Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6955.525ON95495451390.0
YDR421W (ARO80)5.525ON95095441820.0
Suva_2.5985.525ON96595140490.0
Smik_4.6965.525ON94995440450.0
KAFR0E033105.525ON93896922940.0
SAKL0G04884g5.525ON93097021760.0
NCAS0F010705.525ON90492521480.0
NDAI0H015805.525ON90992820900.0
Kpol_1028.825.525ON92595619870.0
ZYRO0D12518g5.525ON88178019490.0
TDEL0A038905.525ON83192419220.0
KLLA0A01804g5.525ON94597818980.0
KNAG0C032505.525ON93695418410.0
KLTH0G03718g5.525ON85793118090.0
TPHA0L003505.525ON85993618030.0
TBLA0D016705.525ON101882716950.0
CAGL0F03025g5.525ON92896215620.0
ADR199C5.525ON944100215080.0
TBLA0E034803.109ON1046601211e-05
SAKL0D00264g8.879ON848431192e-05
Kwal_27.96888.879ON841591183e-05
KLTH0E16500g8.879ON833561156e-05
NDAI0K001508.879ON953431131e-04
KNAG0J002108.879ON861581112e-04
NCAS0C002208.879ON839531102e-04
Kpol_1001.34.344ON8561131103e-04
TDEL0B004808.879ON835431093e-04
TPHA0B004104.344ON945561075e-04
Kwal_55.20722singletonON8271021076e-04
ZYRO0C18150g1.128ON571731066e-04
TBLA0G026102.231ON1000781068e-04
TBLA0E047504.344ON1283721068e-04
Kpol_538.528.879ON907411050.001
NDAI0I021906.61ON735921050.001
AAL175W8.879ON883421040.001
TBLA0A007302.654ON1037801030.001
NDAI0E038507.56ON768451030.002
KLTH0D07260g2.547ON979861030.002
NCAS0H034202.654ON9021681030.002
ZYRO0B00242gsingletonON638561020.002
NDAI0B015402.565ON803991020.002
NDAI0D00900singletonON865551020.002
KAFR0C013203.109ON1006821020.002
NCAS0B065502.231ON906591020.002
KNAG0F037207.512ON7663431020.002
KNAG0E041004.344ON9032191020.002
KAFR0A03060singletonON860461010.002
Ecym_53972.231ON826611010.003
KNAG0K008203.109ON1050541010.003
NDAI0F00110singletonON508461000.003
Kpol_1039.112.231ON992531010.003
TBLA0C062306.60ON795641010.003
Smik_12.1578.283ON6441071010.003
Ecym_2672na 1ON739551000.003
NCAS0A061904.344ON894501000.004
NDAI0K018002.547ON1210661000.004
NDAI0B038502.231ON93099990.004
KLTH0D00594gna 2ON63150990.004
YML076C (WAR1)4.344ON944129990.005
KAFR0L021308.879ON88242990.005
KLLA0E02663gna 3ON110952980.006
Smik_4.8011.26ON771173980.006
TPHA0C049808.879ON85243980.006
ZYRO0A00440g8.879ON85043980.006
SAKL0E08998g2.231ON82361980.006
NCAS0A150207.512ON80946980.006
CAGL0H06875g8.879ON70239980.007
KAFR0J017102.231ON84861980.007
TBLA0G011308.879ON113241980.007
KLTH0E05786gna 4ON81779980.007
NDAI0C002602.654ON104153980.007
Smik_15.3506.61ON78474970.008
Kwal_26.81092.547ON97056970.008
AGL206Cna 1ON73555970.008
KAFR0F014901.128ON65848960.009
TDEL0D051503.109ON99643970.009
Kpol_1042.66.60ON78065960.009
YIL130W (ASG1)2.231ON964130970.009
Suva_7.2684.113ON100048970.009
Ecym_81598.879ON90842960.010
Skud_15.3346.61ON79073960.010
KLTH0H16170gna 5ON61980960.010
KLTH0E07854g4.113ON938243960.011
KLLA0A02585gna 6ON37051950.011
Kpol_455.108.879ON83042960.012
KNAG0M00120singletonON88146960.012
KLTH0D16852g4.344ON81144950.012
YKL038W (RGT1)2.547ON117066950.013
Smik_17.27singletonON68860950.013
Skud_9.372.231ON954130950.014
Suva_13.764.344ON946112950.014
KLLA0A06039g1.199ON65750950.015
Suva_8.2256.61ON80174950.015
Skud_13.664.344ON939100950.015
Kwal_27.108527.389ON104655950.016
TBLA0F012003.109ON108671940.018
KNAG0A071002.547ON128658940.019
Skud_11.1902.547ON117161940.022
YGL013C (PDR1)4.113ON106883940.022
Skud_7.2744.113ON108048930.022
TDEL0G04890singletonON58445930.022
SAKL0G17908g4.344ON80944930.022
SAKL0H00682gna 7ON92264930.022
TBLA0A04280singletonON89257930.024
CAGL0F07909g3.109ON104944930.024
Kwal_56.226053.109ON86543930.024
SAKL0A00704gna 8ON71853930.024
Smik_11.2102.547ON116961930.026
TBLA0G005206.61ON87883920.028
Suva_11.1872.547ON117166930.029
Suva_15.415na 9ON86745920.029
Skud_13.438.879ON88041920.029
KLLA0D10197g8.879ON85636920.029
KNAG0A02300singletonON72969920.030
NCAS0C047803.109ON91451920.030
Kpol_495.213.109ON108544920.031
NDAI0A034204.113ON110847920.034
Smik_9.392.231ON101257920.034
KAFR0B014502.547ON108869920.034
Smik_13.368.879ON88041920.036
KLTH0E14454gna 10ON90244910.037
Suva_10.18na 11ON84249910.038
YML099C (ARG81)8.879ON88041910.038
SAKL0H25146gna 12ON64586910.038
TDEL0G041006.60ON69966910.039
Ecym_6141na 13ON11453840.039
TDEL0C044802.231ON85255910.039
Suva_13.498.879ON88241910.039
NCAS0D027206.60ON757120910.040
Suva_9.592.231ON92657910.042
Smik_7.2774.113ON106948910.044
Skud_11.3001.199ON86577910.046
KAFR0A014801.277ON72563900.047
Skud_2.397.389ON115955910.047
NCAS0A047502.547ON114168900.052
SAKL0D02596gna 1ON75053900.052
Kwal_47.168624.344ON74343900.053
KLTH0F00990g1.26ON78559900.053
YBL066C (SEF1)7.389ON114855900.054
Kpol_1023.415.322ON81550900.055
TPHA0F025506.61ON79957900.056
NDAI0D031804.344ON98990900.057
Kpol_1049.19na 9ON94344900.059
NCAS0A125802.547ON70456900.060
Smik_2.507.389ON115055900.061
KLLA0F09559gsingletonON65865890.062
TBLA0I025408.423ON125943900.064
KLLA0D00484g6.0ON100456890.065
Kwal_34.15751na 5ON62883890.068
SAKL0C09944g3.109ON106185890.069
ZYRO0B14718g4.344ON103553890.072
ZYRO0E06270g2.565ON91278890.078
KAFR0A021302.565ON70760890.078
Kwal_23.47542.231ON81244890.079
NCAS0H00780singletonON90944890.079
CAGL0I07755g3.109ON105344890.080
TBLA0G01100singletonON63339880.080
KLTH0G09108g2.231ON78244880.082
TPHA0A045403.109ON117843890.082
SAKL0A09856g2.547ON102059890.084
KLLA0F02750g3.109ON114846890.084
KAFR0C03660singletonON847107880.085
KLLA0F04609g2.231ON91644880.086
NCAS0A127202.565ON75982880.087
KLTH0D01804g7.56ON65252880.089
NCAS0B082001.199ON875104880.090
SAKL0D01100g4.113ON94072880.093
NCAS0E023107.56ON71846880.095
TBLA0C040504.113ON120749880.098
KLTH0C10098g6.60ON77165880.099
TDEL0D007304.344ON80679880.10
TPHA0F013802.231ON89044880.10
KNAG0E017602.231ON90244880.10
SAKL0G19470g2.654ON83150870.11
Smik_13.644.344ON94450880.11
Skud_4.7951.26ON77560870.11
KNAG0E041507.17ON113651880.11
NDAI0G041403.109ON100190870.11
KLTH0E06666gna 14ON946253870.12
SAKL0C03938g1.128ON78048870.12
KAFR0A066904.113ON99751870.12
Kwal_47.175064.113ON92445870.12
Ecym_7440na 10ON898104870.12
KNAG0M015605.322ON95050870.12
TPHA0F025406.60ON79371870.12
Kwal_56.230583.264ON775100870.13
KNAG0H012603.264ON74164870.13
Suva_2.517.389ON115555870.13
KLLA0A10329gna 15ON63950870.13
KLLA0B04620g4.344ON91944870.13
KLTH0H01672gna 16ON70158860.14
Suva_15.773.109ON102943870.14
CAGL0M02651g8.642ON46240860.14
TBLA0G00490singletonON91861860.15
SAKL0D14916gna 2ON632119860.15
ZYRO0D14058g6.60ON75869860.15
CAGL0G08844g2.231ON84745860.15
Ecym_33842.662ON114689860.16
Kwal_23.6425na 8ON73545860.16
KAFR0F034104.113ON99552860.16
ACR241C1.199ON79569860.16
TBLA0D054201.277ON75758860.17
SAKL0G07634gsingletonON92250860.17
KAFR0C039002.654ON81844860.17
ZYRO0D08316gna 17ON68084860.17
AFR096W1.277ON85263860.18
Skud_15.643.109ON103243860.18
TBLA0G01090singletonON82261860.18
CAGL0L03377g1.277ON120955860.18
AER370W2.231ON80144850.19
KLTH0C07480g3.264ON77554850.19
Kwal_26.6732na 2ON676155850.19
NDAI0A010401.199ON99537850.19
YMR019W (STB4)2.565ON94973850.19
YLL054Cna 11ON84394850.20
Ecym_1146na 18ON66543850.20
TDEL0A02690singletonON722105850.20
NCAS0H002707.512ON90658850.20
Skud_12.3466.60ON69481850.20
SAKL0D03586g3.264ON80147850.21
TDEL0E00300singletonON63761850.21
AAL057C5.322ON80972850.21
KNAG0A044808.423ON101343850.22
Skud_15.5027.56ON75942850.23
TBLA0H03910singletonON76748850.23
KLTH0D16456gna 18ON66153850.23
YBR297W (MAL33)na 19ON46873840.23
Kpol_2001.161.199ON80244850.24
KNAG0M021202.565ON60850840.24
KNAG0F028306.60ON74647840.24
SAKL0B04620gna 6ON36246830.25
NCAS0A035804.113ON111354850.25
TPHA0E038301.26ON82258840.25
KNAG0A025508.423ON73057840.25
NDAI0B016802.547ON92456840.25
Ecym_5001singletonON60744840.26
TPHA0O006001.380ON137234840.26
Kpol_1061.113.264ON73383840.26
NCAS0I002707.17ON94448840.27
YDR520C (URC2)1.26ON77258840.27
TPHA0B015854.344ON81245840.28
YOR172W (YRM1)6.61ON78674840.28
SAKL0G02992gna 3ON106157840.28
Skud_10.101.128ON83345840.29
KAFR0I002804.344ON93656840.29
TPHA0N002307.17ON123260840.30
Ecym_63401.277ON95255840.30
Kwal_33.139341.199ON79795840.30
KLLA0F04213g3.264ON76847840.31
Kpol_1002.52.547ON95878840.31
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.695
         (954 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...  1984   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...  1615   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...  1564   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...  1562   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   888   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   842   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   832   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   809   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   769   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   755   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   744   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   735   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   713   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   701   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     699   0.0  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   657   0.0  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   606   0.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   585   0.0  
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    51   1e-05
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    50   2e-05
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    50   3e-05
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    49   6e-05
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    48   1e-04
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    47   2e-04
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       47   2e-04
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    47   3e-04
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    47   3e-04
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    46   5e-04
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    46   6e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    45   6e-04
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    45   8e-04
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    45   8e-04
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    45   0.001
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    45   0.001
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    45   0.001
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    44   0.001
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      44   0.002
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    44   0.002
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    44   0.002
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    44   0.002
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    44   0.002
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               44   0.002
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    44   0.002
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    44   0.002
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    44   0.002
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    44   0.002
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    44   0.002
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    44   0.003
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    44   0.003
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 43   0.003
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    44   0.003
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.003
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    44   0.003
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    43   0.003
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    43   0.004
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    43   0.004
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    43   0.004
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    43   0.004
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    43   0.005
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    43   0.005
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    42   0.006
Smik_4.801 Chr4 complement(1403910..1406225) [2316 bp, 771 aa] {...    42   0.006
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    42   0.006
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    42   0.006
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    42   0.006
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    42   0.006
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    42   0.007
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    42   0.007
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    42   0.007
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    42   0.007
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    42   0.007
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    42   0.008
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    42   0.008
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    42   0.008
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    42   0.009
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    42   0.009
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    42   0.009
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    42   0.009
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    42   0.009
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    42   0.010
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    42   0.010
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    42   0.010
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    42   0.011
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    41   0.011
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    42   0.012
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      42   0.012
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    41   0.012
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    41   0.013
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    41   0.013
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    41   0.014
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    41   0.014
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.015
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    41   0.015
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    41   0.015
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    41   0.016
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    41   0.018
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    41   0.019
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    41   0.022
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    41   0.022
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    40   0.022
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    40   0.022
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    40   0.022
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    40   0.022
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    40   0.024
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    40   0.024
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    40   0.024
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    40   0.024
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    40   0.026
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    40   0.028
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    40   0.029
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    40   0.029
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    40   0.029
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    40   0.029
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    40   0.030
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               40   0.030
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    40   0.031
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    40   0.034
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    40   0.034
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    40   0.034
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    40   0.036
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    40   0.037
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    40   0.038
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    40   0.038
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    40   0.038
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    40   0.039
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    37   0.039
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    40   0.039
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    40   0.039
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    40   0.040
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    40   0.042
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    40   0.044
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    40   0.046
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    39   0.047
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    40   0.047
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    39   0.052
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    39   0.052
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    39   0.053
KLTH0F00990g Chr6 (77084..79441) [2358 bp, 785 aa] {ON} similar ...    39   0.053
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    39   0.054
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    39   0.055
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    39   0.056
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    39   0.057
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    39   0.059
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    39   0.060
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.061
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    39   0.062
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    39   0.064
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    39   0.065
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    39   0.068
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    39   0.069
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    39   0.072
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    39   0.078
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    39   0.078
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    39   0.079
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    39   0.079
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    39   0.080
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    39   0.080
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    39   0.082
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    39   0.082
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    39   0.084
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    39   0.084
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    39   0.085
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    39   0.086
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    39   0.087
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    39   0.089
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    39   0.090
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    39   0.093
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      39   0.095
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    39   0.098
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    39   0.099
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    39   0.10 
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    39   0.10 
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    39   0.10 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    38   0.11 
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    39   0.11 
Skud_4.795 Chr4 complement(1401165..1403492) [2328 bp, 775 aa] {...    38   0.11 
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    39   0.11 
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    38   0.11 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    38   0.12 
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    38   0.12 
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    38   0.12 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    38   0.12 
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    38   0.12 
KNAG0M01560 Chr13 (276011..278863) [2853 bp, 950 aa] {ON} Anc_5....    38   0.12 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    38   0.12 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    38   0.13 
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    38   0.13 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    38   0.13 
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    38   0.13 
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    38   0.13 
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    38   0.14 
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    38   0.14 
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    38   0.14 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                38   0.15 
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    38   0.15 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    38   0.15 
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    38   0.15 
Ecym_3384 Chr3 complement(728692..732132) [3441 bp, 1146 aa] {ON...    38   0.16 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    38   0.16 
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    38   0.16 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    38   0.16 
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    38   0.17 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    38   0.17 
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    38   0.17 
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    38   0.17 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    38   0.18 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    38   0.18 
TBLA0G01090 Chr7 complement(275031..277499) [2469 bp, 822 aa] {O...    38   0.18 
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    38   0.18 
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    37   0.19 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    37   0.19 
