits (415), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 157/282 (55%), Gaps = 33/282 (11%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  + TG+  AVK+ISK            ++G+I       G+ RE+
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISK----------RKVMGNID------GVTREL 235

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ LNHP ++RL   +E +   YL++E+   G+L + +   G + E+      +Q++ 
Sbjct: 236 EVLRRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLE 295

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H +GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 296 AVKYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPE 355

Query: 201 IVSGIPYQG-------FAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQF 250
           ++SG   +        ++S  D+WS G +++ +LTG LPF    G+ +  L K + +G +
Sbjct: 356 VISGKNSEDKSQNKNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSY 412

Query: 251 -ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
            E P  D  +S EA++ I  +L V+PK R+ A   L HP ++
Sbjct: 413 HEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  158 bits (399), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 153/279 (54%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G+TLG G+ G V+ A+N  TG++ AVK++ K       +   ++             
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYD----------- 85

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 86  --ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILV 143

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           +I+  V Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++ +LL    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSL 203

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ----F 250
            Y APE+++   + G   D+WS GVI + LL G   F  E   ++  L +   G+    F
Sbjct: 204 GYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKF 260

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
             P  D VS +A+  I K L +DP +R  A ++L+ P +
Sbjct: 261 HRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  164 bits (414), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 155/285 (54%), Gaps = 35/285 (12%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A   +TG+  AVK+I+K            ++G++       G+ RE+
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINK----------RKVMGNLD------GVTREL 249

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ L+HP+++ L   +E   + Y+V+E+   G+L + +   GP+ E+      RQI+ 
Sbjct: 250 TVLQKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILE 309

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  + T CG+  Y APE
Sbjct: 310 AVKYIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPE 369

Query: 201 IVSG--------IP-----YQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQK 247
           +V+G        +P     +     D+WS G +++ +LTG LPF       + L  ++ K
Sbjct: 370 VVNGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGK 427

Query: 248 GQF-ELP-SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
             + E+P  D  +S +A+D I  +L VDP  R+ A   L+HP +Q
Sbjct: 428 ASYHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  157 bits (398), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 154/279 (55%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G+TLG G+ G V+ ARN  TG++ AVK++ K       +   ++             
Sbjct: 37  YVFGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGNKIQLEALYD----------- 85

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L+HPN++   D +E+N   Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 86  --ELDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           +I+  V Y H+  IVHRDLKPENLL   K +   + IADFG+A  L+++ +L+  + GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSL 203

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ----F 250
            Y APE+++   + G   D+WS GVI + LL G   F  E   +   L +   G+    F
Sbjct: 204 GYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTF 260

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
             P  D VS +A+  I K L ++P +R  A ++L+ P +
Sbjct: 261 HRPYWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  155 bits (393), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 147/279 (52%), Gaps = 19/279 (6%)

Query: 13  DNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPD 72
           D  +  +++G  LG G  GKV   R+K +G   A+KV++K      N+            
Sbjct: 112 DLKLNDFEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQ--------- 162

Query: 73  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENE 132
                 +REI I   LNH N+ +LY  +  + ++YLV+EY   GEL+ LL + GP+ +  
Sbjct: 163 -----FKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDIT 217

Query: 133 AIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCG 192
           A  +  Q+   ++Y H   I+HRDLKPEN+L+     IK+ DFG +      +  +T CG
Sbjct: 218 ASNYVYQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCG 277

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL 252
           +  Y +PE++S   Y     DVW+ G++ + L+ G  PF EED   +T   ++ K   + 
Sbjct: 278 TIDYLSPELISSREYDE-NVDVWALGILTYELVVGAPPF-EEDTKEQT-YKRIAKSDLKF 334

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           P +  VS EA+DLI  +L V P  R   + ++ HP ++K
Sbjct: 335 PPN--VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  163 bits (413), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 149/280 (53%), Gaps = 31/280 (11%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  + TG+  AVK+ISK            +VG +       G+ RE+
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISK----------RKVVGVMD------GVAREL 235

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ L+HP ++ L   +E     YLV+E+   G+L + +   G + E+      RQI+ 
Sbjct: 236 EVLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 295

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 296 AVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPE 355

Query: 201 IVSGI--------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQF-E 251
           ++SG          Y     D+WS G +++ +LTG LPF     N   L  ++  G + E
Sbjct: 356 VISGKNSGEKEGNTYSSLV-DMWSIGCLVYVILTGHLPFSGSTQN--DLYKQITAGSYHE 412

Query: 252 LP-SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
            P  D  +S +A+D I   L VDP+ R+ A   L+HP ++
Sbjct: 413 GPLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 152/279 (54%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G+TLG G+ G V+ ARN  TG++ AVK++ K       +   ++             
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------- 85

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 86  --ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           +I+  V Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++ +L+    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSL 203

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ----F 250
            Y APE+++   + G   D+WS GVI + LL G   F  E   ++  L +   G+    F
Sbjct: 204 GYVAPEVLTQDGH-GKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRF 260

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
             P  D VS +A+  I K L +DP +R  A  +L+ P +
Sbjct: 261 HRPYWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 157/283 (55%), Gaps = 34/283 (12%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  ++TG+  AVK+I+K            ++G++       G+ RE+
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKR----------KVMGNLD------GVTREL 234

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            ++K LNHP ++ L   +E N   Y+V+E+   G+L + +   G + E+      RQI+ 
Sbjct: 235 EVLKRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILE 294

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 295 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 354

Query: 201 IV-SGIPY-------QGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQ 249
           ++ S   Y         ++S  D+WS G +++ +LTG LPF    G+ +  L K + +G 
Sbjct: 355 VIGSSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGS 411

Query: 250 F-ELP-SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           + E P  D  +S EA+D I  +L VDP  R+ A   L+HP ++
Sbjct: 412 YHEGPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  157 bits (397), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 149/277 (53%), Gaps = 24/277 (8%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G TLG GS G V+ AR  STG+  AVK++ K       + G  +   +  D        
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKA-----LKGKDVQLQMLYD-------- 94

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A+R   QI
Sbjct: 95  ELSILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQI 154

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPENLL   + +   + + DFG+A  L  E +L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGY 214

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ----FEL 252
            APE+++     G   D+WS GV+ + LL G  PF  E  ++   L +   G+    F  
Sbjct: 215 VAPEVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHK 271

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
           P    +S +A+D I + LTV P+ R  A ++L H  +
Sbjct: 272 PYWSSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  163 bits (413), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 155/279 (55%), Gaps = 32/279 (11%)

Query: 25  LGLGSTGKVQLARNKSTGQEAAVKVISK-AVFNAGNMSGTSIVGSITPDALPYGIEREII 83
           +G G+   V+ A  +STG+  AVK+I K  V +  +                 G++RE+ 
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD-----------------GVKRELD 240

Query: 84  IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ LNHP +++L D +E N + Y+++E+   G+L + +   G + E+      RQ++  
Sbjct: 241 VLQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEA 300

Query: 144 VSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEI 201
           V Y H  GI HRDLKP+N+++  D    IKI DFG+A ++ +   L T CG+  Y APE+
Sbjct: 301 VKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEV 360

Query: 202 VSGIPYQG------FAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQF-EL 252
           + G   +       ++S  D+WS G +++ +LTG LPF  +  N   L  ++++G + E 
Sbjct: 361 IDGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEG 418

Query: 253 P-SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           P  D  +S EA++ I  +L VDPK R+ A   L+HP ++
Sbjct: 419 PLKDYRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 153/283 (54%), Gaps = 35/283 (12%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  +STG+  A K+ISK     GNM G               + RE+
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKRKV-MGNMDG---------------VTREL 240

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ LNHP ++RL   +E +   YL++E+   G+L + +   G + E+      RQ++ 
Sbjct: 241 EVLRKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 300

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
           GV Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 301 GVKYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 360

Query: 201 IVSGIP----------YQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQ 249
           +++G            Y     D+WS G +++ +LTG LPF    G+ +  L K ++ G 
Sbjct: 361 VIAGKANAEENEKRNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGS 416

Query: 250 F-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           + E P  D  +S EA+D I  +L V+P  R  A+  L+HP ++
Sbjct: 417 YHEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  156 bits (394), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 153/275 (55%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG G+ G V+ AR  S+ ++ AVK++ K   NA  + G  +   +  D        
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLK---NA--LKGNDVQLQMLYD-------- 86

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +A+    Q+
Sbjct: 87  ELSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQL 146

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LD--HKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPEN+L LD   +  + IADFG+A  L++   L+    GS  Y
Sbjct: 147 LDAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGY 206

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI + LL+G  PF  E  +G +          QF  P 
Sbjct: 207 VAPEVLTKEGH-GKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPY 265

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            D +S EA+D I K LT+DP+ R  A +++  P +
Sbjct: 266 WDSISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  155 bits (393), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 150/279 (53%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G+TLG G+ G V+ ARN  TG++ AVK++ K       +   ++             
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------- 85

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 86  --ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           +I+  V Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++ +L+    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSL 203

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ----F 250
            Y APE+++   + G   D+WS GVI + LL G   F  E   ++  L +   G+    F
Sbjct: 204 GYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRF 260

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
             P  D VS +A+  I K L +DP  R  A  +L  P +
Sbjct: 261 HRPYWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  153 bits (386), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/257 (34%), Positives = 133/257 (51%), Gaps = 19/257 (7%)

Query: 33  VQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREIIIMKLLNHPN 92
           V   R+K TG   A+KV+ KA     N+                   RE+ I   LNHPN
Sbjct: 105 VYCVRHKETGFICALKVMDKAEIVQYNLQKQ--------------FRREVEIQTSLNHPN 150

Query: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGI 152
           + +LY  +     +YL++EY   GEL+ LL   GP  +  A RF  QI   ++Y H   I
Sbjct: 151 LTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQI 210

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS 212
           +HRDLKPEN+L+     IK+ DFG + +   G   +T CG+  Y +PE++    Y     
Sbjct: 211 IHRDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-KV 269

Query: 213 DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTV 272
           DVW+ GV+ + L+ G  PF+E+   +     ++ K   + P  + VS + +DLI K+L  
Sbjct: 270 DVWALGVLTYELIVGSPPFEEDTKEL--TYKRILKNDIKFP--ETVSHDVKDLISKLLKY 325

Query: 273 DPKRRIKARDILKHPLL 289
           +P  RI  RD++KHP +
Sbjct: 326 NPSERISMRDVMKHPWI 342

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  161 bits (407), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 150/283 (53%), Gaps = 35/283 (12%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  +STG+  AVK+I+K     GNM G               + RE+
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKRKV-MGNMDG---------------VTREL 240

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ L+HP ++RL   +E     YL++E+   G+L + +   G + E+      RQI+ 
Sbjct: 241 DVLRKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 300

