Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6975.528ON32321651e-17
Smik_4.6985.528ON39332922e-05
YDR423C (CAD1)5.528ON40932861e-04
Suva_2.600singletonOFF38232852e-04
TPHA0D023405.528ON50625670.041
Kpol_1023.975.528ON59123660.066
YML007W (YAP1)5.528ON65022640.12
Smik_13.1445.528ON63922640.12
Skud_13.1475.528ON66522640.13
Suva_13.1555.528ON64522630.14
TPHA0K005205.528ON56020630.15
TDEL0A039205.528ON46622630.15
KNAG0B036805.528ON48220620.19
TBLA0D016405.528ON59924620.22
ZYRO0D12584g5.528ON57922620.22
NDAI0C010605.528ON63720620.23
Kpol_1004.225.528ON47525620.24
NCAS0H025605.528ON58720610.30
CAGL0H04631g5.528ON58820610.31
KAFR0C054005.528ON48120590.54
TBLA0G009305.528ON60820590.62
NOTE: 11 genes in the same pillar as Skud_4.697 were not hit in these BLAST results
LIST: KAFR0E03290 NCAS0F01100 KNAG0C03210 KLTH0G03784g ADR195C NDAI0H01610 Kwal_47.18631 Ecym_4064 KLLA0A01760g CAGL0F03069g SAKL0G04950g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.697
         (32 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.697 Chr4 complement(1239012..1239107) [96 bp, 32 aa] {ON}...    68   1e-17
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    40   2e-05
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    38   1e-04
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    37   2e-04
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    30   0.041
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...    30   0.066
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    29   0.12 
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    29   0.12 
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...    29   0.13 
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    29   0.14 
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    29   0.15 
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    29   0.15 
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    28   0.19 
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    28   0.22 
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...    28   0.22 
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...    28   0.23 
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    28   0.24 
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    28   0.30 
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    28   0.31 
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    27   0.54 
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    27   0.62 

>Skud_4.697 Chr4 complement(1239012..1239107) [96 bp, 32 aa] {ON}
          YDR423C (INTER)
          Length = 32

 Score = 68.2 bits (165), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 32/32 (100%), Positives = 32/32 (100%)

Query: 1  TLPKYSPLNTDNLCRQLMVNARFTDDSRAMLQ 32
          TLPKYSPLNTDNLCRQLMVNARFTDDSRAMLQ
Sbjct: 1  TLPKYSPLNTDNLCRQLMVNARFTDDSRAMLQ 32

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 40.0 bits (92), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (71%)

Query: 1   TLPKYSPLNTDNLCRQLMVNARFTDDSRAMLQ 32
           +LPKYS L+ DNLC +LM  A FTDD   +++
Sbjct: 349 SLPKYSSLDIDNLCCELMTKAEFTDDCEIVVR 380

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 37.7 bits (86), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 25/32 (78%)

Query: 1   TLPKYSPLNTDNLCRQLMVNARFTDDSRAMLQ 32
           +LPKYS L+ D+LC +L++ A+ TDD + +++
Sbjct: 365 SLPKYSSLDIDDLCSELIIKAKCTDDCKIVVK 396

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 37.4 bits (85), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 24/32 (75%)

Query: 1   TLPKYSPLNTDNLCRQLMVNARFTDDSRAMLQ 32
           ++PK+S L+ DNLC +LMV A+ + D + M+Q
Sbjct: 338 SIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQ 369

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 30.4 bits (67), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 1   TLPKYSPLNTDNLCRQLMVNARFTD 25
           T P+YS ++ D LC +LM +A+ +D
Sbjct: 463 TYPRYSDIDIDGLCEELMASAKCSD 487

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score = 30.0 bits (66), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 18/23 (78%)