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    37   0.19 
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    37   0.19 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    37   0.19 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    37   0.20 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    37   0.20 
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               37   0.20 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    37   0.20 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.20 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.21 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 37   0.21 
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    37   0.21 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    37   0.22 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    37   0.23 
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    37   0.23 
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    37   0.23 
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    37   0.23 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.24 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    37   0.24 
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               37   0.24 
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    37   0.25 
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    37   0.25 
TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {O...    37   0.25 
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    37   0.25 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     37   0.25 
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    37   0.26 
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    37   0.26 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    37   0.26 
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    37   0.27 
YDR520C Chr4 complement(1481085..1483403) [2319 bp, 772 aa] {ON}...    37   0.27 
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     37   0.28 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    37   0.28 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    37   0.28 
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    37   0.29 
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    37   0.29 
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    37   0.30 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    37   0.30 
Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {...    37   0.30 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    37   0.31 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    37   0.31 
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    37   0.32 
Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C ...    37   0.32 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    37   0.32 
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    37   0.32 
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    37   0.33 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    37   0.34 
TPHA0D01900 Chr4 complement(395128..397812) [2685 bp, 894 aa] {O...    37   0.34 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    37   0.35 
ZYRO0F18018g Chr6 complement(1490451..1492637) [2187 bp, 728 aa]...    37   0.35 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    37   0.35 
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    37   0.36 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    37   0.37 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    37   0.37 
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    37   0.38 
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    37   0.38 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    37   0.38 
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    37   0.38 
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    37   0.38 
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    37   0.38 
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    37   0.39 
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    37   0.39 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    36   0.39 
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    37   0.39 
NDAI0E02270 Chr5 (466651..468141) [1491 bp, 496 aa] {ON} Anc_8.642     36   0.40 
KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121     36   0.40 
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    37   0.40 
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    37   0.41 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      34   0.42 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    36   0.42 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    36   0.43 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    36   0.44 
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    36   0.45 
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            36   0.46 
TBLA0A00280 Chr1 (45618..47912) [2295 bp, 764 aa] {ON}                 36   0.46 
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    36   0.46 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    36   0.47 
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    36   0.49 
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     36   0.49 
NCAS0F02700 Chr6 complement(547682..550189) [2508 bp, 835 aa] {O...    36   0.49 
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    36   0.51 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    36   0.51 
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    36   0.53 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    36   0.54 
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    36   0.55 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    36   0.55 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    36   0.55 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               36   0.55 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    36   0.56 
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    36   0.56 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    36   0.57 
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    36   0.57 
CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly...    36   0.57 
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    36   0.57 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    36   0.58 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    36   0.59 
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    36   0.59 
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    36   0.60 
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    36   0.60 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    36   0.60 
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    36   0.61 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    36   0.61 
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    36   0.61 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    36   0.61 
Ecym_3200 Chr3 complement(384639..387116) [2478 bp, 825 aa] {ON}...    36   0.62 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    36   0.63 
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    36   0.65 
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    36   0.66 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    36   0.66 
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    36   0.67 
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    36   0.67 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    36   0.68 
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    36   0.68 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    36   0.68 
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    36   0.70 
TBLA0E03050 Chr5 complement(764239..766578) [2340 bp, 779 aa] {O...    36   0.70 
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    36   0.70 
NDAI0C04170 Chr3 complement(953071..955548) [2478 bp, 825 aa] {O...    36   0.71 
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    35   0.73 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    35   0.73 
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    35   0.74 
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    35   0.75 
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    35   0.75 
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    36   0.76 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    35   0.77 
KAFR0G01220 Chr7 (276857..279406) [2550 bp, 849 aa] {ON} Anc_1.2...    35   0.78 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    35   0.80 
KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON} Anc_5.3...    35   0.80 
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    35   0.82 
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    35   0.84 
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    35   0.85 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    35   0.86 
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    35   0.86 
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    35   0.86 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    35   0.86 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    35   0.87 
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    35   0.87 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    35   0.88 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    35   0.88 
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    35   0.89 
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    35   0.90 
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    35   0.91 
KLLA0C01023g Chr3 (76863..78773) [1911 bp, 636 aa] {ON} similar ...    35   0.92 
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    35   0.93 
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    35   0.93 
Kwal_14.2619 s14 (835443..838946) [3504 bp, 1167 aa] {ON} YLR256...    35   0.94 
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    35   0.95 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    35   0.95 
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    35   0.96 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    35   0.97 
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    35   0.98 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    35   0.99 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    35   0.99 
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    35   0.99 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    35   1.00 
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    35   1.0  
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    35   1.0  
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    35   1.1  
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    35   1.1  
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    35   1.1  
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    35   1.1  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    35   1.1  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    35   1.2  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    35   1.2  
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    35   1.2  
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    35   1.2  
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    35   1.2  
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    35   1.2  
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...    35   1.2  
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    35   1.2  
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...    35   1.2  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    35   1.3  
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               35   1.3  
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    35   1.3  
NCAS0I02410 Chr9 (451205..453964) [2760 bp, 919 aa] {ON} Anc_3.1...    35   1.4  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    35   1.4  
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    35   1.4  
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    35   1.4  
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    35   1.4  
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    33   1.4  
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    35   1.4  
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    35   1.5  
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    35   1.5  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    35   1.5  
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    35   1.5  
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    35   1.5  
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    35   1.5  
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    35   1.5  
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    35   1.5  
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    35   1.6  
ZYRO0C13882g Chr3 complement(1093041..1095542) [2502 bp, 833 aa]...    35   1.6  
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    35   1.6  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    35   1.6  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    34   1.6  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    35   1.7  
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    34   1.7  
SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} simila...    34   1.7  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    34   1.8  
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    34   1.8  
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    34   1.8  
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    32   1.8  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...    34   1.8  
Smik_4.552 Chr4 complement(1000275..1002938) [2664 bp, 887 aa] {...    34   1.8  
TPHA0D00660 Chr4 complement(130279..131415) [1137 bp, 378 aa] {O...    34   1.8  
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    34   1.8  
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    34   1.9  
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    34   1.9  
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    34   1.9  
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    34   1.9  
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    34   2.0  
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    34   2.0  
Suva_2.469 Chr2 complement(833514..836180) [2667 bp, 888 aa] {ON...    34   2.0  
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    34   2.0  
YDR303C Chr4 complement(1068729..1071386) [2658 bp, 885 aa] {ON}...    34   2.1  
KLTH0A07766g Chr1 (654163..655980) [1818 bp, 605 aa] {ON} conser...    34   2.1  
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    34   2.1  
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    34   2.1  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    34   2.1  
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    34   2.1  
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    34   2.1  
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    34   2.1  
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    34   2.2  
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    34   2.2  
Skud_4.565 Chr4 complement(1011134..1013803) [2670 bp, 889 aa] {...    34   2.2  
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    34   2.2  
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    34   2.2  
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    34   2.2  
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    34   2.3  
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    34   2.3  
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    34   2.3  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    34   2.3  
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    34   2.3  
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    34   2.3  
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    34   2.3  
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    34   2.3  
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    34   2.3  
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    34   2.6  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    34   2.7  
KAFR0H02600 Chr8 complement(496353..497432) [1080 bp, 359 aa] {O...    33   2.8  
TBLA0F03550 Chr6 complement(875734..876630) [897 bp, 298 aa] {ON...    33   2.8  
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    34   2.8  
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    34   2.8  
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    33   2.8  
KLLA0C08657g Chr3 (757100..759268) [2169 bp, 722 aa] {ON} some s...    33   2.9  
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    33   2.9  
Skud_9.204 Chr9 (367291..370320) [3030 bp, 1009 aa] {ON} YIR023W...    33   2.9  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...    34   2.9  
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    33   3.0  
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    33   3.0  
NDAI0F02030 Chr6 complement(499614..501464) [1851 bp, 616 aa] {O...    33   3.0  
Kpol_2002.26 s2002 (52403..54820) [2418 bp, 805 aa] {ON} (52403....    33   3.0  
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    33   3.0  
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    33   3.1  
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    33   3.1  
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    33   3.1  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    33   3.2  
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     33   3.3  
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    33   3.3  
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    33   3.4  
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    33   3.5  
Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar t...    33   3.6  
Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa] {O...    33   3.7  
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    33   3.7  
SAKL0A06116g Chr1 (554152..555684) [1533 bp, 510 aa] {ON} simila...    33   3.7  
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    33   3.8  
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               33   3.9  
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    33   3.9  
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    33   4.1  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   4.3  
Kpol_1057.3 s1057 (3619..6702) [3084 bp, 1027 aa] {ON} (3619..67...    33   4.5  
Skud_10.110 Chr10 complement(196907..198793) [1887 bp, 628 aa] {...    33   4.5  
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    33   4.6  
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    33   4.6  
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    33   4.7  
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    33   4.8  
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    33   4.9  
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    33   4.9  
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    33   4.9  
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    33   5.0  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    33   5.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    33   5.1  
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    33   5.2  
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    33   5.3  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    33   5.4  
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    33   5.4  
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    33   5.5  
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    33   5.6  
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    33   5.6  
KAFR0L00620 Chr12 (118240..119076) [837 bp, 278 aa] {ON} Anc_7.1...    32   5.7  
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    33   5.7  
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    33   5.7  
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    33   5.8  
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    33   5.9  
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    32   5.9  
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    33   6.0  
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    33   6.1  
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    33   6.1  
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    33   6.1  
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    33   6.3  
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    32   6.5  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    33   6.5  
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    32   6.9  
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    32   6.9  
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    32   7.1  
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     32   7.3  
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    32   7.3  
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     32   7.5  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    32   7.5  
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    32   7.6  
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    32   8.5  
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    32   8.6  
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    32   8.8  
Smik_5.156 Chr5 complement(222965..226099) [3135 bp, 1044 aa] {O...    32   8.9  
NCAS0B05740 Chr2 (1090374..1091687) [1314 bp, 437 aa] {ON} Anc_8...    32   9.0  
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    32   9.1  
Suva_4.265 Chr4 (467625..470438) [2814 bp, 937 aa] {ON} YBR033W ...    32   9.2  
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    32   9.3  
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    32   9.4  
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    32   9.5  
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    32   9.6  
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    32   9.6  
NCAS0H01260 Chr8 (238877..240499) [1623 bp, 540 aa] {ON} Anc_6.152     32   9.7  
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    32   9.8  
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    32   9.9  