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 301 AVKYIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 360

Query: 201 IVSG----------IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQ 249
           ++ G          I Y     D+WS G +++ +LTG LPF    G+ +  L K + +G 
Sbjct: 361 VIGGKNSAEENEDRIEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGS 416

Query: 250 F-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           + E P  D  +S EA+D I  +L V P +R+ A   L HP ++
Sbjct: 417 YHEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  162 bits (409), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 144/282 (51%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA ++ T ++  +K                     T D   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             I RE+   +  + P + +LY+V  T + +++ LEY    EL++ L+    L   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  D+WS GVIL+ L+TG LPFD++D  ++T    V     E P  
Sbjct: 197 YMAPELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDD-EVKTKWKIVN----EEPKY 251

Query: 256 DE--VSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
           D   +  +A+DLI ++L  +P  R     +L+HP LQ Y S+
Sbjct: 252 DSKFIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  161 bits (408), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 143/283 (50%), Gaps = 30/283 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA ++ T ++  +K                     T D   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             I RE+   +  + P + +LY+V  T + +++ LEY    EL++ L+    +   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFE---L 252
           Y APE++    Y GF  D WS GVIL+ L+TG LPFD++D       +  ++ +++   +
Sbjct: 197 YMAPELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLI 256

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
           P D      A+DLI ++L  +P  R     +L+HP LQ Y S+
Sbjct: 257 PDD------AKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  154 bits (390), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 157/279 (56%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           ++ G+TLG GS G V+ A  KS  +E A+K++ K       + G  +   +  D      
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKA-----LEGNQVQLQMLYD------ 75

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I+K L+HPN++   + +ET+  +Y+V + A  GELF+ ++++G   E++A++   
Sbjct: 76  --ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILI 133

Query: 139 QIIIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAALETEG-KLLETSCGSP 194
           QI+  V Y H+  IVHRDLKPENLL L  K +  + IADFG+A    +G +L+  + GS 
Sbjct: 134 QILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSL 193

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG----QF 250
            Y APE+++ +   G   D+WS GVI + LL+G   F  E   +   L +   G    +F
Sbjct: 194 GYVAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKF 250

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
             P  D +S +A++ I K L ++P++R  A ++L  P +
Sbjct: 251 HKPYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  161 bits (408), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 144/283 (50%), Gaps = 30/283 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +K+ + +G GS GKV LA ++ T ++  +K                     T D   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             I RE+   +  + P + +LY+V  T + +++ LEY    EL++ L+    +   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFE---L 252
           Y APE++    Y GF  D+WS GVIL+ L+TG LPFD++D       +  ++ +++   +
Sbjct: 197 YMAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVI 256

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI 295
           P D      A+DLI ++L  +P  R     +L+HP LQ Y S+
Sbjct: 257 PDD------ARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSV 293

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 152/296 (51%), Gaps = 28/296 (9%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG G+ G V+ AR   T ++ AVK++ K       + G  +   +  D        
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKA-----LKGNDVQLQMLYD-------- 93

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I+++L HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +A+    QI
Sbjct: 94  ELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQI 153

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+    L+  + GS  Y
Sbjct: 154 LSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGY 213

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI++ LL G   F  E  DG +           F  P 
Sbjct: 214 VAPEVLTNNGH-GKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPY 272

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK--------YPSIRDSKSIR 302
            D +S EA++ I + LT+DP  R  A +++K P +          YP IR    +R
Sbjct: 273 WDNISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLR 328

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  154 bits (390), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 146/271 (53%), Gaps = 20/271 (7%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG GS G V+ AR  S+G+  A+K++ K       + G  +   +  D        
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKA-----LKGKDVELQMLYD-------- 94

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A+R   QI
Sbjct: 95  ELSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQI 154

Query: 141 IIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPENLL         + + DFG+A  L+ + +L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGY 214

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+V+     G   D+WS GV+ + LL G  PF  E  +G +    +      F  P 
Sbjct: 215 VAPEVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPY 273

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILK 285
              +S EA+D I + LTV+P  R  A ++L+
Sbjct: 274 WSNISNEAKDFILRALTVNPHDRPTATELLQ 304

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/269 (34%), Positives = 147/269 (54%), Gaps = 21/269 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           ++ G  LG G   +    +++S G+  A K ++K               SI  +     +
Sbjct: 92  YRRGHFLGEGGFARCFQIKDES-GKIFAAKTVAKI--------------SIKTEKTKKKL 136

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             EI I K + HPN++   D +E +T++Y++LE    G L +L+ +R  L E E +RFF 
Sbjct: 137 LSEIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFT 195

Query: 139 QIIIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE-TSCGSPHY 196
             I G V Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA+    +  + T CG+P+Y
Sbjct: 196 TQICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNY 255

Query: 197 AAPEIVSG-IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
            APE++ G      F  D+WS GV+++ALL G+ PF  +D N+  +  +++  Q+  P D
Sbjct: 256 IAPEVLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKD 313

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDIL 284
             VS EA+ LI  IL VDP  R   R+I+
Sbjct: 314 KYVSSEAKTLIADILCVDPVERPSIREII 342

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  154 bits (389), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 154/285 (54%), Gaps = 20/285 (7%)

Query: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSIT 70
           +  N    +  G+TLG G+ G V+ AR  ST ++ AVK++ K       + G S+   + 
Sbjct: 24  VASNAKTDYIFGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKA-----LEGNSVQLQML 78

Query: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130
            D        E+ I++ LNHPN++   D +ET    ++V + A  GELF+ +V++G   E
Sbjct: 79  YD--------ELSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTE 130

Query: 131 NEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKL 186
            +AI+   QI+  V Y H+  IVHRDLKPENLL   + +   + +ADFG+A  L++  +L
Sbjct: 131 EDAIKILVQILGAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDEL 190

Query: 187 LETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLK 244
           +  + GS  Y APE+++   + G   D+WS GVI + LL G   F  E  +G +      
Sbjct: 191 IFKAAGSLGYVAPEVLTSDGH-GKPCDIWSIGVITYTLLCGYSAFAAESVEGFLDECTQN 249

Query: 245 VQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            +   F  P  D VS +A+  I + LT+DP +R  A  +L+ P +
Sbjct: 250 DKPVVFHKPYWDNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  154 bits (390), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/270 (32%), Positives = 146/270 (54%), Gaps = 22/270 (8%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG G+ G V+ ARN    Q  A+K++ K       +                 +  
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQM---------------LYD 102

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q+
Sbjct: 103 ELSILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQM 162

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LD--HKYNIKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L LD   +  + I+DFG+A  L +E +L+  + GS  Y
Sbjct: 163 LTAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGY 222

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +  +        F  P 
Sbjct: 223 VAPEVLTTSGH-GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPY 281

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDIL 284
            + +S+EA+  I + LT+ P RR  A ++L
Sbjct: 282 WNNISKEAKQFILRALTLTPARRPTAAELL 311

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 149/281 (53%), Gaps = 33/281 (11%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  +STG+  AVK+ISK     GNM G S               RE+
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKV-MGNMEGVS---------------REL 242

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ L+HP ++RL   +E     Y+V+E+   G+L + +   G + E       RQI+ 
Sbjct: 243 EVLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILE 302

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 303 AVKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 362

Query: 201 IVSGI--------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQF- 250
           ++ G          Y     D+WS G +++ +LTG LPF    G+ +  L K + +G + 
Sbjct: 363 VIGGKGETNEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYH 418

Query: 251 ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           E P  D  +S EA+  I  +L V+P  R+ A   L+HP ++
Sbjct: 419 EGPLKDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  152 bits (384), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 137/263 (52%), Gaps = 27/263 (10%)

Query: 33  VQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER----EIIIMKLL 88
           V   R+  TG   A+K++ K+                  + L Y + +    EI I   L
Sbjct: 140 VYCCRHIKTGFICAIKIMDKS------------------EILTYNVTKQFRNEIEIQSNL 181

Query: 89  NHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCH 148
           NH N+ +LY  +  +  +YL++EY   GEL+++L + GP  +  A  F  Q+   + Y H
Sbjct: 182 NHENLTKLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLH 241

Query: 149 ALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQ 208
              I+HRDLKPEN+L+D    IKI DFG +     G   +T CG+  Y +PE+++   Y 
Sbjct: 242 KKRIIHRDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYD 301

Query: 209 GFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICK 268
           G   DVW+ G+I + L+ G  PF+E+   +     +++      P+   VS++A++LI  
Sbjct: 302 GLI-DVWALGIIAYELIVGTPPFEEDTKELT--YKRIKNCDLNFPA--HVSQDAKNLISS 356

Query: 269 ILTVDPKRRIKARDILKHPLLQK 291
           +L ++P  RI   D+LKHP + K
Sbjct: 357 LLKLNPSERITLTDVLKHPWINK 379

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 152/279 (54%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G+TLG GS G V+ AR  STG+  AVK++ K       + G  +   +  D      
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKA-----LKGNCVQIEMLYD------ 86

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L+HPN++     +E+    Y+  + A  GELF+ ++ RG   E +A+R   
Sbjct: 87  --ELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIV 144

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEGKLLETSCGSP 194
           Q++ G+ Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L++   L+  + GS 
Sbjct: 145 QLLQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSL 204

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG----QF 250
            Y APE+++ +   G   D+WS GVI + LL G  PF  E  ++   L +   G    +F
Sbjct: 205 GYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKF 261

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
             P  D +S EA++ I + L ++P +R  A ++L+ P +
Sbjct: 262 HRPYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  153 bits (386), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 153/290 (52%), Gaps = 21/290 (7%)

Query: 13  DNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPD 72
           D+    +    TLG GS G V+ A+   + ++ AVK++ K              G + P 
Sbjct: 59  DHKKAGYLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKN--------GGLEP- 109

Query: 73  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENE 132
                I  E+ I++ L+HPN+++  D +ET +  Y+V + A  GELF+ ++  G   E +
Sbjct: 110 -----IYDELNIIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEED 164

Query: 133 AIRFFRQIIIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEGKLLE 188
           A+    QI+  V Y H+  I+HRDLKPENLL LD   +  I +ADFG+A  LE +  ++ 
Sbjct: 165 AVNIVVQILKAVEYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIY 224

Query: 189 TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQ 246
              GS  Y APE+ +   + G  SD+WS GVI + LL G  PF  E  DG +  +     
Sbjct: 225 RPAGSLGYVAPEVFTSDGH-GKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDEN 283

Query: 247 KGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIR 296
             +F+ P  D +S  A++ I +IL +DP  R  A ++L  P +Q   S+R
Sbjct: 284 PVKFQRPYWDGISELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  159 bits (401), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 151/283 (53%), Gaps = 35/283 (12%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  +STG+  AVK+ISK     GNM G               + RE+
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISKRKV-MGNMDG---------------VTREL 244