Query: 3   PKYSPLNTDNLCRQLMVNARFTD 25
           P+YS ++ D LC++LM NA+ +D
Sbjct: 550 PRYSDIDIDGLCQELMHNAKCSD 572

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 29.3 bits (64), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 1   TLPKYSPLNTDNLCRQLMVNAR 22
           T PKYS ++ D LC +LM  A+
Sbjct: 607 THPKYSDIDVDGLCSELMAKAK 628

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 29.3 bits (64), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 1   TLPKYSPLNTDNLCRQLMVNAR 22
           T PKYS ++ D LC +LM  A+
Sbjct: 596 THPKYSDIDVDGLCSELMAKAK 617

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 29.3 bits (64), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 1   TLPKYSPLNTDNLCRQLMVNAR 22
           T PKYS ++ D LC +LM  A+
Sbjct: 622 THPKYSDIDVDGLCSELMAKAK 643

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 28.9 bits (63), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 1   TLPKYSPLNTDNLCRQLMVNAR 22
           T PKYS ++ D LC +LM  A+
Sbjct: 602 THPKYSDIDVDGLCSELMAKAK 623

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 28.9 bits (63), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 3   PKYSPLNTDNLCRQLMVNAR 22
           PKYS L+ D LC +LM+ A+
Sbjct: 518 PKYSELDIDGLCTELMLQAK 537

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 28.9 bits (63), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 1   TLPKYSPLNTDNLCRQLMVNAR 22
           T PKYS ++ D LC +LM  A+
Sbjct: 422 THPKYSAIDIDGLCGELMTKAK 443

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 28.5 bits (62), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 3   PKYSPLNTDNLCRQLMVNAR 22
           PKYS L+ D LC +LM  A+
Sbjct: 441 PKYSDLDIDGLCGELMTKAK 460

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 28.5 bits (62), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 17/24 (70%)

Query: 2   LPKYSPLNTDNLCRQLMVNARFTD 25
           LPKY+  + +NLC +LM  A+ +D
Sbjct: 549 LPKYTSADIENLCNELMSKAKCSD 572

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 28.5 bits (62), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 16/22 (72%)

Query: 1   TLPKYSPLNTDNLCRQLMVNAR 22
           + PKYS ++ D LC++LM  A+
Sbjct: 536 SHPKYSDMDIDGLCQELMAKAK 557

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score = 28.5 bits (62), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 3   PKYSPLNTDNLCRQLMVNAR 22
           PKYS L+ D LC +LM  A+
Sbjct: 596 PKYSELDIDGLCSELMTKAK 615

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 28.5 bits (62), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 1   TLPKYSPLNTDNLCRQLMVNARFTD 25
           T P+Y+ L+ D LC +LM +A+ +D
Sbjct: 432 TNPRYTDLDIDGLCEELMFSAKCSD 456

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 28.1 bits (61), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 3   PKYSPLNTDNLCRQLMVNAR 22
           PKYS L+ D LC +LM  A+
Sbjct: 546 PKYSDLDIDGLCSELMTKAK 565

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score = 28.1 bits (61), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 3   PKYSPLNTDNLCRQLMVNAR 22
           PKYS ++ D LC +LM  A+
Sbjct: 547 PKYSDIDIDGLCSELMAKAK 566

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 27.3 bits (59), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 3   PKYSPLNTDNLCRQLMVNAR 22
           PKYS ++ D LC +LM  A+
Sbjct: 440 PKYSDIDIDGLCGELMAKAK 459

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 27.3 bits (59), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 3   PKYSPLNTDNLCRQLMVNAR 22
           PKYS L+ D LC +LM  A+
Sbjct: 567 PKYSDLDIDGLCTELMHKAK 586

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 3,578,556
Number of extensions: 60761
Number of successful extensions: 108
Number of sequences better than 10.0: 21
Number of HSP's gapped: 108
Number of HSP's successfully gapped: 21
Length of query: 32
Length of database: 53,481,399
Length adjustment: 7
Effective length of query: 25
Effective length of database: 52,678,737
Effective search space: 1316968425
Effective search space used: 1316968425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)