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score = 1984 bits (5139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 954/954 (100%), Positives = 954/954 (100%)

Query: 1   MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF
Sbjct: 1   MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60

Query: 61  SSTRGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGV 120
           SSTRGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGV
Sbjct: 61  SSTRGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGV 120

Query: 121 KWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKR 180
           KWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKR
Sbjct: 121 KWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKR 180

Query: 181 LSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDN 240
           LSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDN
Sbjct: 181 LSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDN 240

Query: 241 LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGL 300
           LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGL
Sbjct: 241 LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGL 300

Query: 301 YNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD 360
           YNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD
Sbjct: 301 YNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD 360

Query: 361 YANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS 420
           YANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS
Sbjct: 361 YANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS 420

Query: 421 SKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEI 480
           SKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEI
Sbjct: 421 SKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEI 480

Query: 481 LPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPP 540
           LPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPP
Sbjct: 481 LPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPP 540

Query: 541 FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSN 600
           FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSN
Sbjct: 541 FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSN 600

Query: 601 YREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISR 660
           YREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISR
Sbjct: 601 YREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISR 660

Query: 661 LNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLT 720
           LNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLT
Sbjct: 661 LNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLT 720

Query: 721 LTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCT 780
           LTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCT
Sbjct: 721 LTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCT 780

Query: 781 EMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEK 840
           EMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEK
Sbjct: 781 EMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEK 840

Query: 841 LPVDEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASED 900
           LPVDEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASED
Sbjct: 841 LPVDEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASED 900

Query: 901 IGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNTNDIDNETDSSRPVTRK 954
           IGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNTNDIDNETDSSRPVTRK
Sbjct: 901 IGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNTNDIDNETDSSRPVTRK 954

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score = 1615 bits (4182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/954 (83%), Positives = 851/954 (89%), Gaps = 4/954 (0%)

Query: 1   MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           MS K+R S N A ELPKRRRTYQACI+CRSRKVKCDLGPVDNPH PPCARCKRELK C F
Sbjct: 1   MSAKKRPSGNAAFELPKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIF 60

Query: 61  SSTRGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGV 120
           SS +G +N   PN I A S   L KS+Q+I+N STSPI +D+ LS K   +E SFKSEG+
Sbjct: 61  SSNKGTSNDLPPNSINAISLPSLGKSKQEIQNDSTSPILSDVPLSRKGISSEKSFKSEGM 120

Query: 121 KWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKR 180
           KWK ELSSMQNALEFLAQAAGTVAKEGAKEII++KS TP+PL   LD +++SATD GLKR
Sbjct: 121 KWKLELSSMQNALEFLAQAAGTVAKEGAKEIIKEKSTTPKPLKSSLDATNKSATDEGLKR 180

Query: 181 LSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDN 240
           LS+ DS    T T +EN   ML  +LN NR TSQL+ EI  VRP PTRKI+DFDYIGPD+
Sbjct: 181 LSKSDS----TNTLYENTADMLNHTLNTNRKTSQLMEEIGKVRPPPTRKIDDFDYIGPDS 236

Query: 241 LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGL 300
           LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYH FDTLGL
Sbjct: 237 LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLGL 296

Query: 301 YNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD 360
            NGE+G+RHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD
Sbjct: 297 DNGEDGMRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD 356

Query: 361 YANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS 420
           YANDPELNNVN RGSKNI TRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS
Sbjct: 357 YANDPELNNVNARGSKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS 416

Query: 421 SKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEI 480
           SK+FIVTHISETTSAMNMNQRSLLAESFSVLNLNL K ++DG E+NE+Y GNEKFYL+EI
Sbjct: 417 SKVFIVTHISETTSAMNMNQRSLLAESFSVLNLNLGKIENDGNESNEDYLGNEKFYLNEI 476

Query: 481 LPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPP 540
           LP++E K RWK VFE+S +  DNEK  LTDWEREFLNDEYVLYYSNK DDTNLAQNH PP
Sbjct: 477 LPDEESKLRWKRVFENSENDHDNEKNFLTDWEREFLNDEYVLYYSNKKDDTNLAQNHIPP 536

Query: 541 FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSN 600
           FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLS+FSPL+EGWLSN
Sbjct: 537 FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSN 596

Query: 601 YREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISR 660
           YRE+LVPLSDVPFSLADRKNKKQ+FDNIDRINGESIITDFNYCQLYIFSLALQVDGK SR
Sbjct: 597 YRELLVPLSDVPFSLADRKNKKQIFDNIDRINGESIITDFNYCQLYIFSLALQVDGKTSR 656

Query: 661 LNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLT 720
           LNMNEIVTSARYVELAYRSAKEIL SAKRVSRQ MLK+MPVRWVIRIIRSIAFIVKCYLT
Sbjct: 657 LNMNEIVTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWVIRIIRSIAFIVKCYLT 716

Query: 721 LTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCT 780
           LTGSELATNPDARNILKLSAISVDETFD++RDTAVTLKEATPDELHLCQRYAAILMYLCT
Sbjct: 717 LTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCT 776

Query: 781 EMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEK 840
           EMKLRK S+LERP LLR  TTPLESN   SLEG D+TKK  F + IG NKT++ FE  E+
Sbjct: 777 EMKLRKKSYLERPPLLRDGTTPLESNRESSLEGQDLTKKPIFSKRIGYNKTETTFEPSER 836

Query: 841 LPVDEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASED 900
              +EI  N  NSND S K IV+ FVEQNNDIT ALLNNELFQGPSLS+EVTDWFGASED
Sbjct: 837 PLTEEINSNSQNSNDTSSKGIVDPFVEQNNDITTALLNNELFQGPSLSDEVTDWFGASED 896

Query: 901 IGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNTNDIDNETDSSRPVTRK 954
           IGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVN+N+I+N+ ++SRP+TRK
Sbjct: 897 IGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNSNNINNDINNSRPITRK 950

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score = 1564 bits (4049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 774/951 (81%), Positives = 825/951 (86%)

Query: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63
           KR SSEN     PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELK C FSS 
Sbjct: 15  KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN 74

Query: 64  RGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWK 123
           R   +  SP+MI   SK+  SKSEQ + N   S   +DM LSGK T NET FKSEG+KWK
Sbjct: 75  REAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWK 134

Query: 124 FELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSR 183
            ELSSMQN LEFLAQAAGTVAKEGAKEII+D+S T  P V+ L +S Q +TD GLK LSR
Sbjct: 135 LELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSR 194

Query: 184 GDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLT 243
             SAAS T TP EN+T  LA +LNANRTTSQLI EI  VRP PTRKIEDF+YIGP NLLT
Sbjct: 195 SLSAASDTNTPIENLTVALATTLNANRTTSQLIEEIGKVRPIPTRKIEDFEYIGPANLLT 254

Query: 244 KEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNG 303
           KEEAIELIEAFFLTMHPFFPNIP QLHDPKELA+YPILFCAILTVSARYH FDTLGL NG
Sbjct: 255 KEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNG 314

Query: 304 ENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYAN 363
           ENG RH+EVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIH KWSDYAN
Sbjct: 315 ENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYAN 374

Query: 364 DPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKI 423
           DPELNNVNVRG K+I TR+DEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSS+I
Sbjct: 375 DPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRI 434

Query: 424 FIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPN 483
           FIVTHISETTSAMNMNQRS+LAESFSVLNLNL +FD+DG ENNENY GNE+FYLDEILPN
Sbjct: 435 FIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFDNDGNENNENYLGNERFYLDEILPN 494