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ L+HP ++RL   +E     YL++E+   G+L + +   G + E+      RQI+ 
Sbjct: 245 EVLRKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 304

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H+  I HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 305 AVKYIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 364

Query: 201 IVSG----------IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQ 249
           I+SG            Y     D+WS G +++ +LTG LPF    G+ +  L K V+ G 
Sbjct: 365 IISGSNNLEENEERNEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGS 420

Query: 250 F-ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           + E P  D  +S EA++ I  +L V+P  R+ A   L+HP ++
Sbjct: 421 YHEGPLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {ON}
           YPL209C (REAL)
          Length = 367

 Score =  150 bits (379), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 87/257 (33%), Positives = 132/257 (51%), Gaps = 19/257 (7%)

Query: 33  VQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREIIIMKLLNHPN 92
           V   R+KSTG   A+KV+ K      N+                   RE+ I   LNHPN
Sbjct: 118 VYCVRHKSTGYICALKVMEKEEIIRYNLQRQ--------------FRREVEIQMSLNHPN 163

Query: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGI 152
           + + Y  +     +YL++EY   GE++ LL   GP  +  A  +  QI   + Y H   I
Sbjct: 164 LTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYIYQIANALDYMHKKNI 223

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS 212
           +HRD+KPEN+L+     IK+ DFG + +       +T CG+  Y +PE++    Y     
Sbjct: 224 IHRDIKPENILIGFNNTIKLTDFGWSIINPPESRRKTVCGTIDYLSPEMIESREYDH-TI 282

Query: 213 DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTV 272
           D W+ G++ F LLTG  PF+EE  +  T   ++     ++PS+  VS++AQDLI K+L  
Sbjct: 283 DAWALGILAFELLTGAPPFEEEMKD--TTYKRIAALDIKIPSN--VSQDAQDLILKLLKY 338

Query: 273 DPKRRIKARDILKHPLL 289
           DPK R++  D+  HP +
Sbjct: 339 DPKDRMRLEDVKMHPWI 355

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  154 bits (388), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 155/314 (49%), Gaps = 46/314 (14%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           + LG+ LG G    V+ A+NK+TG+  AVK+      +    +                 
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQ--------------F 238

Query: 79  EREIIIMKLLNHPNVLRLYD-----VWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
             E  I+  ++HPN++ L D     + +T    YLVLE  + GELF+ +V++  LP+ E+
Sbjct: 239 REETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEES 298

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-------------------YNIKIAD 174
              F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +KIAD
Sbjct: 299 KAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIAD 358

Query: 175 FGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFD 232
           FG+A    E +   T CG+P Y APE++     +G+ S  D+WS GVIL+  L G  PF 
Sbjct: 359 FGLAKFTGEMQFTNTLCGTPSYVAPEVLVK---KGYTSKVDLWSAGVILYVCLCGFPPFS 415

Query: 233 EEDG--NIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           ++ G  +++  ++   K  F  P  DE+   A  LI  +L +DP+ R        HP L 
Sbjct: 416 DQLGPPSLKEQIMSA-KYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLD 474

Query: 291 KYPSIRDSKSIRGL 304
               +  S +++ L
Sbjct: 475 SVSHLDVSHNLKRL 488

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  157 bits (398), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 102/319 (31%), Positives = 173/319 (54%), Gaps = 25/319 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           ++ G+ LG G   +    +++S G+  A K ++K               SI  +     +
Sbjct: 142 YRRGQFLGEGGFARCFQIKDES-GKIFAAKTVAKI--------------SIKTEKTRRKL 186

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             EI I K + H N+++  D +E + ++Y++L     G L  LL +R  L E E +RFF 
Sbjct: 187 LSEIQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFT 245

Query: 139 -QIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
            QI   + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y
Sbjct: 246 VQICGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNY 305

Query: 197 AAPEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS 254
            APE++ G  + G  +  D+WS GV++FALL G+ PF  +D N  T+  +++  ++  P 
Sbjct: 306 IAPEVLLG-KHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPI 362

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ-KYPSIRDSKSIRGLPREDTYLTP 313
           +  +S+EA+ LI  IL  DP  R    +I+++   +  +PS+  +     +P  D +LTP
Sbjct: 363 NKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTP 422

Query: 314 LSESNSSIDATILQNLVIL 332
            +ES ++    ++Q+ +IL
Sbjct: 423 -NESLNNFRNCMIQSGLIL 440

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 145/274 (52%), Gaps = 20/274 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +++G  LG G  GKV   ++K +G  +A+KV+ K    + N                   
Sbjct: 175 FEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEIVSYNAEKQ--------------F 220

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF-NLLVERGPLPENEAIRFF 137
           +RE+ +   LNHPN+++++  ++    +YL++EY   GEL+ +L    GP  +  A  + 
Sbjct: 221 KREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASNYI 280

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            QI   + Y H+  I+HRD+KPEN++L     IK+ADFG +         +T CG+  Y 
Sbjct: 281 YQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTIDYL 340

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDE 257
           APE+V+   Y  +  D+W+ G++ + L+ G  PF+EE  ++     ++       P    
Sbjct: 341 APELVTFKEYD-YNVDIWALGILTYELIVGNPPFEEETKDLT--YKRIINVDLNFP--QT 395

Query: 258 VSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           VS +A+DLI ++L  DP +R+   D++KHP + K
Sbjct: 396 VSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score =  149 bits (377), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 150/289 (51%), Gaps = 19/289 (6%)

Query: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60
           MA    ++P  K  ++  ++LG+ LG G  GKV   R++STG   A+KV+ K      N+
Sbjct: 86  MAHENKNLPKFKSLSLDDFELGKKLGKGKFGKVYCVRHRSTGFICALKVMEKEEIIKYNL 145

Query: 61  SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
                              RE+ I   LNHPN+ + Y  +     +YL++EY   GE++ 
Sbjct: 146 QRQ--------------FRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYK 191

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LL   GP  +  A  +  QI   + Y H   I+HRD+KPEN+L+     IK+ DFG + +
Sbjct: 192 LLRSHGPFNDILASDYVYQIANALDYMHKKNIIHRDIKPENILIGFNNIIKLTDFGWSII 251

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
                  +T CG+  Y +PE++    Y     D W+ GV+ F LLTG  PF+EE  +  T
Sbjct: 252 NPPDSRRKTVCGTIDYLSPEMIESREYDH-TIDAWALGVLAFELLTGAPPFEEEMKD--T 308

Query: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
              ++     ++PS+  +S++AQDLI K+L  DPK R++  D+  HP +
Sbjct: 309 TYKRIAALDIKIPSN--ISQDAQDLILKLLKYDPKDRMRLEDVKMHPWI 355

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 151/273 (55%), Gaps = 20/273 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           ++ G+TLG GS G V+ A+  S+ +E AVK++ K       +    +             
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRENAIQLRMLY------------ 78

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
            +E+ I+K L+H N++   + +ET+  LY+V + A  GELF+ ++  G   E++A++   
Sbjct: 79  -QELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIV 137

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEGKLLETSCGSP 194
           QI+  V Y H+  IVHRDLKPENLL    +    + IADFG+A  L++  +L+  + GS 
Sbjct: 138 QILSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSL 197

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFEL 252
            Y APE+++ +   G   D+WS GVI + LL G   F  E  +G +   +   Q  QF+ 
Sbjct: 198 GYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQK 256

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILK 285
           P  D +S+ A++ I K L + P++R  A ++LK
Sbjct: 257 PYWDNISQSAKNFILKCLDLTPEQRPTATELLK 289

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  157 bits (396), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 150/281 (53%), Gaps = 31/281 (11%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  + TG+  AVK+ISK            ++G++       G+ RE+
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISK----------RKVMGNVE------GVTREL 237

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            ++  LNHP ++ L   +E     YL++E+   G+L + +   G + E+      RQI+ 
Sbjct: 238 EVLHRLNHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 297

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H   I HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 298 AVKYIHQQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPE 357

Query: 201 IVSG-------IPYQGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQF- 250
           ++ G       +    ++S  D+WS G +++ +LTG LPF         L  ++ +G + 
Sbjct: 358 VIDGKSLEEKSVNKNLYSSLVDMWSIGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYH 415

Query: 251 ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           E P  D ++S EA+D I  +L V+P+ R+ A   LKHP +Q
Sbjct: 416 EGPLKDFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQ 456

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  156 bits (394), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/336 (30%), Positives = 171/336 (50%), Gaps = 46/336 (13%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  ++TG+  AVK+I+K            ++G++       G+ RE+
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINK----------RKVMGNVD------GVTREL 264

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ LNHP ++ L   +E +   YL++E+   G+L + +   G + E+      RQI+ 
Sbjct: 265 EVLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 324

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 325 AVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPE 384

Query: 201 IVSGIPYQGFAS---------DVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQF 250
           ++ G   +G  +         D+WS G +++ +LTG LPF    G+ +  L K +  G +
Sbjct: 385 VIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSY 441

Query: 251 -ELPSDDE-VSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSI------------R 296
            E P  D  +S EA+D I  +L ++P  R+ A   L+HP L    SI             
Sbjct: 442 HEGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSIGAEIAVSLSQSLS 501

Query: 297 DSKSIRGLPREDTYLTPLSESNSSIDATILQNLVIL 332
            ++++ G+  E  YL   SE  S+  A   +  VIL
Sbjct: 502 QARALEGMD-EAEYLVAQSEVASNRKAPTHEKRVIL 536

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  155 bits (391), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 137/230 (59%), Gaps = 9/230 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + H N+++  D +E +T++Y++LE    G L +LL  R  L E E +RFF   
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQ 184

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I+G V Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA L  + +   T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDD 256
           PE+++G  + G  +  D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G F  P D 
Sbjct: 245 PEVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDK 301

Query: 257 EVSREAQDLICKILTVDPKRRIKARDILKHPLLQK-YPSIRDSKSIRGLP 305
            +S EA  LI  IL++DP  R    +I+ +   +  +PS  D+  +   P
Sbjct: 302 FISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  148 bits (373), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 145/272 (53%), Gaps = 28/272 (10%)

Query: 24  TLGLGSTGKVQLARNKSTGQEAAVKVISK-AVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           TLG GS G+V L R+   G+  A+KV+ K  V     +  T+                E 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTN---------------DER 92

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            ++KL++HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A  +  ++I+
Sbjct: 93  RMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVIL 152

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE++
Sbjct: 153 ALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVI 210

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREA 262
           +  PY   + D WS G+++F +L G  PF   D        K+ +G+   P       + 
Sbjct: 211 ATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPP--FFHPDV 265

Query: 263 QDLICKILTVDPKRRI-----KARDILKHPLL 289
            DL+CK++T D  RR+       +D+  HP  
Sbjct: 266 VDLLCKLITSDLTRRLGNLQSGPQDVKSHPWF 297

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 145/250 (58%), Gaps = 22/250 (8%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + H N+++  D +E +T++Y++LE    G L +LL  R  L E E +RFF   
Sbjct: 126 EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQ 184

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I+G V Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDD 256
           PE+++G  + G  +  D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G +  P D 
Sbjct: 245 PEVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDK 301

Query: 257 EVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGL--PREDTYLTPL 314
            +S+EA  LI  IL++DP         L+ P L +   I D    RG+  PR D  +   
Sbjct: 302 CISQEALTLIRDILSIDP---------LERPSLDE---IIDYVWFRGIFPPRIDASVLSS 349

Query: 315 SESNSSIDAT 324
           + S  ++DA 
Sbjct: 350 APSYENLDAA 359

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score =  148 bits (373), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 87/257 (33%), Positives = 132/257 (51%), Gaps = 19/257 (7%)

Query: 33  VQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREIIIMKLLNHPN 92
           V   R++STG   A+KV+ K      N+                   RE+ I   LNHPN
Sbjct: 118 VYCVRHRSTGYICALKVMEKEEIIKYNLQKQ--------------FRREVEIQTSLNHPN 163

Query: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGI 152
           + + Y  +     +YL++EY   GE++ LL   GP  +  A  +  QI   + Y H   I
Sbjct: 164 LTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNI 223

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS 212
           +HRD+KPEN+L+     IK+ DFG + +       +T CG+  Y +PE+V    Y     
Sbjct: 224 IHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDH-TI 282

Query: 213 DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTV 272
           D W+ GV+ F LLTG  PF+EE  +  T   ++     ++PS+  +S++AQDLI K+L  
Sbjct: 283 DAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDIKMPSN--ISQDAQDLILKLLKY 338

Query: 273 DPKRRIKARDILKHPLL 289
           DPK R++  D+  HP +
Sbjct: 339 DPKDRMRLGDVKMHPWI 355

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  149 bits (377), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 150/278 (53%), Gaps = 20/278 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G+TLG GS G V+ A+  ST +  AVK+I K       + G  +   +  D      
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKA-----LKGNDVQLQMLYD------ 95

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ +++RG   E +A++   
Sbjct: 96  --ELSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIII 153

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAALETEG-KLLETSCGSP 194
           Q++  + Y H+  IVHRDLKPEN+L         + IADFG+A    +G  L+  + GS 
Sbjct: 154 QMLKAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSL 213

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFEL 252
            Y APE+++   + G   D+WS GVI + LL G   F  E  +G +      +   +F  
Sbjct: 214 GYVAPEVLTTNGH-GKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHE 272

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           P  + VSREA++ I K LT++P  R  A ++L  P ++
Sbjct: 273 PYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  148 bits (373), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 136/260 (52%), Gaps = 19/260 (7%)

Query: 32  KVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREIIIMKLLNHP 91
           +V   R+K TG   A+KV+ K      N+                   RE+ I   LNH 
Sbjct: 122 RVYCVRHKVTGFICAMKVMEKQEIMQYNVQKQ--------------FRREVEIQSSLNHQ 167

Query: 92  NVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALG 151
           N+ +LY  +  +  +YL++EY   GEL+ LL  +GPL +  A  +  Q+   + Y H   
Sbjct: 168 NLTKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMADALDYMHQRN 227

Query: 152 IVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFA 211
           I+HRD+KPEN+L+     +K+ DFG + +   G   +T CG+  Y +PE+++   Y    
Sbjct: 228 IIHRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPELIASKEYDD-K 286

Query: 212 SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILT 271
            DVW+ GV+ F L+    PF+E+   + +   ++ +G  + P  + +S +AQDLI K+L 
Sbjct: 287 VDVWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFP--NHISSDAQDLITKLLR 342

Query: 272 VDPKRRIKARDILKHPLLQK 291
            + K RI  R++ +HP + K
Sbjct: 343 HNSKDRISLREVKQHPWITK 362

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  150 bits (378), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 94/275 (34%), Positives = 144/275 (52%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G TLG GS G V+ AR  ST ++ A+K++ K      N+    +               
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY-------------E 95

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    QI
Sbjct: 96  ELSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQI 155

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ +  L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F +P 
Sbjct: 216 VAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPY 274

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            D +S +A+  I K L +DP  R  A ++L  P +
Sbjct: 275 WDSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score =  147 bits (372), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 145/295 (49%), Gaps = 26/295 (8%)

Query: 2   AVNGNSVPAIKDN-------TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAV 54
             +G  VP + D+       T+  +++G+ LG G  GKV   +++ TG   A+K + K  
Sbjct: 76  TAHGTRVPILNDHNDKFENMTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKK- 134

Query: 55  FNAGNMSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAE 114
                         I    +     RE+ I     H N+ +LY  +     +YL++EY  
Sbjct: 135 -------------EIVQYTIQKQFRREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVY 181

Query: 115 KGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIAD 174
            GEL+  L   GPL E  A  F  Q+   + Y H+  I+HRD+KPEN+L+     IK+ D
Sbjct: 182 YGELYKFLKNNGPLNETLASYFVYQMANALDYMHSKNILHRDIKPENILIGFNNTIKLTD 241

Query: 175 FGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE 234
           FG +    +G+  +T CG+  Y +PE++    Y     DVW+ GV+ + LL G  PF+E+
Sbjct: 242 FGWSVYNEDGQKRKTLCGTIDYLSPELIKSREYNN-KVDVWALGVLTYELLVGSPPFEED 300

Query: 235 DGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
              +     ++ +   + P +  VS +A+DLI ++L  +P +RI   ++  H  +
Sbjct: 301 TKEM--TYRRILRCDLKFPLN--VSPQARDLIVRLLQFEPSKRIPLSEVKSHAWI 351

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  150 bits (378), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 147/271 (54%), Gaps = 22/271 (8%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G+TLG G+ G V+ ARN +  ++ AVK++ K       ++                +  
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALKGDELNM---------------LYD 100

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E++I++ L+HP++++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q+
Sbjct: 101 ELMILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQM 160

Query: 141 IIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  + Y H+  +VHRDLKPEN+L         + I+DFG+A  L +E  L+  + GS  Y
Sbjct: 161 LEAIEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGY 220

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +  +        F  P 
Sbjct: 221 VAPEVLTTSGH-GKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKPY 279

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILK 285
            + +S EA++ I K LT+DP  R  A ++L+
Sbjct: 280 WNSISVEAKEFILKALTLDPSERPTATELLQ 310

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  154 bits (390), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 147/281 (52%), Gaps = 32/281 (11%)

Query: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           E +G G+   V+ A  +STG+  A K+ISK     GN  G               ++RE+
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKRKL-MGNWDG---------------VDREL 233

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            +++ L+HP ++RL   +E     YL++E+   G+L + +   G + E+      RQ++ 
Sbjct: 234 AVLRKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 293

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V+Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++  G  ++T CG+  Y APE
Sbjct: 294 AVAYIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPE 353

Query: 201 IVSGI---------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQF- 250
           ++ G           Y     D+WS G +++ +LTG LPF         L  ++ +G + 
Sbjct: 354 VIGGKNDNTEEEKNEYSSLV-DMWSMGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYH 410

Query: 251 ELPSDD-EVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290
           E P  D  +S EA+D I  +L V+P  R  A   L+HP ++
Sbjct: 411 EGPLKDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  154 bits (389), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 131/210 (62%), Gaps = 8/210 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + HPN+++  D +E +T++Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I+G + Y H+  I+HRDLK  N+  D  +N+KI DFG+AA L  + +   T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDD 256
           PE+++G  + G  F  DVWS GV+++ALL G+ PF  ++ N  T+  +++   F  P D 
Sbjct: 239 PEVLTG-KHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDK 295

Query: 257 EVSREAQDLICKILTVDPKRRIKARDILKH 286
            +S EA+ LI  IL++DP  R    +I+++
Sbjct: 296 PISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  154 bits (388), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 83/210 (39%), Positives = 131/210 (62%), Gaps = 8/210 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + HPN+++  D +E +T++Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 120 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I+G + Y H+  I+HRDLK  N+  D  +N+KI DFG+AA L  + +   T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDD 256
           PE+++G  + G  F  D+WS GV+++ALL G+ PF  ++ N  T+  +++   F  P D 
Sbjct: 239 PEVLTG-KHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDK 295

Query: 257 EVSREAQDLICKILTVDPKRRIKARDILKH 286
            +S EA+ LI  IL++DP  R    +I+++
Sbjct: 296 PISSEAKVLIKDILSLDPLERPSLAEIMEY 325

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  147 bits (370), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 144/272 (52%), Gaps = 28/272 (10%)

Query: 24  TLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDALPYGIEREI 82
           TLG GS G+V L R+   G+  A+KV+ KA V     +  T+              ER +
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTND-------------ERRM 102

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
             +KL+ HP ++R++  ++ + +L++V++Y E GELF LL +    P   A  +  ++ +
Sbjct: 103 --LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTL 160

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y APE++
Sbjct: 161 ALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIAPEVI 218

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREA 262
           +  PY   + D WS GV+++ +L G  PF   D        K+  G+   P     + + 
Sbjct: 219 ATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYPQ--FFNSDV 273

Query: 263 QDLICKILTVDPKRRI-----KARDILKHPLL 289
            DL+ K+LT D  RRI      A+DI  HP  
Sbjct: 274 IDLLSKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 137/259 (52%), Gaps = 19/259 (7%)

Query: 33  VQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREIIIMKLLNHPN 92
           V   ++K +G   A+K + K+     N+                   RE+ I   LNHPN
Sbjct: 168 VYCVKHKESGFICALKAMDKSEIIQYNLQRQ--------------FRREVEIQTSLNHPN 213

Query: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGI 152
           + +LY  +  +  +YL++EY   GEL+ LL   GP  +  A RF  QI   +++ H  GI
Sbjct: 214 LTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFVYQIADALNHLHEKGI 273

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS 212
           +HRDLKPEN+L+     +K+ DFG + +  +G   +T CG+  Y +PE++    Y     
Sbjct: 274 IHRDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYLSPEMIRSREYDD-TV 332

Query: 213 DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTV 272
           DVW+ GV+ + L+ G  PF+E+   +     ++ KG+   P    VS++ +DLI ++L  
Sbjct: 333 DVWALGVLTYELVAGDPPFEEDSKEL--TYKRILKGEIRFPG--TVSQDVRDLISRLLKN 388