Query: 484 DEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPL 543
           DE K+RWK V E+    SDNEK +LTDWEREFLNDEYVLYYSNK DDTNLAQNH PPFPL
Sbjct: 495 DESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPPFPL 554

Query: 544 RFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYRE 603
           RFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLS+FSPLMEGWLSNYRE
Sbjct: 555 RFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYRE 614

Query: 604 VLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNM 663
           VLVPLSDVPFSLADRKNK+QV +NIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNM
Sbjct: 615 VLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNM 674

Query: 664 NEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTG 723
           +EIV SA+YVELAY+SAKEIL SAKRVSRQ MLK+MPVRWVIRIIRSIAFIVKCYLTLTG
Sbjct: 675 SEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTG 734

Query: 724 SELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMK 783
           SE+ATNPDARNILKLSAISVDETFDL+RDTAVTLKEATPDELHLCQRYAAILMYLCTEMK
Sbjct: 735 SEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMK 794

Query: 784 LRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPV 843
           LRK SHLERP   R+   PL+S+    LEG ++ K  TF +  G +  +  F+   K   
Sbjct: 795 LRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVGKTSA 854

Query: 844 DEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGL 903
           +E  +NLNNS +L  K  +NSFVEQ NDITA LLNNEL QGPSLSEEVTDWF ASEDIGL
Sbjct: 855 EETSNNLNNSTELPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASEDIGL 914

Query: 904 EFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNTNDIDNETDSSRPVTRK 954
           EFVEPWTELIEQRYMQCGDGDNNNFENLYNLF N+ND D +TDSSRP   +
Sbjct: 915 EFVEPWTELIEQRYMQCGDGDNNNFENLYNLFANSNDTDIDTDSSRPAAHQ 965

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score = 1562 bits (4045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 776/954 (81%), Positives = 837/954 (87%), Gaps = 5/954 (0%)

Query: 1   MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           MS K+R SEN    LPKRRRTYQACINCRSRKVKCDLGPVDNPH PPCARCKREL++C F
Sbjct: 1   MSLKKRFSENTTSALPKRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECLF 60

Query: 61  SSTRGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGV 120
           SS +   N TSP+M+       + +S+ +I N S   I+++M LS K T +ET FKS+GV
Sbjct: 61  SSQKVVKNSTSPHMVNT-----ICQSKGEIPNHSRRLISSEMALSEKGTNDETLFKSDGV 115

Query: 121 KWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKR 180
           KWK ELSSMQNALEFLAQAAGTVAKEGAKE I+D+SATPRP    LDT HQSA +  LK 
Sbjct: 116 KWKLELSSMQNALEFLAQAAGTVAKEGAKETIKDRSATPRPSESSLDTPHQSAANKELKT 175

Query: 181 LSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDN 240
           LS  +  ASAT TPHEN+T  LAA+LN+N+  SQLI+EIS  RP PTR+I+DF+YIGPDN
Sbjct: 176 LSISECDASATNTPHENITDTLAAALNSNQKMSQLIKEISRARPMPTRRIDDFEYIGPDN 235

Query: 241 LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGL 300
           LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFC+ILTVSARYH FDTLGL
Sbjct: 236 LLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFDTLGL 295

Query: 301 YNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD 360
            NGENG+RHIEVHDKLW+YCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD
Sbjct: 296 DNGENGIRHIEVHDKLWIYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD 355

Query: 361 YANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS 420
           YANDPELNNV VR SKNI T+KDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS
Sbjct: 356 YANDPELNNVGVRESKNISTKKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS 415

Query: 421 SKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEI 480
           SKIFIVTHISETTSAMNMNQR LLAESFSVLNLN+ KFD DG + NENY GNEKFYL+EI
Sbjct: 416 SKIFIVTHISETTSAMNMNQRPLLAESFSVLNLNVRKFDDDGNKGNENYLGNEKFYLNEI 475

Query: 481 LPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPP 540
           LP+DE KKRWK VF+DS D  D+EK +LTDWEREFLNDEYVLYYSNK DDTNLAQN  PP
Sbjct: 476 LPDDESKKRWKKVFKDSEDDDDSEKNILTDWEREFLNDEYVLYYSNKKDDTNLAQNPMPP 535

Query: 541 FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSN 600
            PLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLS+FSPL+EGWLSN
Sbjct: 536 SPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSN 595

Query: 601 YREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISR 660
           YREVLVP+SDV F LADRKNKKQVFDNI+R+NGE+IITDFNYCQLYIFSLALQVDGK SR
Sbjct: 596 YREVLVPISDVSFLLADRKNKKQVFDNINRLNGETIITDFNYCQLYIFSLALQVDGKTSR 655

Query: 661 LNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLT 720
           LNMNEI+TSARYVELAYRSAKEIL SAKRVSRQ MLK+MPVRW IRIIRSIAFIVKCYLT
Sbjct: 656 LNMNEIMTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWAIRIIRSIAFIVKCYLT 715

Query: 721 LTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCT 780
           LTGSELATNPDARNILKLSAISVDETFD++RDTAVTLKEATPDELHLCQRYAAILMYLCT
Sbjct: 716 LTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCT 775

Query: 781 EMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEK 840
           EMKLRK S+ ERP L  + TTPLESN   S EGVD TKK TF ++I  NK +   E+ +K
Sbjct: 776 EMKLRKKSYTERPPLSTNGTTPLESNCESSPEGVDFTKKPTFPKNIRSNKAECNSESSKK 835

Query: 841 LPVDEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASED 900
            P++EI  NLNN N+LS K I N FVEQNND T  LLNNELFQGPSLSEEVTDWFGASED
Sbjct: 836 SPMEEIDSNLNNPNNLSSKVIFNPFVEQNNDTTTTLLNNELFQGPSLSEEVTDWFGASED 895

Query: 901 IGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNTNDIDNETDSSRPVTRK 954
           IGL FVEPWTELIEQRYMQCGDGD NNFENLYNLFVN+NDIDN+  SSRP+TRK
Sbjct: 896 IGLGFVEPWTELIEQRYMQCGDGDINNFENLYNLFVNSNDIDNDIGSSRPITRK 949

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/969 (49%), Positives = 624/969 (64%), Gaps = 85/969 (8%)

Query: 2   SPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
           SP+ +S + E+    K RR+Y+AC+NCR+RKVKCDLGP DNPH PPC RCKRE ++C F+
Sbjct: 4   SPQGKSLKTES----KWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFT 59

Query: 62  STRGETNGTSPNMITAAS-KTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGV 120
           S R + +      ++  +  + +++ +   R +  S  +     S       T  +S   
Sbjct: 60  SRRKKKDDVISGTVSLTNVPSAITQEDDNDRIQLNSGSSKGALFSNSPKNPNTQDQS--- 116

Query: 121 KWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKR 180
           KWK+ L SMQN LEFLA AAG+V+KE  + +   +             SHQ A +   + 
Sbjct: 117 KWKYGLGSMQNTLEFLATAAGSVSKESNRRLTTARH------------SHQYAKETS-ED 163

Query: 181 LSRGDSAASA-----TCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDY 235
               DS+ S+     T T  ++V A L       R T  LI E+S VRP P +K+ D DY
Sbjct: 164 FRVDDSSPSSERKDITDTSEQSVIAPLLKECGTQRATVSLIEELSRVRPKPNKKLADIDY 223

Query: 236 IGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRF 295
           IGP NLL+++EA ELI+A+FLTMHPFFPNIPLQL DP EL  YPIL CAILT+S+RYH F
Sbjct: 224 IGPSNLLSEQEARELIDAYFLTMHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRYHPF 283

Query: 296 DTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIH 355
              G YNGEN  R+IEVH+ LW YCQ+LISQT+WAEASTRSIGTVLAFIIFTEWNPR IH
Sbjct: 284 SEFGFYNGENNKRNIEVHETLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIH 343

Query: 356 YKWSDYANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMG 415
           ++ +DYAN  E  + +V  S+     KD++GLTG+GAIRRSDRMSWMLTGSAVRLAQDMG
Sbjct: 344 WRRTDYANSAE-KDTDVPHSQ-----KDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMG 397

Query: 416 FIENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDS---DGKENNENYFGN 472
           FIE S+KIF+ +HIS+T ++MNMNQR  L+E+FSV+     +  +   D ++ + +  GN
Sbjct: 398 FIETSTKIFVASHISDTFASMNMNQRCALSETFSVVGFGAGRERASAIDSEQTDVDEVGN 457

Query: 473 EKFYLDEILPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTN 532
           EKFYL+++L N+E ++RW  V E     +D +   LTD EREFLNDEYVLYY+N+ND+  
Sbjct: 458 EKFYLEQMLQNEESRERWTRVLERLQHNNDKKNGPLTDLEREFLNDEYVLYYANRNDE-- 515

Query: 533 LAQNHTP-PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFS 591
           + Q H   PFPL+FSF QRAKIE+IRI+ IAY+TIY +K KRKL + DQ HNL+VL I S
Sbjct: 516 MVQQHLQLPFPLKFSFHQRAKIELIRIILIAYDTIYYDKGKRKLTSNDQVHNLAVLGILS 575

Query: 592 PLMEGWLSNYREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLA 651
           PL+EGW + YR +L   S  P+S+  RKNK+ V +  + IN ESI++D+ YCQLYI+SLA
Sbjct: 576 PLIEGWYATYRNLLKISSGQPYSIEIRKNKRAVHELGEEINRESILSDYYYCQLYIYSLA 635

Query: 652 LQVDGKISRLNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSI 711
           LQVD K  +L +NE   SA+YVELAY +AKEIL S+ RV R  MLK+MPVRWV+RI+R++
Sbjct: 636 LQVDVKGPKLRINEATKSAKYVELAYVAAKEILISSTRVHRLKMLKYMPVRWVMRIVRAV 695

Query: 712 AFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRY 771
           +F+VKCYLTLTG     N +A+ ILKL  IS+DET   +R  A+ LKEA+PDELHLC RY
Sbjct: 696 SFLVKCYLTLTGGGGVPNSEAQTILKLCCISLDETIHTIRLAALILKEASPDELHLCVRY 755

Query: 772 AAILMYLCTEMKLRKSSHLE------------RPSLLRSSTTPLESNHGFSLEGVDVTKK 819
           +AIL+YLC EM L+   + +            R   + S  T    +    L   D +K 
Sbjct: 756 SAILLYLCKEMNLKSKRNQKLLVSHGILINESRNRQMGSRRTKATQDSDIDLGSTDDSKN 815

Query: 820 STFYRDIGGNK-------TDSKF-------ETP-EKLPVDEIGDNLNNSNDLSGKAIVNS 864
                ++  N        T S F       ETP +++P   + DN  N+ D  G     +
Sbjct: 816 IQSNNELLPNNISTTNGLTTSLFNTEEMRSETPNQRIPTSAVADNTPNNLDNDGTNNPTN 875

Query: 865 FVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGD 924
           F                   PSL +E  DWF  S DIGL+FVEPWTEL+EQR++Q GDG 
Sbjct: 876 F-------------------PSLPDEAIDWFSGSADIGLDFVEPWTELLEQRFLQSGDG- 915

Query: 925 NNNFENLYN 933
           NN FE LYN
Sbjct: 916 NNIFEELYN 924

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/970 (47%), Positives = 624/970 (64%), Gaps = 98/970 (10%)

Query: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--S 61
           KR   E +  + PK RRTYQAC+NCR+RKVKCDLGPVDNPH PPC RCKRE K+C F  S
Sbjct: 5   KRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTES 64

Query: 62  STRGETNGTSPNMI---TAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSE 118
           + RG     + + I   TA +   +SK+           IT+    +  E   +  FK E
Sbjct: 65  NKRGGLRVANVSAIAENTANATASMSKA-----------ITSVFQGNTSEGSQQPDFKRE 113

Query: 119 G----VKWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSAT 174
                +    EL++MQ+ALEFLA+AAG+VAKE ++++++  +       + L++   S T
Sbjct: 114 NSIDPLPINSELTTMQDALEFLAKAAGSVAKEDSRDLVDASTK-----YEELESQSNSRT 168

Query: 175 DGGLKRLSRGDSA--ASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIED 232
           D  +   S  DS   +++   P E   A L       R T  LI ++S VRP P+R++ D
Sbjct: 169 DTPISSGSAQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTD 228

Query: 233 FDYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARY 292
            +YIG   +L++EEA++LI+ FFLTMHPFFP++PLQL +P ELA+YPIL CAILT+S+RY
Sbjct: 229 IEYIGTLKMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRY 288

Query: 293 HRFDTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPR 352
           H FD + +YNGE+  R++E+H++LW+YCQ+LISQT+WAEASTRSIGTVLAF++FTEWNPR
Sbjct: 289 HSFDEVNMYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPR 348

Query: 353 SIHYKWSDYANDPELNNVNVRGSKNIC----------TRKDEEGLTGVGAIRRSDRMSWM 402
           +IH++WSDYAN+P+LN+V+ R   N+           +++  +GLTG+ A+RRSDRM+WM
Sbjct: 349 AIHWRWSDYANNPDLNDVSKRDLSNVACSSSSSTACNSQQHGDGLTGLSAMRRSDRMAWM 408

Query: 403 LTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDG 462
           LTG+AVRLAQDMGF+  SSKIF  THISET +AMNMNQRS+L++S + +NLN       G
Sbjct: 409 LTGTAVRLAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINLN-------G 461

Query: 463 KENNENYFGNEKFYLDEILPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVL 522
            E++     NE +YL +IL +D  K+RW    +    +S   +  + D EREF+NDEYVL
Sbjct: 462 YEDD---VENESYYLGQILKSDGSKERWSKFLKKLGSSSTRGR--MNDIEREFVNDEYVL 516

Query: 523 YYSNK------------NDDTNLA-QNHTPPFPLRFSFAQRAKIEIIRILSIAYETIYCE 569
           YYS+K            NDD N   Q    P+ L+FSF QRAKIE++RI+SI YETIY  
Sbjct: 517 YYSDKDGAPAHADEYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY-- 574

Query: 570 KNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKKQVFDNID 629
           + K KL +  Q HNL++LSI SPL+E W + Y+ +L P S    + A    KK +F+  +
Sbjct: 575 RGKLKLYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTE 634

Query: 630 RINGESIITDFNYCQLYIFSLALQVD---GKISRLNMNEIVTSARYVELAYRSAKEILGS 686
           +++ ES+I+D+ YCQLYI+SLALQVD    K  +L MNEI   ARYVELAY +AKEIL S
Sbjct: 635 KVDRESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNS 694

Query: 687 AKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDET 746
           A RV +  MLK+MPVRWV RI+RS+AF+VKCYLTLTGS +ATNP+A  IL LS I  +E 
Sbjct: 695 AIRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEI 754

Query: 747 FDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKSSHLERPSLLRSSTTPLESN 806
              ++  A+TL+EA+PDELHLC RY+ ILMYLCTEMKLR   + + P     S  P    
Sbjct: 755 IQTIQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQP---- 810

Query: 807 HGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEK---LPVDEIGDNLNNSNDLSGKAIVN 863
                E + V    T +   G N+T  K +  ++   LP   + ++L  + + +   + N
Sbjct: 811 -----EQISV---ETTFNFCGKNETHEKGQGSQQRGPLPPPRM-NSLPETTNFAFN-VDN 860

Query: 864 SFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDG 923
            F  Q              Q   L  +V DWF  S++IGL+FVEPWTE+IEQ+++   + 
Sbjct: 861 FFSPQGA------------QTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFI--SND 906

Query: 924 DNNNFENLYN 933
           +N  FENLYN
Sbjct: 907 NNKTFENLYN 916

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/925 (49%), Positives = 601/925 (64%), Gaps = 70/925 (7%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           K +R+++ACI+CR RKVKCDLGP++NPH PPC RC+RE K C FSS  G    +S N+ T
Sbjct: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSS--GGNGMSSANLST 83

Query: 77  AASK----TFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNA 132
              K    TF         + +++  +   T   K+T N T  +    KWK EL+SMQN+
Sbjct: 84  MNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTEN-TYKRLPREKWKLELASMQNS 142

Query: 133 LEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATC 192
           LEFLA+AA +VA +   E  ++ +              + A +G     S  D+      
Sbjct: 143 LEFLAKAADSVAHQSNPESFKETA--------------KLAKNGASNDTSENDTPVQQQD 188

Query: 193 TPHENVTAMLAASLNANRTT-SQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELI 251
           +P+EN    L    N+ R+   QL + IS +RP  ++ + D ++IGP  LL++EEA ELI
Sbjct: 189 SPNENYLTPLTTPHNSRRSALPQLEKSIS-IRPKSSQTLSDMEFIGPSKLLSEEEARELI 247

Query: 252 EAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGL--RH 309
           + FFLTM+PFFP+IPLQL D  EL  YPIL CAILT+S+RYH FD    YNG  G   R+
Sbjct: 248 DLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRN 307

Query: 310 IEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNN 369
           I VH+KLW+YCQ+LISQT+WAEASTRSIGT+ AFIIFTEWNPR+IH+KWSDYAN+PE  +
Sbjct: 308 IHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYD 367

Query: 370 VNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHI 429
           +  R S +    KDE+GLTG+ AIRRSDRM+WMLTG+AVRLAQD+G IE S+K+F+ THI
Sbjct: 368 MTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHI 427

Query: 430 SETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIKKR 489
           SE+ +A+NMNQ  +L++SF+  NL       DG +N  N   NE+ YL++IL NDE K R
Sbjct: 428 SESYTAINMNQGLILSQSFNERNL-------DGIDN-LNGVDNERLYLEQILQNDESKAR 479

Query: 490 WKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPF-PLRFSFA 548
           W G+ +   +     +  L D EREFLNDEY LYY++ ++DT   Q HT    PL+F+  
Sbjct: 480 WNGILKLLDNEVGISEEYLQDVEREFLNDEYTLYYADHDEDT---QQHTQQIIPLKFTST 536

Query: 549 QRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVPL 608
           Q+AK+E++RIL + YETIY EK  ++L +TDQRHNL+VL+I +PL+E W +NYR +L   
Sbjct: 537 QKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIR 596

Query: 609 SDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNEIVT 668
                SL  R+NK++ F+   +IN E++I+D+ YCQLYI+SLALQVD + ++L +NEI  
Sbjct: 597 EGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRR 656

Query: 669 SARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSELAT 728
            A +VE AY +AKEIL SA RV +  MLK+MPVRWV+RI+RS+AFIVKCYLTLT S+L+T
Sbjct: 657 CASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLST 716

Query: 729 NPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLR-KS 787
           NP+A  IL+LSAISVDET   ++  A+TLKEA PDELHLC RY+AILMYLC EMKLR K+
Sbjct: 717 NPEANTILRLSAISVDETIQTIQTAAITLKEAAPDELHLCTRYSAILMYLCREMKLRDKT 776

Query: 788 SHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPVDEIG 847
           ++             +E+++   +EGV     S F     GN        P  LP     
Sbjct: 777 NNNNNTGENEEQKILIENSNPDGVEGV----ASNF-----GN-------VPSTLPPSYAQ 820

Query: 848 DNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLEFVE 907
            +          A   SF++               +GPSLS  VTDWF    DIGL+FVE
Sbjct: 821 KSTTKEQLSDDGAHSMSFMD---------------EGPSLSNNVTDWFNVGGDIGLDFVE 865

Query: 908 PWTELIEQRYMQCGDGDNNNFENLY 932
           PWTE+IEQRY+Q GD  N +FE LY
Sbjct: 866 PWTEMIEQRYLQSGDV-NTSFEELY 889

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/928 (47%), Positives = 592/928 (63%), Gaps = 57/928 (6%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           K +R Y+AC NC+ RKVKCD+GP++NPH PPCARC+RE K C F +T+G       + I 
Sbjct: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78

Query: 77  AASKTFLSKSEQQIRNR---STSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNAL 133
           + + T    S   +  +   S++ +  ++ +   +T           KWK  L+SMQN+L
Sbjct: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISP--TKWKIGLTSMQNSL 136

Query: 134 EFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATCT 193
           EFLA+AAG V    A            P          SA       L + +S  + T +
Sbjct: 137 EFLAKAAGNVGFLSA------------PSAHSAREELNSAVVPKATSLPQEESLMNMTSS 184

Query: 194 PHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIEA 253
            H ++  +       +++   LI +++ VRP+P RK+ D DYIGP+ LL++ +AIELI+ 
Sbjct: 185 LHSDLLNISPIGKLQHKSLP-LIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDL 243

Query: 254 FFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLG--LYNGENG-LRHI 310
           FFLTM PFFPNIPLQL +PKELA+YPIL CAILT+S+RYH FDT    + NG+N   RHI
Sbjct: 244 FFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHI 303

Query: 311 EVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNV 370
           +VH+KLW+YCQ+LISQTIWAEASTRSIGT+LAFIIFTEWNPR+IH+ WSDYA+DP LN++
Sbjct: 304 DVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDI 363

Query: 371 NVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHIS 430
           + R  +    +++EEGLTG+ AIRRSDRM+WML+G+AVRLAQD G I  ++K+ I THIS
Sbjct: 364 SKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHIS 423

Query: 431 ETTSAMNMNQRSLLAESF-SVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIKKR 489
           +T +AMNMNQRS L+ SF S    +L K    GK++ +    NE FYL +IL N E K+R
Sbjct: 424 DTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQ--VVNENFYLTQILQNKESKER 481

Query: 490 WKGVFEDSADASDNEKYL--LTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPLRFSF 547
           WK +   +    DNE+ +  L+D E EFLNDEY LY+S +++D++      PP PL+F+F
Sbjct: 482 WKKI--SATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSS----QRPPLPLKFTF 535

Query: 548 AQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVP 607
            QRAK+E++RI+++ YETIY E  +++L + DQR NL+VL+I SPL++ W SNY  +L  
Sbjct: 536 VQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKT 595

Query: 608 LSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNEIV 667
            +  P S    K K++ F     I+GE++I+D+ YCQLYIFSLALQVD   ++L +NEI 
Sbjct: 596 DAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEIT 655

Query: 668 TSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSELA 727
             A YVE AY +AKEIL SA RV +  MLK+MPV+WV+RI+RS+AFIVKCYLTLT    +
Sbjct: 656 RCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFS 715

Query: 728 TNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKS 787
           +NP+AR IL LSAISVDET   ++DTA+ LKEA PDELHL  RY+AIL+YLC EMK +  
Sbjct: 716 SNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHE 775