Query: 273 DPKRRIKARDILKHPLLQK 291
           DPK RI  ++++ HP + +
Sbjct: 389 DPKERILLKEVMVHPWIMR 407

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  153 bits (386), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 146/272 (53%), Gaps = 23/272 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G  LG G   +    ++ S G+  A K ++KA              SI  +     +
Sbjct: 82  YHRGHFLGEGGFARCFQIKDDS-GEIFAAKTVAKA--------------SIKSEKTRKKL 126

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             EI I K ++HPN+++  D +E ++++Y++LE    G L  LL  R  L E E +RFF 
Sbjct: 127 LSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFT 185

Query: 139 QIIIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
             I G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNY 245

Query: 197 AAPEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS 254
            APE++ G  + G  F  D+WS GV+L+ALL G+ PF   D N  T+  +++   F  P 
Sbjct: 246 IAPEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPK 302

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKH 286
           D  +S E + LI  IL++DP  R    +I+ +
Sbjct: 303 DKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  147 bits (371), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/289 (32%), Positives = 149/289 (51%), Gaps = 19/289 (6%)

Query: 3   VNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSG 62
           V+ NS    +D ++  +++G+ LG G  GKV   ++K TG   A+K + K+     N+  
Sbjct: 107 VSNNSPVHYQDISLDDFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQK 166

Query: 63  TSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                            RE+ I   L HPN+ RLY  +     +YL++EY   GEL+  L
Sbjct: 167 Q--------------FRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHL 212

Query: 123 VERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
              GP  +  A  F  Q+   ++Y H+  I+HRD+KPEN+LL  +  +K+ DFG +    
Sbjct: 213 RSHGPFNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNV 272

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
                +T CG+  Y +PE++    Y     DVW+ GV+ + LL G  PF+E+   +    
Sbjct: 273 GNSKRKTLCGTMDYLSPELIKSREYDN-KVDVWALGVLTYELLVGSPPFEEDTKEL--TY 329

Query: 243 LKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            ++ K     P  D+VS  A+DLI ++L  DP+ RI  +D+ +HP ++K
Sbjct: 330 KRIIKRDLRFP--DQVSPHARDLISRLLEYDPQNRIPLKDVKRHPWIKK 376

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 144/277 (51%), Gaps = 20/277 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G TLG GS G V+ AR  ST ++ A+K++ K      N+    +             
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNIQLQMLY------------ 94

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    
Sbjct: 95  -EELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIV 153

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEGKLLETSCGSP 194
           QI+  V Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+ +  L+  + GS 
Sbjct: 154 QILGAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSL 213

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFEL 252
            Y APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F +
Sbjct: 214 GYVAPEVLTQDGH-GKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHM 272

Query: 253 PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
           P  D +S +A+  I K L ++P  R  A ++L  P +
Sbjct: 273 PYWDNISVDAKRFILKALILNPADRPTATELLDDPWI 309

>Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]
           {ON} (36090..36101,36217..37689) [1485 nt, 495 aa]
          Length = 494

 Score =  150 bits (378), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/303 (30%), Positives = 148/303 (48%), Gaps = 42/303 (13%)

Query: 10  AIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSI 69
           A +++    + +G+ LG G    V+  RNK TGQ  A+K+    + +    +        
Sbjct: 173 ARQESVFDKYIIGKELGSGHYAIVKEGRNKKTGQSVAIKIFHPQLNDDQKKN-------- 224

Query: 70  TPDALPYGIEREIIIMKLLNHPNVLRLYDVW-----ETNTDLYLVLEYAEKGELFNLLVE 124
                 +    E  I+  ++HPN++ L D +     ++    YLVL+  + GELF+ +V 
Sbjct: 225 ------HQFREETDILMRVHHPNIVNLLDSYVEPLSKSQIQKYLVLDKIDDGELFDRIVR 278

Query: 125 RGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL-------------------D 165
           +  L +NE    F+QI+ G+ Y H   I+HRD+KPEN+LL                   +
Sbjct: 279 KTSLSQNETKALFKQILSGIQYLHGQNIIHRDIKPENILLNITRRTSNDQIKTGPWDEDE 338

Query: 166 HKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALL 225
               +KIADFG+A    E +   T CG+P Y APE++    Y     D+WS GV+L+  L
Sbjct: 339 IDIQVKIADFGLAKFTGELQFTNTLCGTPSYVAPEVLRKTGYTS-KVDIWSTGVLLYVCL 397

Query: 226 TGRLPFDEEDGNIRTLLLKVQKGQFEL--PSDDEVSREAQDLICKILTVDPKRRIKARDI 283
            G  PF ++ G   TL  ++ +G+F    P  DE++     LI  +L V+P +R    D+
Sbjct: 398 CGFPPFSDQLGP-PTLKEQILQGKFAFFSPYWDEINDSVLHLISNLLVVNPAQRYSIEDM 456

Query: 284 LKH 286
           + H
Sbjct: 457 INH 459

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 146/272 (53%), Gaps = 23/272 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G  LG G   +    ++ S G+  A K ++KA              SI  +     +
Sbjct: 82  YHRGHFLGEGGFARCFQIKDDS-GEIFAAKTVAKA--------------SIKSEKTRKKL 126

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             EI I K ++HPN+++  D +E ++++Y++LE    G L  LL  R  L E E +RFF 
Sbjct: 127 LSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFT 185

Query: 139 QIIIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
             I G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNY 245

Query: 197 AAPEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS 254
            APE++ G  + G  F  D+WS GV+L+ALL G+ PF   D N  T+  +++   F  P 
Sbjct: 246 IAPEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPR 302

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKH 286
           D  +S E + LI  IL++DP  R    +I+ +
Sbjct: 303 DKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 150/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     +  T+         
Sbjct: 66  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 117

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
                ER +  +KL+ HP ++R++  ++   ++++V++Y E GELF+LL +    P   A
Sbjct: 118 -----ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVA 170

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  E +  +  T CG+
Sbjct: 171 KFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQ-TVTWTLCGT 228

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           P Y APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P
Sbjct: 229 PDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYP 285

Query: 254 SDDEVSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
                  +  DL+ K++T D  RRI      +RDI  HP  
Sbjct: 286 P--YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 147/269 (54%), Gaps = 23/269 (8%)

Query: 22  GETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIERE 81
           G  LG G   +    R+ S G+  A K ++K               SI  +     +  E
Sbjct: 98  GHFLGEGGFARCFQIRDDS-GKIFAAKTVAKI--------------SIKSEKTRKKLLSE 142

Query: 82  IIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           I I K + H N+++  D +E +T++Y++LE    G L +LL +R  L E E +RFF   I
Sbjct: 143 IQIHKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQI 201

Query: 142 IG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAP 199
            G + Y H+  ++HRDLK  N+  D KYN+KI DFG+AA L  + +   T CG+P+Y AP
Sbjct: 202 CGAIKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIAP 261

Query: 200 EIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDE 257
           E++ G  + G  +  D+WS GV+++AL+ GR PF  +D N  T+  +++   F  P D  
Sbjct: 262 EVLMG-KHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKL 318

Query: 258 VSREAQDLICKILTVDPKRRIKARDILKH 286
           +S EA+ LI  IL++DP  R    +I+ +
Sbjct: 319 ISSEAKILIQDILSLDPLERPSVNEIMDY 347

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 145/272 (53%), Gaps = 23/272 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G  LG G   +    ++ S G+  A K ++KA              SI  +     +
Sbjct: 82  YHRGHFLGEGGFARCFQIKDDS-GEIFAAKTVAKA--------------SIKSEKTRKKL 126

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             EI I K + HPN+++  D +E ++++Y++LE    G L  LL  R  L E E +RFF 
Sbjct: 127 LSEIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFT 185

Query: 139 QIIIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
             I G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNY 245

Query: 197 AAPEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS 254
            APE++ G  + G  F  D+WS GV+L+ALL G+ PF   D N  T+  +++   F  P 
Sbjct: 246 IAPEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPK 302

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKH 286
           D  +S E + LI  IL++DP  R    +I+ +
Sbjct: 303 DKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 130/230 (56%), Gaps = 19/230 (8%)

Query: 106 LYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLD 165
            Y++ EY   G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++ 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 166 HKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALL 225
               IKI DFG++ +    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+
Sbjct: 68  TSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVLV 127

Query: 226 TGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILK 285
            G++PFD+E+ ++  L  K+++G+ E P    +S E   L+ K+L VDP +R   + ++ 
Sbjct: 128 CGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQVVN 183

Query: 286 HPLLQK---YPSIRDSKSIRGLPREDTYLTPLSESNSSIDATILQNLVIL 332
           H  +Q+   +P+          P    +  PL+    ++DAT+++ +  L
Sbjct: 184 HQWMQRGYDFPA----------PSYIPHRVPLTA--DALDATVIKEMYRL 221

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 149/277 (53%), Gaps = 28/277 (10%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDALPYG 77
           +++  TLG GS G+V L R+   G+  A+KV+ K  +     +  T+             
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIKMKQIEHTND------------ 140

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFF 137
            ER +  +KL+ HP ++RL+  ++ + +L++V++Y E GELF+LL +    P   A  + 
Sbjct: 141 -ERRM--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 197

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            ++++ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A  +    +  T CG+P Y 
Sbjct: 198 AEVVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVTWTLCGTPDYI 255

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDE 257
           APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P    
Sbjct: 256 APEVIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFPQG-- 310

Query: 258 VSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
              +  DL+ +++T D  +R+      +RD+  HP  
Sbjct: 311 FHPDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 150/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     +  T+         
Sbjct: 67  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 118

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
                ER +  +KL+ HP ++R++  ++   ++++V++Y E GELF+LL +    P   A
Sbjct: 119 -----ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVA 171

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  E +  +  T CG+
Sbjct: 172 KFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQ-TVTWTLCGT 229

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           P Y APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P
Sbjct: 230 PDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP 286

Query: 254 SDDEVSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
                  +  DL+ K++T D  RRI      +RDI  HP  
Sbjct: 287 P--YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  145 bits (367), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 144/272 (52%), Gaps = 28/272 (10%)

Query: 24  TLGLGSTGKVQLARNKSTGQEAAVKVISK-AVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           TLG GS G+V L R+   G+  A+KV+ K  V     +  T+                E 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTN---------------DER 92

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            ++KL++HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A  +  ++I+
Sbjct: 93  RMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVIL 152

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE++
Sbjct: 153 ALEYLHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVI 210

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREA 262
           +  PY   + D WS G+++F +L G  PF   D        K+ +G+   P       + 
Sbjct: 211 ATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPP--FFHPDV 265