Query: 788 SHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLP---VD 844
           S  +       S+    SN   S + +          DI      S  E   K P    +
Sbjct: 776 SSQQSKGYDSKSS----SNAPLSDDVITNQSGDKMSEDI---LLKSHAEVAAKDPRTSQE 828

Query: 845 EIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLE 904
            I   +N  N L GK         + D T   LN        L  +V +WF  S +IGLE
Sbjct: 829 NIELQMNKPN-LDGK------FASDMDFTTDNLN-------ELPGDVANWFTTSGNIGLE 874

Query: 905 FVEPWTELIEQRYMQCGDGDNNNFENLY 932
           FVEPWTE+IEQ Y+Q GD  N  F++LY
Sbjct: 875 FVEPWTEMIEQMYLQSGDA-NTTFDDLY 901

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  770 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/956 (44%), Positives = 587/956 (61%), Gaps = 81/956 (8%)

Query: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63
           KR  SE   ++  K RR+Y+AC+NCRSRK+KCDLGP+DNPH PPC RCKRE ++C F  T
Sbjct: 5   KRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT 64

Query: 64  RGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETG------NETSFKS 117
           +          +TA          ++    S  P     +L+G  +       N    K 
Sbjct: 65  KRRD-------VTAKINNMKGSELERSIISSILPDVDKKSLNGGGSAGSDLKQNNIRKKP 117

Query: 118 EGVKWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGG 177
               W+ ++S+MQ ALEFLA A G ++K   + ++          ++  D    +  +  
Sbjct: 118 TDSNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTL--IENEDADDSNPNNDN 175

Query: 178 LKRLSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIG 237
            + +SR DS    +     N    L     A++  S L+  I  +RP PTR + D +YIG
Sbjct: 176 SEDVSRSDSNTPKS----RNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIG 231

Query: 238 PDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDT 297
           P+ LLT++EA  LI  FFLTMHP+FP IPLQLH+P EL  YPIL CAILTVS+RY+ F+ 
Sbjct: 232 PNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNE 291

Query: 298 LGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYK 357
           + + N     R+I VH+KLW YCQ+LIS TIWAEASTRSIGT+LAF++FTEWNPR+IH+ 
Sbjct: 292 IFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWT 351

Query: 358 WSDYANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFI 417
           WSDY N+PEL         N+   K E+  TG  A+R SDRM+WM TGSAVRLAQDM FI
Sbjct: 352 WSDYGNNPELTCFTKNNENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHFI 410

Query: 418 ENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENY-------F 470
           +N+ KIF+ THISET +AMN+NQRS L++S S +NL++ +  S GK N++         F
Sbjct: 411 DNNYKIFMATHISETFNAMNVNQRSTLSDSLSNINLSITR--SHGKNNDDEEGHIFAENF 468

Query: 471 GNEKFYLDEILPNDEIKKRW-KGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKND 529
           GNE++YL++IL +D+ K++W K + E +++ S     ++TD ERE+LNDEY+LYY N N 
Sbjct: 469 GNEQYYLEQILKHDKSKEKWIKFLKEINSNKSSENSTVITDAEREYLNDEYILYYQNNNP 528

Query: 530 DTNLA-QNHTP-----PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHN 583
           +T     NH+      P+PL+F+   +AKIEI+RI+SIAYETIY  KNKR LA  +QR N
Sbjct: 529 ETQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQN 588

Query: 584 LSVLSIFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYC 643
           L+VLSIFSPL+E W SN+  +L      P  ++  K+K  V      I  ES+I D+ YC
Sbjct: 589 LAVLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYC 648

Query: 644 QLYIFSLALQVDGKISRLNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRW 703
           QLYI+SLAL+VD K + LN++EI  SA+YV +AY +AKEIL SA RV++  +L+++PVRW
Sbjct: 649 QLYIYSLALKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRW 708

Query: 704 VIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPD 763
           V RI+RS+AFIVKC+L LT SE + N +   I++LS I VDE  +L+  T+VTL +A+PD
Sbjct: 709 VTRILRSVAFIVKCFLLLTESETSENSEINAIIRLSGIPVDEALELIETTSVTLNDASPD 768

Query: 764 ELHLCQRYAAILMYLCTEMKLRKSSHLERPSLLRSSTTPLESNHGFSL--EGVDVTKKST 821
           ELHLC+RY++IL+Y+C E              LR+ T  L  N G +   E  DV     
Sbjct: 769 ELHLCKRYSSILLYMCKE--------------LRNKTQNLYMNEGVAAKQENADVKV--- 811

Query: 822 FYRDIGGNKTDSKFETPE--KLPVDEIGDN--------LNNSNDLSGKAIVNSFVEQNND 871
                 GNK+     + E  + P++    N        +N +  ++     +  +EQ   
Sbjct: 812 ------GNKSLENLSSIENSQEPIEPFIMNEHPQTELPINTTEQIAIVGNEHHGIEQ--- 862

Query: 872 ITAALLNNEL-FQGPSLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNN 926
            T  L  N + FQG     EV DWF +S DIGLEFVE WTE+IEQ Y++  DGD N
Sbjct: 863 -TPILNPNSMSFQG-----EVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGDQN 912

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/780 (49%), Positives = 523/780 (67%), Gaps = 40/780 (5%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--SSTRGETN-----G 69
           K RR Y+ACI+CR++K+KCD+GP+DNPH PPC RC+RE K+C    +  RG T+     G
Sbjct: 17  KWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILPENKRRGNTDTEFKLG 76

Query: 70  TSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSM 129
              N +        S+SEQ + +++ +P       +G  + N         KWKFE+ +M
Sbjct: 77  KIENGLVGVMNK--SESEQSLLSQTRAPPP-----NGSTSNN---LDLVDPKWKFEIGTM 126

Query: 130 QNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAAS 189
            NALEFLA+AAG+V+KE   E+   ++ +   + +  DT+        +  L   D    
Sbjct: 127 YNALEFLAKAAGSVSKEEPIEMKSPQNRSDLGVGNMPDTALNGVMSDNIGNLDISD---- 182

Query: 190 ATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIE 249
                 E+  A L  +  + R  + LI ++S +RP  ++K+ D DYIGP  LL+++EA  
Sbjct: 183 ------ESFLAPLTTANGSQRAAAPLIEKLSSMRPKSSKKLIDVDYIGPSKLLSEDEATR 236

Query: 250 LIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGLRH 309
           LI+ FFLTMHPFFP+IPLQL DP EL  YPIL CAILT+SARY+ F  LG Y+GE   R+
Sbjct: 237 LIDIFFLTMHPFFPHIPLQLQDPDELVRYPILLCAILTISARYNPFGELGFYDGEAHNRN 296

Query: 310 IEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNN 369
           IEVH++LW+YCQ+LISQTIWAEASTRSIGTVLAF++FTEWNPR+IH+KWSDYAN+PELN+
Sbjct: 297 IEVHERLWIYCQRLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANNPELND 356

Query: 370 VNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHI 429
           V  R +    T +D E  TG+ A+RRSDRM+WML G+AVRLAQDM FI+ SSKIF+ THI
Sbjct: 357 VTKRETHGANTPRDTETFTGMAAVRRSDRMAWMLIGAAVRLAQDMSFIDTSSKIFVATHI 416

Query: 430 SETTSAMNMNQRSLLAESFSVLNLN-LEKFDSDGKENNENYFGNEKFYLDEILPNDEIKK 488
           +E  +AMN+NQ+S+L+ES S +N   LE+ D           GNE FYL+ IL  DE K+
Sbjct: 417 AEAHTAMNLNQKSILSESLSEVNREVLERLDD---------IGNENFYLEHILQKDESKE 467

Query: 489 RWKGVFEDSADASDNEKY-LLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPLRFSF 547
           RW    ++ ++    +    LTD EREFLNDEYVLYY N  +D +   + T PFPL+FS 
Sbjct: 468 RWTNFLQNVSEGRRAKGTGPLTDMEREFLNDEYVLYYVNARNDASSKSSLTLPFPLKFSH 527

Query: 548 AQRAKIEIIRILSIAYETIY--CEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVL 605
            QRAKIE++RIL+I YE+IY   EK+K +L   + + NL++L I S L+E W + Y+++L
Sbjct: 528 PQRAKIELLRILTIGYESIYYESEKDKTQLINGNPKRNLALLEIISTLIEKWHATYKDLL 587

Query: 606 VPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNE 665
           +P +  P SL   +NK+ V +   +I+ ES+  D+NYCQLYI+SLALQ D K   L M E
Sbjct: 588 IPANATPCSLDMARNKRAVHELTQQIDRESLSCDYNYCQLYIYSLALQNDVKNMDLKMPE 647

Query: 666 IVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSE 725
           I  SARYVELAYR+A+ IL SA+R+    ML++MPVRWV RI+R++AF+VKCYL LT   
Sbjct: 648 IRKSARYVELAYRAAEGILDSAERIHSLKMLRYMPVRWVTRIVRAVAFLVKCYLVLTKDG 707

Query: 726 LATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLR 785
           LA NP A  IL+L+ I  +ET  ++   AVTL+EA PDE+HL  RY+ IL +LC E+K+R
Sbjct: 708 LAANPVAGTILRLTVIPSEETVPIIERAAVTLQEAAPDEVHLGMRYSKILKFLCAEVKMR 767

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 25/31 (80%)

Query: 889 EEVTDWFGASEDIGLEFVEPWTELIEQRYMQ 919
           E+  D F AS+DIGL+FV+ WTE+IE RYMQ
Sbjct: 838 EDPFDLFAASDDIGLDFVDTWTEMIENRYMQ 868

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/924 (45%), Positives = 559/924 (60%), Gaps = 104/924 (11%)

Query: 8   SENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGET 67
           SE  +++  K RR+Y+AC+NCR RK+KCD+GP+D PH PPC RCKRE K C F  +R ++
Sbjct: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS 64

Query: 68  NGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELS 127
                 +     +T   + + ++          D+          +  K +G KW+FE+S
Sbjct: 65  ------VFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDG-KWRFEIS 117

Query: 128 SMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSA 187
           SMQNALEFLA+AAG+VAKE   ++ E K          +D S  S  D   K L+     
Sbjct: 118 SMQNALEFLAKAAGSVAKED-NQLHEIKQ---------IDPSQVSRDDSSWKDLTPTSFE 167

Query: 188 ASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEA 247
           AS        + A L A   ++R    LI+++S VRP P  K+ + ++IG  + LT+EE 
Sbjct: 168 ASRA-----GIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEV 222

Query: 248 IELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGL 307
           I+L++ FFLTM+PFFP+IPLQL DP+ELA YP+L C+I+TVSARYH F  +GL +     
Sbjct: 223 IKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNN 282

Query: 308 RHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPEL 367
           R+IEVH++LW+YCQKLISQTIWAEASTRSIGTVLAF++FTEWNPR+IH+KWSDYAN  + 
Sbjct: 283 RNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDS 342

Query: 368 NNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVT 427
            +     S +    +D E LTG+ AIRRSDRM+WMLTG+AVRLAQDMGF E SSKIF  T
Sbjct: 343 KD----RSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTAT 398

Query: 428 HISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIK 487
           HISET +AMN+ QRS L ES + +NL   KF  +      N  GNE+FYL++IL ND+ K
Sbjct: 399 HISETHTAMNVGQRSTLTESLNEINLGSIKFPRN------NSVGNEQFYLEKILENDDSK 452

Query: 488 KRWKGVFED-SADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPLRFS 546
            RW     D   D + +++  LTD EREFLNDEYVLYY+   D  +   ++  PFPLRFS
Sbjct: 453 DRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFS 512

Query: 547 FAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLV 606
             QRAKIE++RI+++ +E IYC K+K++    D   NLS+L + SPL+E W  +Y ++L 
Sbjct: 513 KIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLE 572

Query: 607 PLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNEI 666
           P    P ++   +NK++V   + +I+ ES+I ++ YCQLYI+S ALQVD K  +L ++EI
Sbjct: 573 PAEGKPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEI 632

Query: 667 VTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSEL 726
             SA+YVELAY +AK +L SA R+ R  +LK MPVRWV RI++S+AFIVKCYLTL G+ +
Sbjct: 633 TRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAV 692

Query: 727 ATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRK 786
             NP A  ILKL+ I  ++    +   A+ LKEA+PDELHLC RY+ ILM LC+EM+   
Sbjct: 693 VNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR--- 749

Query: 787 SSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPVDEI 846
                                    E  D T             TDS   TP        
Sbjct: 750 -------------------------ESEDYT-------------TDSP--TP-------- 761

Query: 847 GDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLEFV 906
           G      ND S    +++ +   ND+             S S+E+          GLEFV
Sbjct: 762 GTTFGQDNDPSPIQPLDTAIPLPNDVVDWF---------STSDEI----------GLEFV 802

Query: 907 EPWTELIEQRYMQCGDGDNNNFEN 930
           E W E+IEQRY+Q G   + N  N
Sbjct: 803 ESWAEMIEQRYLQ-GSSYSQNLGN 825

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/978 (42%), Positives = 592/978 (60%), Gaps = 89/978 (9%)

Query: 7   SSENEAHELPKR---RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63
           S+ NE+   PK+   +R Y+AC+NC+ RKVKCDLGP DNPH PPC RCKRE ++C F+ T
Sbjct: 3   SNGNESQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTET 62

Query: 64  -RGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNE--------TS 114
            RG            A ++ +S  E+         IT+   + G+    E         +
Sbjct: 63  KRGG--------FRVAKQSLVSLKEESAGKSMADVITS--VIQGQTLKKELDTDLDRLQT 112

Query: 115 FKSEGVKWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLD-TSHQSA 173
              + +    +  ++QNA  FLA+AAG+VAKE  ++ ++  +AT    ++P D  S Q +
Sbjct: 113 HTKDDISINTDPPTLQNAFYFLAKAAGSVAKEDLRDQVD--AATKYDEIEPTDAVSRQPS 170

Query: 174 TDGGLKRLSRGDSAASATCTPHENVTAMLAASL--------NANRTTSQLIREISGVRPS 225
                   S G+  A+ +  P  ++  ML  S              T  LI ++S VRP 
Sbjct: 171 VS------SYGNKQATGSMEP-SSIPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRPK 223

Query: 226 PTRKIEDFDYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAI 285
           P+ K+ D +YIGP  LLT+ EA + I+AFFLTMHPF P IPLQL D  ELA YP+L C I
Sbjct: 224 PSMKLGDIEYIGPYQLLTEAEARKRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTI 283

Query: 286 LTVSARYHRFDTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFII 345
           LT+SARYH    LGL   +N + H+E+H++LW+YCQ+L+SQT+WAEASTRSIGT+LAF+I
Sbjct: 284 LTISARYHTLHDLGLNEIDNTV-HVELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLI 342

Query: 346 FTEWNPRSIHYKWSDYANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTG 405
           FTEWNPR+IH+K SDYAN P+++++  R S      +  + LTG+ A+RRSDRMSW+LTG
Sbjct: 343 FTEWNPRAIHWKGSDYANYPDISDLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTG 402

Query: 406 SAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKEN 465
           +AVRLAQD+  IE SSKIF++THI ET +AMN+N+RS L+ES S + LN       G E+
Sbjct: 403 NAVRLAQDLNVIEFSSKIFVMTHICETHTAMNLNKRSSLSESLSEVRLN-------GFED 455

Query: 466 NENYFGNEKFYLDEILPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYS 525
           N+    NE+F+L+ IL ND+ K+RW    E   + S  +K  LTD EREFLNDEY+LY+ 
Sbjct: 456 ND--LDNEQFFLERILQNDKSKERWARFLERVGERS--KKGSLTDIEREFLNDEYLLYHY 511

Query: 526 NKNDDTNLAQNHTPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLS 585
           N     N      P F L+FS  QR K+E+++I+S+ YE +Y      KL++ D+   LS
Sbjct: 512 NTE---NPNTQSDPEFRLKFSKIQRGKVELLKIVSLGYENVY----NGKLSSHDRHQRLS 564

Query: 586 VLSIFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQL 645
           +LS+ SPL+EGW + Y+ +LVP      S+A   NK  VF+  +++  ES+I+D+ YCQL
Sbjct: 565 MLSVLSPLIEGWYNIYKSLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQL 624

Query: 646 YIFSLALQVDGK---ISRLNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVR 702
           YI+SLALQ D +    S+L +NEI  SARYVELAY +AKEIL SA+RV +  MLK+MPVR
Sbjct: 625 YIYSLALQWDHQDTSTSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVR 684

Query: 703 WVIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATP 762
           WV+RI+RSI F++KCYLTLTG+ +  NP+A  IL +S +  DE    ++ TA+ L+ A P
Sbjct: 685 WVMRIVRSIVFMIKCYLTLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAP 744

Query: 763 DELHLCQRYAAILMYLCTEMKLRKSSHLERP------------SLLRSSTTPLESNHGFS 810
           DELHLC RY+ ILMYLCTEMK R   +++ P            +  RS      S   FS
Sbjct: 745 DELHLCSRYSTILMYLCTEMKHRCKPNMQPPVPRSISNDYLDKTSNRSENVADNSARHFS 804

Query: 811 LEGVDVTKKSTFYRDIGGNK-TDSKFETPEKLPVDEIGDNLNNSNDLS-----GKAIVNS 864
           + G  V+  +        NK T+ +F + E    +   D     +  +     G A +NS
Sbjct: 805 VGGYQVSDTANVSSSPFINKGTNVRFGSTEYKQQETTNDEQQRPDTFTVDSALGVASINS 864

Query: 865 -------FVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLEFVEPWTELIEQRY 917
                      + +  +A+       G  L  ++ DWF  + +IGL+FV PWTE++E+++
Sbjct: 865 APPAPVPEPAPDTNPASAINTGPNSSGGYLPPQLVDWFNDNNEIGLDFVGPWTEMVEKQF 924

Query: 918 MQCGDGDNNNFENLYNLF 935
           +     D++++EN +N F
Sbjct: 925 V--NKVDDSSYENWFNDF 940

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/954 (41%), Positives = 570/954 (59%), Gaps = 79/954 (8%)

Query: 20  RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGE----TNGTSPNMI 75
           R ++AC NCR +KV+CD GP DNPH PPCARCKRE K+C+F++  G+      G + N I
Sbjct: 21  RGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAKTGKEQDMVTGEATNGI 80

Query: 76  TAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNALEF 135
                  + K+E  +   + + ++  +  +  E GNE +       WK EL+SM N L F
Sbjct: 81  PTVDTVPVKKNELALPALAVT-VSPGLIQNRSEMGNEAN---PNTGWKLELTSMHNTLAF 136

Query: 136 LAQAAGTVA----KEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASAT 191
           LAQAAGTV+    K   K+ +    +TP   +  L +           +   G +++   
Sbjct: 137 LAQAAGTVSNTLNKGLMKKTLPSDRSTPSLEISRLGS-----------KTPTGFASSLGL 185

Query: 192 CTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELI 251
             P      +L      N+   QLI +    +    + ++D   IG + LL+++EA   I
Sbjct: 186 GMPSNPTKTLLQEIETQNKV--QLIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEATAFI 243

Query: 252 EAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGLRHIE 311
           +AFF TMHPFFP IPLQL DP EL EYPIL CAILT+S RYH F   G  NG+   R+ E
Sbjct: 244 DAFFCTMHPFFPYIPLQLQDPLELLEYPILLCAILTISTRYHSFSEFGFDNGDYNKRNFE 303

Query: 312 VHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYAND-----PE 366
           VH+KLW  CQ ++S+TIW EASTRSIGTVLAFI+FTEWNPR IH+K SDYAND      E
Sbjct: 304 VHEKLWDNCQVMLSKTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDDEAVSE 363

Query: 367 LNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIV 426
           L+N             + E LTG  AIRRSDRM+WMLTGSAVRLAQDMGF+E ++K+ + 
Sbjct: 364 LSN------------DEAEELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVCVA 411

Query: 427 THISETTSAMNMNQRSLLAESFSVLNLNLEKFDSD---GKENNENYFGNEKFYLDEILPN 483
           THIS+  ++MNMNQ+ +L+ +F+VL      + SD      ++     +E+ ++ ++L N
Sbjct: 412 THISDAFASMNMNQKPVLSGNFNVLQGGTNNYTSDPLNSSGSSHESTCSEQAFMKQMLEN 471

Query: 484 DEIKKRWKGVF-----EDSADASDNE-KYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNH 537
                RW+ +      ED      NE    L+D EREFLNDE++LYYS +    N     
Sbjct: 472 TNSHTRWRHILSSLQMEDLFQRQRNEYSNDLSDLEREFLNDEFILYYSLERRSDN---QE 528

Query: 538 TPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGW 597
           TPPFPL+FS+AQ+AKIE+  I+ + Y+TIY ++ ++KLA+ +Q HNLSVLSI SPLMEGW
Sbjct: 529 TPPFPLQFSYAQKAKIELTNIMLLGYDTIYYDRGRKKLASNNQLHNLSVLSILSPLMEGW 588

Query: 598 LSNYREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGK 657
            + Y+ +L+  S  P++   R +K+ +++    I+ ESII D+ Y QLYI+SLALQ D K
Sbjct: 589 HNVYKNLLIAPSANPYTTTTRGDKRAMYELSKNIDSESIICDYRYSQLYIYSLALQADFK 648

Query: 658 ISRLNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKC 717
            + L ++EI  +A+YVE+A+ +AKEI+ SA RV +  +LK+MPVRWV+R++R+++F+VKC
Sbjct: 649 RAELTVSEITQNAKYVEIAFNAAKEIIFSAFRVHKLNLLKYMPVRWVMRLVRAVSFLVKC 708

Query: 718 YLTLTGSEL----ATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAA 773
            L L  + +    ++  + R ILKL +ISV +T + ++  A+TLKEATPDELHL  RY+A
Sbjct: 709 CLILNATSIGGGGSSEAEVRTILKLCSISVKDTANTIKMAAMTLKEATPDELHLSMRYSA 768

Query: 774 ILMYLCTEMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDS 833
           IL+YLC E++  K S  + P        P  +   +++      +         G   ++
Sbjct: 769 ILLYLCRELESEKDSSKKIP-------FPNNATTKYAISPTYEGRDGEIAAGSAGGCANT 821

Query: 834 KFETPEKL---PVDEIGDNLN-NSNDLSGKAIVNSFVEQNNDI--------TAALLNNEL 881
              T  +L   P+ +I +    N+ D +   IVN  +  + +          A+    + 
Sbjct: 822 AHITANRLRTVPLSDINETTGRNTEDTANNNIVNGSLNGDRNHLGTTEGTGAASQSTTDR 881