Query: 263 QDLICKILTVDPKRRI-----KARDILKHPLL 289
            DL+ K++T D  RR+       +D+  HP  
Sbjct: 266 VDLLSKLITADLTRRLGNLQSGPQDVKSHPWF 297

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  148 bits (373), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 143/275 (52%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G TLG GS G V+ AR  ST ++ A+K++ K      N+    +               
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY-------------E 95

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQI 155

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ E  L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGY 215

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F +P 
Sbjct: 216 VAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPY 274

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            D +S + +  I K L ++P  R  A ++L  P +
Sbjct: 275 WDNISIDVKRFILKALRLNPADRPTATELLDDPWI 309

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 150/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     +  T+         
Sbjct: 68  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 119

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
                ER +  +KL+ HP ++R++  ++   ++++V++Y E GELF+LL +    P   A
Sbjct: 120 -----ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVA 172

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  E +  +  T CG+
Sbjct: 173 KFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQ-TVTWTLCGT 230

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           P Y APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P
Sbjct: 231 PDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP 287

Query: 254 SDDEVSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
                  +  DL+ K++T D  RRI      +RDI  HP  
Sbjct: 288 P--YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  148 bits (373), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 144/275 (52%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIER 80
            G TLG GS G V+ AR  ST ++ A+K++ K      N+    +               
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY-------------E 95

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQI 155

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ +  L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGQFELPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F +P 
Sbjct: 216 VAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPY 274

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            D +S +A+  I K L ++P  R  A ++L  P +
Sbjct: 275 WDNISIDAKRFILKALRLNPTERPTATELLDDPWI 309

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  147 bits (370), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 149/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     +  T+         
Sbjct: 80  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKTQVVRMKQIEHTN--------- 130

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
                  E  ++KL+ HP ++R++  ++   +L++V++Y E GELF+LL +    P   A
Sbjct: 131 ------DERRMLKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNPVA 184

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+
Sbjct: 185 KFYAAEVVLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-SVTWTLCGT 242

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           P Y APE+++  PY   + D WS G+++F +L G  PF   D        K+ +G+   P
Sbjct: 243 PDYIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIYP 299

Query: 254 SDDEVSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
                  +  DL+ K++T D  RRI      ++DI +HP  
Sbjct: 300 P--FFHPDVVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  145 bits (367), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 148/281 (52%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  +     +  T+         
Sbjct: 59  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQIEHTN--------- 109

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
                  E  ++KL+ HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A
Sbjct: 110 ------DERRMLKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVA 163

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A   T   +  T CG+
Sbjct: 164 KFYAAEVVLALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKEVT--TVTWTLCGT 221

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           P Y APE+++  PY   + D WS G++++ +L G  PF   D        K+  G+   P
Sbjct: 222 PDYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYP 278

Query: 254 SDDEVSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
           S    + +  DL+ K++T D  RRI       ++I  HP  
Sbjct: 279 S--FFNSDVVDLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  151 bits (382), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 144/272 (52%), Gaps = 23/272 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G  LG G   +    ++ S G   A K ++KA              SI  +     +
Sbjct: 82  YHRGHFLGEGGFARCFQIKDDS-GDIFAAKTVAKA--------------SIKSEKTRKKL 126

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             EI I K + HPN+++  D +E ++++Y++LE    G L  LL  R  L E E +RFF 
Sbjct: 127 LSEIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFT 185

Query: 139 QIIIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
             I G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y
Sbjct: 186 TQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNY 245

Query: 197 AAPEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS 254
            APE++ G  + G  F  D+WS GV+L+ALL G+ PF   D N  T+  +++   F  P 
Sbjct: 246 IAPEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPK 302

Query: 255 DDEVSREAQDLICKILTVDPKRRIKARDILKH 286
           D  +S E + LI  IL++DP  R    +I+ +
Sbjct: 303 DKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  149 bits (375), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 136/294 (46%), Gaps = 42/294 (14%)

Query: 22  GETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIERE 81
           G+ LG G    V+ ARNK TG+  AVK+      +               D        E
Sbjct: 201 GKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDD--------------DKRTKKFTEE 246

Query: 82  IIIMKLLNHPNVLRLYD-----VWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRF 136
             I+  + HPN+++L D     V +T    YLVLE    GELF  +V +  L E+E    
Sbjct: 247 TKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKAL 306

Query: 137 FRQIIIGVSYCHALGIVHRDLKPENLLL-------------------DHKYNIKIADFGM 177
           FRQ++ G+ Y H+  I+HRD+KPEN+LL                   +    +KIADFG+
Sbjct: 307 FRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGL 366

Query: 178 AALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN 237
           A    E K   T CG+P Y APE++    Y     D+WS GV+L+  L G  PF E+   
Sbjct: 367 AKFTGEMKFTNTLCGTPSYVAPEVLVKTGYTS-RVDMWSAGVLLYVCLCGFPPFSEQLAP 425

Query: 238 IRTLLLKVQKGQFEL--PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
             ++  ++ +G+F    P  D +      LI  +L V+P  R    D L HP  
Sbjct: 426 -PSMKEQILQGKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWF 478

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  151 bits (382), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 138/237 (58%), Gaps = 9/237 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + H NV++  D +E +T++Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 129 EIQIHKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQ 187

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 247

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDD 256
           PE++ G  + G  +  D+WS GV+L+ALL G+ PF  +D N  T+  +++   F  P + 
Sbjct: 248 PEVLMG-KHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEK 304

Query: 257 EVSREAQDLICKILTVDPKRRIKARDILKHPLLQK-YPSIRDSKSIRGLPREDTYLT 312
            +S EA+ LI  +L++DP  R    +I+ +   +  +P   +S  +  +P  D  LT
Sbjct: 305 HISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTLT 361

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  146 bits (369), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 144/272 (52%), Gaps = 28/272 (10%)

Query: 24  TLGLGSTGKVQLARNKSTGQEAAVKVISK-AVFNAGNMSGTSIVGSITPDALPYGIEREI 82
           TLG GS G+V L R+   G+  A+KV+ K  +     +  T+                E 
Sbjct: 113 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTN---------------DER 157

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
            ++ +++HP  +R++  ++    ++++++Y E GELF+LL +    P   A  +  ++ +
Sbjct: 158 RMLSVVSHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCL 217

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y H++ I++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y APE+V
Sbjct: 218 ALEYLHSMDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAPEVV 275

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREA 262
           S  PY   + D WS G+++F +L G  PF   D N       +   + + PS      +A
Sbjct: 276 STKPYNK-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFPS--IFHPDA 330

Query: 263 QDLICKILTVDPKRRI-----KARDILKHPLL 289
           QDL+C+++T D  +R+      + D+ +HP  
Sbjct: 331 QDLLCRLITRDLSKRLGNLQNGSEDVKRHPWF 362

>CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} similar
           to uniprot|P38147 Saccharomyces cerevisiae YBR274w CHK1
           regulats inhibitory Cdk phosphorylation of PDS1
          Length = 528

 Score =  148 bits (374), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 160/314 (50%), Gaps = 29/314 (9%)

Query: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNK-STGQEAAVKVISKAVFNAGN 59
           M     S+P IKD      +LG T+G GS G V+ AR K  +    AVK +         
Sbjct: 1   MVFTQESLPVIKDV-----ELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESG 55

Query: 60  MSGTSIVGSITPDALPYGIEREIIIM-KLLNHPNVLRLYDVWETNTDLYLVLEYAEKGEL 118
           +S   +              RE+++  K   H NVLR+ D       L+++LE A+ G+L
Sbjct: 56  LSQKDV-------------SREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDL 102

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
           F+ +     +  + A  +F+Q+I  ++Y H +G+ HRD+KPEN+LLD K N+K+ADFG+A
Sbjct: 103 FDKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLA 162

Query: 179 A-LETEGKLLETSC---GSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFD-- 232
           +    +   L  S    GSP Y APEI+S   Y    +D+WS GV+LF LLTG +P+   
Sbjct: 163 SQFRRKDGTLRVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIP 222

Query: 233 -EEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            +ED N    +    +G+  L   + V     +L+ KIL  DP++R+    +  HP L  
Sbjct: 223 AKEDDNYEWFV--NNEGKVSLGPWERVELRQMNLLRKILQPDPRKRVSLEKLRHHPWLTS 280

Query: 292 YPSIRDSKSIRGLP 305
              + +S+ +   P
Sbjct: 281 RSKLANSEGLCNNP 294

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  147 bits (370), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 91/287 (31%), Positives = 156/287 (54%), Gaps = 24/287 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G+TLG G+ G V+ AR  ST +  AVK++ K       + G  +   +  D      
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKA-----LKGNDVQLQLLYD------ 88

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++ +G   E +A++   
Sbjct: 89  --ELKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVT 146

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           QI+  V Y H+  IVHRDLKPEN+L     +   + +ADFG+A  L++  +L+  + GS 
Sbjct: 147 QILSAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSL 206

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG----QF 250
            Y APE+++     G   D+WS GV+ + LL+G  PF  E  ++   L +  +G    +F
Sbjct: 207 GYVAPEVLT-TSGHGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKF 263

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRD 297
             P  D +S +A++ I + L + P +R  A ++L+ P +    S ++
Sbjct: 264 HKPYWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score =  144 bits (364), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 143/274 (52%), Gaps = 21/274 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +++G  LG G  GKV   R+K +G   A+K I K                I    L   +
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEK--------------NEILQFNLLKQL 145

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
           +RE+ I   ++HPN+++LY  +     +YL++E++  GEL+  L   GP  +  A  +  
Sbjct: 146 KREVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIY 205

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAA 198
           QI   + Y H   I+HRD+KPEN+L+     +K+ADFG + L  EG   +T CG+  Y +
Sbjct: 206 QIADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTIDYLS 265

Query: 199 PEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGQFELPSDDE 257
           PE+++   Y     DVW+ GV+ + L+ G  PF+E   N + L  K + K     P  + 
Sbjct: 266 PEMITPREYDE-QVDVWALGVLAYELVVGVPPFEE---NSKELTYKRILKCDLNFP--ES 319

Query: 258 VSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           +S++A+DLI K+L  D  +R+    +  HP + K
Sbjct: 320 ISKDAKDLISKLLVTDTTQRLSLTGVKTHPWILK 353

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  144 bits (364), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 149/281 (53%), Gaps = 19/281 (6%)

Query: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSIT 70
           IK  T+  +++G+ LG G  GKV   ++K +G   A+K + K      N+          
Sbjct: 94  IKQTTLEDFEIGKKLGKGKFGKVYCVKHKKSGFICALKAMEKNEIIQYNLQKQ------- 146

Query: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130
                  + REI I  +LNHPN+ +LY  +     +Y+V+EY  +GEL+ LL   GP  +
Sbjct: 147 -------VRREIEIQTILNHPNLTKLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFND 199

Query: 131 NEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190
             A  +  QI   + Y H   I+HRD+KPEN+L+     +K+ DFG + +  +G   +T 
Sbjct: 200 VLASNYVYQIADALDYLHQKHIIHRDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTL 259

Query: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQF 250
           CG+  Y +PEI++   Y     D+W+ GV+ + L+ G   F+EE   +     ++ KG+ 
Sbjct: 260 CGTIDYLSPEIITSKEYD-HTVDIWALGVLAYELVVGSPAFEEETKEMT--YKRIVKGEL 316

Query: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
           + P  + +    +DLI +IL ++P +R+  ++I +HP + K
Sbjct: 317 KFP--EHLPNIVRDLIQRILVIEPSKRMSLKEIKRHPWILK 355

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  146 bits (368), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 152/281 (54%), Gaps = 24/281 (8%)

Query: 17  GPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPY 76
           G +  G+TLG G+ G V+ AR  ST ++ AVK+I K       + G  I   +  D    
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKA-----LKGNDIQLQMLYD---- 87

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRF 136
               E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +A++ 
Sbjct: 88  ----ELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKI 143

Query: 137 FRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEGKLLETSCG 192
             QI+  + Y H+  +VHRDLKPEN+L     +   I IADFG+A  L+ +  L+  + G
Sbjct: 144 VVQILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAG 203

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFEL 252
           S  Y APE+++   + G   D+WS GVI + LL G   F  E   +   L +  + +F +
Sbjct: 204 SLGYVAPEVLTEGGH-GKPCDIWSLGVITYTLLCGYSAFIAE--TVEGFLEECTRSKFPV 260

Query: 253 ----PSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
               P  D +S EA++ I + LT++P  R  A ++L+ P +
Sbjct: 261 KFHKPYWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  151 bits (381), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 129/211 (61%), Gaps = 10/211 (4%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K ++H N+++  D +E N ++Y++LE    G L  L+ +R  + E E   F  QI
Sbjct: 128 EIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQI 187

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHYA 197
             G+ Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   + E K   T CG+P+Y 
Sbjct: 188 CGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKF--TICGTPNYI 245

Query: 198 APEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           APE++ G  + G  +  D+WS GV+L+ALL G+ PF  +D N  T+  ++++  F  P D
Sbjct: 246 APEVLMG-KHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKD 302

Query: 256 DEVSREAQDLICKILTVDPKRRIKARDILKH 286
            ++S++A+ LI  IL+++P  R   ++I+ +
Sbjct: 303 KKISQDAKYLIDDILSLNPMERPSIQEIMDY 333

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 149/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     +  T+         
Sbjct: 40  TLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTN--------- 90

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
                  E  ++KL+ HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A
Sbjct: 91  ------DERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 144

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++ +G+ Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG 
Sbjct: 145 KFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGP 202

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           P Y APE+++  PY   + D WS GV++F +L G  PF   D        K+ +G+   P
Sbjct: 203 PDYIAPEVIATKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMKTYEKILQGKVVYP 259

Query: 254 SDDEVSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
           +      +  DL+ K++T D  RRI      ++DI  HP  
Sbjct: 260 T--FFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHPWF 298

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 148/295 (50%), Gaps = 28/295 (9%)

Query: 2   AVNGNSVPA-IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60
               +S PA  KD T+  +++G+ LG G  GKV   ++K TG   A+K + K        
Sbjct: 122 GTKADSSPARYKDFTLDDFEIGKKLGKGKFGKVYCVKHKQTGFICALKAMKKK------- 174

Query: 61  SGTSIVGSITPDALPYGIE----REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKG 116
                      + + Y +E    RE+ I   L HPN+ RLY  +     +YL++EY   G
Sbjct: 175 -----------EIIQYNVEKQFRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNG 223

Query: 117 ELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFG 176
           EL+  L   GP  +  A  F  Q+   + Y H+  I+HRD+KPEN+LL  +  +K+ DFG
Sbjct: 224 ELYKHLRSHGPFNDIVASHFVYQMADALDYMHSKHIIHRDIKPENILLGFQNTLKLTDFG 283

Query: 177 MAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDG 236
            +          T CG+  Y +PE++    Y     DVW+ GV+ + LL G  PF E+  
Sbjct: 284 WSVTNLNNSRRRTLCGTMDYLSPELIKSREYDN-KVDVWALGVLTYELLVGTPPFLEDSK 342

Query: 237 NIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
            +     ++++   + P  D +S +A+D+I K+L  +P  RI  RD+ KHP + K
Sbjct: 343 EM--TYKRIKRRDLKFP--DHISSQARDIISKLLEYEPNARIALRDVKKHPWILK 393

>KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 aa]
           {ON} 
          Length = 511

 Score =  147 bits (371), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 143/299 (47%), Gaps = 46/299 (15%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           + LG  LG G    V+  +NK TGQ  AVK+      +    S                 
Sbjct: 197 YTLGRELGSGHYAIVKEGKNKQTGQTVAVKIFHPQQNDDQKKSKQ--------------F 242

Query: 79  EREIIIMKLLNHPNVLRLYD-----VWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
             E  I+  ++HPN++ L D     + +  T  YLVLE  + GELF+ +V++  L ++E 
Sbjct: 243 REETNILMRIHHPNIVNLLDSFVEPISKQQTQKYLVLEKIDNGELFDRIVKKTCLRQDET 302

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLL--------DHK-----------YNIKIAD 174
              F QI+ G+ Y H   I+HRD+KPEN+LL        D K             +KIAD
Sbjct: 303 KAIFTQILHGLKYLHGQNIIHRDIKPENILLNITKRTSPDQKQLGPWDDDEIDVQVKIAD 362

Query: 175 FGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFD 232
           FG+A    E +   T CG+P Y APE++     +G+ S  D+WS GVIL+  L G  PF 
Sbjct: 363 FGLAKFTGEMQFTNTLCGTPSYVAPEVLIK---KGYTSKVDMWSSGVILYVCLCGFPPFS 419

Query: 233 EEDG--NIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
           ++ G   ++  +L+  K  F  P  D +      LI  +L +DP++R    D   HP L
Sbjct: 420 DQLGPPALKEQILQA-KFAFYTPYWDNIDDSILHLISHLLVLDPEQRYSVSDAFNHPWL 477

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 149/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  +     +  T+         
Sbjct: 69  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQVEHTND-------- 120

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
                ER +  +KL+ HP ++R++  ++   ++++V++Y E GELF+LL +    P   A
Sbjct: 121 -----ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVA 173

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y H   I++RDLKPEN+LLD   +IKI DFG A  E +  +  T CG+
Sbjct: 174 KFYAAEVILALEYLHGHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQ-TVTWTLCGT 231

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           P Y APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P
Sbjct: 232 PDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP 288

Query: 254 SDDEVSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
                  +  DL+ K++T D  RRI      +RDI  HP  
Sbjct: 289 P--YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 327

>Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa]
           {ON} complement(126043..127197) [1155 nt, 385 aa]
          Length = 384

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 149/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDA 73
           T+  +++  TLG GS G+V L R+    +  A+KV+ K  +F    +  T+         
Sbjct: 70  TLKDFQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMKQIEHTND-------- 121

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133
                ER+I  +K++ HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A
Sbjct: 122 -----ERKI--LKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 174

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+
Sbjct: 175 KFYAAEVILALDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVSTVTWTLCGT 232

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253
           P Y APE+++  PY   + D WS G++++ +L G  PF   D        K+  G+   P
Sbjct: 233 PDYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGKVNYP 289

Query: 254 SDDEVSREAQDLICKILTVDPKRRI-----KARDILKHPLL 289
           S      +  DL+ +++T D  RR+      A DI  H   
Sbjct: 290 S--FFHPDVIDLLARLITADLTRRLGNLQSGAEDIKSHAWF 328

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  149 bits (377), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 156/296 (52%), Gaps = 24/296 (8%)

Query: 22  GETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIERE 81
           G  LG G   +     N  +G+  A K ++K               SI  +     +  E
Sbjct: 86  GHFLGEGGFARC-FQFNDDSGKIFAAKTVAKL--------------SIKSEKTRRKLLSE 130

Query: 82  IIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           I I K + + N+++  D +E +T++Y++LE    G L +LL +R  L E E +RFF   I
Sbjct: 131 IQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQI 189

Query: 142 IG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAP 199
            G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y AP
Sbjct: 190 CGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 249

Query: 200 EIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDE 257
           E++ G  + G  +  D+WS GV+L+ALL G+ PF  +D N  T+  +++   F  P D  
Sbjct: 250 EVLMG-KHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKY 306

Query: 258 VSREAQDLICKILTVDPKRRIKARDILKHPLLQK-YPSIRDSKSIRGLPREDTYLT 312
           +S EA+ LI  +L++DP  R    +I+ +   +  +P   +S  +  +P  D  LT
Sbjct: 307 ISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQLT 362

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  149 bits (376), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 125/209 (59%), Gaps = 6/209 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + HPN+++  D +E +T++Y++LE    G L +LL +R  L E E   F  QI
Sbjct: 124 EIQIHKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQI 183

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAP 199
           +  + Y H   ++HRDLK  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y AP
Sbjct: 184 VGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 243

Query: 200 EIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDE 257
           E+++G  + G  +  D+WS GV+++ALL G+ PF  ++ NI  +  +++ G +  P +  
Sbjct: 244 EVLAG-KHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKP 300

Query: 258 VSREAQDLICKILTVDPKRRIKARDILKH 286
            S+E   LI  IL++DP  R    +I+ +
Sbjct: 301 TSKEVMVLIQDILSIDPIERPSLDEIMDY 329

>ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and to YFR014C
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
           Calmodulin-dependent protein kinase
          Length = 471

 Score =  145 bits (367), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 149/279 (53%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGI 78
           +  G TLG G+ G V+ AR  ST Q  AVK++ K       + G  +   +  D      
Sbjct: 59  YVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKA-----LKGNDVQLQMLYD------ 107

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFR 138
             E+ I++ L HPN++R  D +E+    Y+V + A  GELF+ ++ +G   E +A++   
Sbjct: 108 --ELSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKIVV 165

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           Q++  V Y H+  IVHRDLKPEN+L     +   + IADFG+A  L    +L+  + GS 
Sbjct: 166 QMLNAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAAGSL 225

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPS 254
            Y APE+++   + G   D+WS GVI + LL G  PF  E  ++   L +V K ++ +  
Sbjct: 226 GYVAPEVLTTNGH-GKPCDIWSLGVITYTLLCGYSPFVAE--SVEGFLEEVAKDRYPVKF 282

Query: 255 DDE----VSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            ++    +S EA+  I + L ++P+ R  A ++L  P +
Sbjct: 283 HEQYWSKISTEARRFILRALEINPQYRPTASELLCDPWI 321

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score =  143 bits (360), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 144/291 (49%), Gaps = 27/291 (9%)

Query: 5   GNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTS 64
           G  +  +++  +  +++G+ LG G  G+V   R+  +G   A+K + K            
Sbjct: 95  GVPLSKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKK----------- 143

Query: 65  IVGSITPDALPYGIE----REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
                  D + Y IE    RE+ I   L HPN+ +LY  +     +YL++EY   GEL+ 
Sbjct: 144 -------DIIQYNIEKQFRREVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYK 196

Query: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
            L  R    +  A  +  Q+   + Y H   I+HRD+KPEN+++     IK+ DFG + +
Sbjct: 197 HLKGRSHFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVI 256

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
             +G   +T CG+  Y +PE++    Y     DVW+ GV+ + LL G  PF+EE   +  
Sbjct: 257 TPKGSKRKTLCGTVDYLSPELIRSREYNE-KVDVWALGVLTYELLVGSPPFEEESKEL-- 313

Query: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQK 291
              ++ K     P  D V  EA+ LI ++L  DP  RI  +++ KHP ++K
Sbjct: 314 TYKRILKRNLIFP--DHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEK 362

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  150 bits (379), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 165/364 (45%), Gaps = 68/364 (18%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALP 75
           +G +++ + +G GS GKV LA ++ T ++  +K                     T D   
Sbjct: 38  VGNYRILKQIGEGSFGKVYLALHRPTHRKVVLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIR 135
             I RE+   +  ++P + ++Y++  T T +++ LEY    EL++ L+    +P  E   
Sbjct: 77  PNIVREVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD     K+ DFG          LET CG+  
Sbjct: 137 LFAQIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSD 255
           Y APE++    Y GF  D+W+ GVIL+ ++ G +PFDE+D               E+ + 
Sbjct: 197 YMAPELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD---------------EVKTK 241

Query: 256 DEVSREAQDLICKILTVD------------PKRRIKARDILKHPLLQKYPSIRDSKSIRG 303
            ++  E  D    I + D            P  R   R+ILKH  L+ Y      K+ + 
Sbjct: 242 WKIVNEDPDFTNNISSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPYGFTILEKTDKI 301

Query: 304 LPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRF 363
           + R+                   +N  I +H +    + ++LK  G + +   ++++ + 
Sbjct: 302 IQRQ-------------------RNDSIHFHSKIEKRLLKRLKRSGFDTQSIKHSIMKK- 341

Query: 364 KCDT 367
           KCD+
Sbjct: 342 KCDS 345

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  144 bits (362), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 143/261 (54%), Gaps = 23/261 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNKSTGQEAAVKVISK-AVFNAGNMSGTSIVGSITPDALPYG 77
           +++  TLG GS G+V L R+   G+  A+KVI K  V     +  T+             
Sbjct: 98  FQIMRTLGTGSFGRVHLVRSIHNGRFYALKVIKKNTVVRLKQIEHTN------------- 144

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFF 137
              E  ++ ++NHP ++R++  ++ +  ++++++Y E GELF+LL      P   A  + 
Sbjct: 145 --DERRMLSVVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYA 202

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            ++ + + Y H+L I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y 
Sbjct: 203 AEVCLALEYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYI 260

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDE 257
           APE+VS  PY   + D WS G++++ +L+GR PF +    I+T    +       PS   
Sbjct: 261 APEVVSSKPYNK-SVDWWSFGILIYEMLSGRTPFYDR-STIKT-YENILSAPLTFPS--Y 315

Query: 258 VSREAQDLICKILTVDPKRRI 278
           +  + QDL+ +++T D  +R+
Sbjct: 316 LHEDVQDLLNRLITRDLSKRL 336

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  149 bits (376), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 128/208 (61%), Gaps = 8/208 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + H N+++  D +E + ++Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 142 EIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I G + Y H+  I+HRDLK  N+  D  YN+K+ DFG+AA L  + +   T CG+P+Y A
Sbjct: 201 ICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 260

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDD 256
           PE++ G  + G  F  D+WS GV+++ALL G+ PF  +D N+  +  +++  ++  P D 
Sbjct: 261 PEVLMG-KHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDK 317

Query: 257 EVSREAQDLICKILTVDPKRRIKARDIL 284
            VS+EA+ LI  IL+++P +R    DI+
Sbjct: 318 YVSKEAEILIHDILSLNPLQRPTIIDII 345

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  145 bits (367), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 141/294 (47%), Gaps = 42/294 (14%)

Query: 22  GETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIERE 81
           G+ LG G    V+ A NK TGQ AAVK+      +    +                   E
Sbjct: 192 GKELGTGHYAVVKEAINKETGQIAAVKIFHPQQNDDQKKTKQ--------------FRDE 237

Query: 82  IIIMKLLNHPNVLRLYD-----VWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRF 136
             I+  + H N+++L D     V +++   YLVLE    GELF+ +V +  L ++E    
Sbjct: 238 TKILMRIQHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFDRIVRKTKLEQDETRAI 297

Query: 137 FRQIIIGVSYCHALGIVHRDLKPENLLLDHK-------------------YNIKIADFGM 177
           F+Q++ G+ Y H+  I+HRD+KPEN+LL  +                     +KIADFG+
Sbjct: 298 FKQLLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPWDRDEIDIKVKIADFGL 357

Query: 178 AALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDG- 236
           A    E K   T CG+P Y APE+++   Y     D+WS GV+L+  L G  PF E+   
Sbjct: 358 AKFTGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLLYVCLCGFPPFSEQLSP 416

Query: 237 -NIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLL 289
            +++  +L+  K  F  P  DE+   A  LI  +L V+P +R    D + HP  
Sbjct: 417 PSMKEQILQ-GKYAFYSPYWDEIDDSALHLISNLLVVNPAQRFSVNDTINHPWF 469

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score =  149 bits (375), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 149/279 (53%), Gaps = 20/279 (7%)

Query: 10  AIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSI 69
            IKDN+   ++  E LG G   +    ++   G   A K++SK               SI
Sbjct: 85  VIKDNSKKYFR-RECLGEGGFARCFHIKD-DVGISFACKIVSKK--------------SI 128

Query: 70  TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129
             +   + +  EI I + L + ++++  D +E   ++Y++LE    G L +LL +R  L 
Sbjct: 129 KTERTKFKLLSEIQIHQNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILT 188

Query: 130 ENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLE 188
           E E      Q+   ++Y H+  I+HRDLK  N+  D  +NIKI DFG+AA L    +   
Sbjct: 189 EAEVKFMTTQVCGAINYMHSNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKY 248

Query: 189 TSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQK 247
           T CG+P+Y APE++ S      F +D+WS G++++A++ G+ PF  +D  + T+  K++ 
Sbjct: 249 TMCGTPNYIAPEVILSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKD--VTTIYEKIKL 306

Query: 248 GQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKH 286
            Q+E P D  ++ + + LI  +L +DP +R +  DILK+
Sbjct: 307 CQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKY 345

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  148 bits (374), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 122/209 (58%), Gaps = 6/209 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + H NV++  D +E +T++Y++LE    G L  LL +R  + E E   F  QI
Sbjct: 138 EIQIHKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQI 197

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAP 199
              + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y AP
Sbjct: 198 CGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 257

Query: 200 EIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDE 257
           E++ G  + G  +  D+WS GV+++ALL G+ PF  +D N+  +  +++   F  P D  
Sbjct: 258 EVLMG-KHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKY 314

Query: 258 VSREAQDLICKILTVDPKRRIKARDILKH 286
           +S EA+ LI  IL+ DP  R    +I+ +
Sbjct: 315 ISNEAKTLIHDILSTDPLERPSIEEIIDY 343

>TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.222
           YPL209C
          Length = 374

 Score =  142 bits (358), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 136/264 (51%), Gaps = 19/264 (7%)

Query: 32  KVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREIIIMKLLNHP 91
           +V   ++K TG   A+K + K+     N+                   RE+ I   L+HP
Sbjct: 129 RVYCVKHKKTGFICAMKAMEKSELVQYNVQKQ--------------FRREVEIQSSLSHP 174

Query: 92  NVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALG 151
           N+ +LY  +  +  +YL++EY   GEL+ +L  RGP  +  A  +  Q+   + + H   
Sbjct: 175 NLTKLYGFFHDDKRVYLLMEYLVNGELYKVLKARGPFNDIVASHYVYQMADALDFMHQKN 234

Query: 152 IVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFA 211
           I+HRD+KPEN+L+     +K+ DFG + +   G   +T CG+  Y +PE+++   Y    
Sbjct: 235 IIHRDVKPENILMGFGNVVKLTDFGWSIISARGVRRKTLCGTIDYLSPELITSREYDD-K 293

Query: 212 SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILT 271
            DVW+ GV+ + L+    PF+E+  +  +   ++  G  + P  D +S +AQDLI K+L 
Sbjct: 294 VDVWALGVLTYELIVNSPPFEEDSKD--STYKRIVSGDLKFP--DTISSDAQDLIRKLLR 349

Query: 272 VDPKRRIKARDILKHPLLQKYPSI 295
              K RI  +D+ +HP + K+ S 
Sbjct: 350 HKAKDRISLQDVKRHPWILKHKSF 373

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  142 bits (359), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/274 (29%), Positives = 144/274 (52%), Gaps = 28/274 (10%)

Query: 24  TLGLGSTGKVQLARNKSTGQEAAVKVISKA-VFNAGNMSGTSIVGSITPDALPYGIEREI 82
           TLG GS G+V L R++  G+  A+KV+ K  V     +  T+                E 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTN---------------DER 136

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIII 142
           +++ ++ HP ++R++  ++ +  ++++++Y E GELF+LL +    P   A  +  ++ +
Sbjct: 137 LMLSIVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCL 196

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+V
Sbjct: 197 ALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVV 254

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREA 262
           S  PY   + D WS G++++ +L G  PF   D N      K+   +   P     + + 
Sbjct: 255 STKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPP--FFNEDV 309

Query: 263 QDLICKILTVDPKRRI-----KARDILKHPLLQK 291
           +DL+ +++T D  +R+        D+  HP  ++
Sbjct: 310 KDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,215,034
Number of extensions: 4500381
Number of successful extensions: 19384
Number of sequences better than 10.0: 2064
Number of HSP's gapped: 15573
Number of HSP's successfully gapped: 2398
Length of query: 1135
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1014
Effective length of database: 39,606,813
Effective search space: 40161308382
Effective search space used: 40161308382
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)