Query: 882 FQGPSLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLF 935
             G SL +EVT+WF  + +IGLEFVEPWT++IEQR++Q G G N+ FE LY  F
Sbjct: 882 LTG-SLPDEVTNWFSGNAEIGLEFVEPWTDMIEQRFLQSGTG-NDVFEELYQYF 933

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/931 (41%), Positives = 551/931 (59%), Gaps = 114/931 (12%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--SSTRGETNGTSPNM 74
           K RR Y+AC+NCRSRK +CDLGP D+P  PPC RCKRE K+C F  +S RG   G     
Sbjct: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG---GRKRIE 72

Query: 75  ITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNALE 134
            T    T ++ + +        P+    TL    +  E S   E       L+SM NALE
Sbjct: 73  WTVDGNTDVNATARFEAEDKYIPVA---TLKDTTSIKEGSLTPE-------LNSMHNALE 122

Query: 135 FLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATCTP 194
           FLA+AAG+ AKE ++  I        P  +  D + +  T        R +S       P
Sbjct: 123 FLAKAAGSAAKEDSRSRI--------PSYERQDKTIREKT------YHREES-------P 161

Query: 195 HENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIEAF 254
           +++ +    ASL    T  +LI ++S  +P     + D +YIG   LLT++EA  LI+ F
Sbjct: 162 NQHASGSKRASLA---TPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLF 218

Query: 255 FLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGLRHIEVHD 314
           FL MHPFFP IP QL   +EL  YPIL CAILT+SARYH F    +  GE   R+IEVHD
Sbjct: 219 FLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHD 278

Query: 315 KLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNVRG 374
           +LW+YCQ+LISQ++WAEASTRS+GT+LAF++FTEWNPR+IH+ W+DYAND  L++++ R 
Sbjct: 279 RLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRD 338

Query: 375 SKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHISETTS 434
             +   R D   LTG+GA+RRSDRM+WMLTG+AVRLAQDMGF+ NS KIF   HI+ET +
Sbjct: 339 YHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQT 398

Query: 435 AMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIKKRWKGVF 494
           AMNMNQRS+L++S + ++LN    DS          G     ++EI  N++ K+RWK  +
Sbjct: 399 AMNMNQRSILSQSLAEVSLNGHDGDS----------GLSSACIEEIFRNEDSKRRWKS-Y 447

Query: 495 EDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDD----TNLAQNHTPPF----PLRFS 546
               D+ + +     D E+EFL DEY  +++  +D     +NL  +          L F+
Sbjct: 448 TQQRDSVEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFT 507

Query: 547 FAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLV 606
             QRAK+E++RI+SI YE IY +    KL   D +H L+VL I +P+++GW + Y+ +LV
Sbjct: 508 PRQRAKVELLRIMSIGYEAIYYKDT--KLTLIDHKHKLAVLGILAPMIKGWHNTYKHLLV 565

Query: 607 PLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDG---KISRLNM 663
           P +         +NK   +D   +I+ ES+I+D+ YCQLYI+SLALQ++    K  + N+
Sbjct: 566 PFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNI 625

Query: 664 NEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTG 723
           NE+  SA+YVELAY +AKE+L SA RV +   LK+MPVRW  RIIR++AF+V+CY+TLTG
Sbjct: 626 NELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMTLTG 685

Query: 724 SELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMK 783
           S L ++P A  IL +  IS +E  ++++  A+TL+EA+PDELHLC R++ +LM+LCTEMK
Sbjct: 686 SGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMK 745

Query: 784 LRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPV 843
            ++ S  +   L RSS+  L                         N TD+    P ++P 
Sbjct: 746 RKQHSEPQNSELRRSSSHSLH------------------------NPTDA----PARMPT 777

Query: 844 DEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPS-LSEEVTDWFGASEDIG 902
                     N  +    + +F+E  +              PS L  E+ DWF  S+D+G
Sbjct: 778 TPA------ENYAATDFAIPAFLETPH--------------PSHLPSELEDWFCTSDDVG 817

Query: 903 LEFVEPWTELIEQRYMQCGDGDNNNFENLYN 933
           L+FVEPW E++EQ+++   +  N  FENLYN
Sbjct: 818 LDFVEPWAEMLEQQFI--NNDKNMTFENLYN 846

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/936 (43%), Positives = 547/936 (58%), Gaps = 115/936 (12%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           K +R+++AC  CR RK+KC+LGP+DNPH PPC RCKRE ++C F     ++   SP  I 
Sbjct: 12  KWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLSPKDIN 71

Query: 77  AASKTFLSKSE----QQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNA 132
                  +K +    QQ  N+  +          KE  N      E   W+ ++SSMQNA
Sbjct: 72  YGDDGDDNKLKFIHYQQGDNKGAN---------NKEIQN---MALEDSAWESDVSSMQNA 119

Query: 133 LEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATC 192
           LE+LA AA +V++       E+   T                     +LS   ++ S   
Sbjct: 120 LEYLASAAKSVSQ------FENHKPT--------------------SKLSDMVNSYSKDD 153

Query: 193 TPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIE 252
              EN+   L          S LI ++S +R  P +K+ D  YIG D LLT+EEA  LIE
Sbjct: 154 MTQENIIKELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIE 213

Query: 253 AFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGLRHIEV 312
            FF  +HPFFP IPLQLH+P++L  YPIL CA++T+SARY+ F  L L   E+   +I +
Sbjct: 214 VFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITI 273

Query: 313 HDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNV 372
           H+KLW+YCQ+LIS+TIWAEASTRSIGT+LAF++FTEWNPR+IH+ WSDYAND E  N N 
Sbjct: 274 HEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNE 333

Query: 373 RGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHISET 432
               +       E +TG  A+R SDRM+WMLTGSAVRLAQDM FI+ S+KIF+ THI+ET
Sbjct: 334 LNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAET 393

Query: 433 TSAMNMNQRSLLAESFSVLNLNLEKFDS----DGKENNENYFGNEKFYLDEILPNDEIKK 488
            +AMN+N RS L+ES S +N++ +K D     DGK+ +E YFGNEK+YL++I  N + ++
Sbjct: 394 YNAMNVNLRSSLSESLSNVNIHSKKIDPVKIIDGKK-SERYFGNEKYYLEQIFKNAKDRE 452

Query: 489 RWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPLRFSFA 548
               + E+      N K    D ER+FLNDEY+L+YSN +D T   QN     PL F+  
Sbjct: 453 SSYDLLENILRERRNAK-AFPDNERDFLNDEYILFYSNPDDAT---QNDELDTPLDFTVI 508

Query: 549 QRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVPL 608
           QRAKIE+++I+SI YETIY EK +R     +Q+ NL++L+IFS L++ W  NY E+L P 
Sbjct: 509 QRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPE 568

Query: 609 SDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNEIVT 668
             +   L   K   Q    I  I  ES+I D+ YCQLYI+SL+LQV+ + S+L + E+  
Sbjct: 569 ETLDPVLNASKMGLQSMTQI--IENESLICDYYYCQLYIYSLSLQVEDEESKLKLKELSQ 626

Query: 669 SARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSELAT 728
           SA+YV +AY SAKEIL SAKR+    MLKF+PVRWVIRI+R+I+FIVKCY+T T  +   
Sbjct: 627 SAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMN 686

Query: 729 NPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKSS 788
             +  ++L LS I VDE+ +L+   AV LKE+TPDELHLC RY+ IL+ L  E+K+    
Sbjct: 687 YKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKM---- 742

Query: 789 HLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPVDEIGD 848
                      T   +  HG                       DS    PE+L  D   +
Sbjct: 743 ----------DTLSTQQAHG----------------------NDS---MPERLTADTTLE 767

Query: 849 NLNNSNDLSGKAIVNSFVEQNN---DITAALLNNELFQGP----------SLSEEVTDWF 895
           N          AI   F   +N    +    L+N+L   P          S   EV DWF
Sbjct: 768 N----------AIRTEFTTTSNSGSQVELTPLSNKLATLPIDRNTTPPYASFPTEVVDWF 817

Query: 896 GASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENL 931
             S DIGLEFVEPWTE+IEQRY++ G+  N +F++L
Sbjct: 818 STSADIGLEFVEPWTEMIEQRYIKSGNTQNKDFDDL 853

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/827 (44%), Positives = 519/827 (62%), Gaps = 70/827 (8%)

Query: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--- 60
           KR S +    +  + RR+Y+ACINCR +KVKCDLGP++NPH+PPC RCKRE +DC F   
Sbjct: 10  KRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69

Query: 61  ----SSTRGETNGTSPNM-ITAASKTFLSKSEQQIRNRSTSPITA-------DMTLSGK- 107
                +   E +    N  +  + +  + ++   I+ R +S +         D++ S K 
Sbjct: 70  LKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKH 129

Query: 108 ETGNETSFKSEGVKWKFELSSMQNALEFLAQAAGTVAKEGA------------KEIIEDK 155
           E  ++ S +   +K  F  ++M+NALEFLA AAG  A+E              KE+ +D 
Sbjct: 130 ERKDKPSERKSNLKVNF--TNMRNALEFLANAAGQAAEERLSEEEEELNNKFEKELNDDH 187

Query: 156 SATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATCTPHENVTAMLAASLNANRT-TSQ 214
            +   P      T   ++TD  +K L   D          E++ ++  +    NR   + 
Sbjct: 188 ISIDSPA-----TQSTTSTDS-VKHLDLSD----------ESIASLFLSENETNRKKVTS 231

Query: 215 LIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKE 274
           LI  +   RP   RK+ D+DYIG   ++++ EAI+LI AFFLTMHPF+P +P QL DP E
Sbjct: 232 LIEAVIAARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHE 291

Query: 275 LAEYPILFCAILTVSARYHRFDTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEAST 334
           LA YPIL C ILT+S+R+H+F+ LG YNG N  RHI+VH+KLWVYCQK+ISQT+WAEAST
Sbjct: 292 LARYPILLCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEAST 351

Query: 335 RSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNVRGSKNICTRKDEEGLTGVGAIR 394
           RS+GTVLAF++FTEWNPR+IH+KW+DYAN+P+LN+ +   +      K  +  TG+GAIR
Sbjct: 352 RSLGTVLAFLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIR 411

Query: 395 RSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLN 454
           RSDRM+WML G++VR+AQDMGFIENSS +F+ TH SET  AMN+ QRS L ES +    +
Sbjct: 412 RSDRMAWMLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYS 471

Query: 455 LEKFDSDGKENNENYFGNEKFYLDEILP-NDEIKKR--WKGVFEDSAD--ASDNEKYLLT 509
             +  S  +   +    NE FY++ I   N +I +R  WK   +++ +     ++K  L+
Sbjct: 472 QGRM-SSYRNKQQQTLKNEIFYIENIFSENFKITERNYWKSQLQENIENKIDIDDKIALS 530

Query: 510 DWEREFLNDEYVLYYSNKNDDT-NLAQNHTP-------PFPLRFSFAQRAKIEIIRILSI 561
           D  R FLNDE+ L+YSN ND T +  +N+ P       P P+  S +Q+A IE++RI S 
Sbjct: 531 DKVRGFLNDEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFST 590

Query: 562 AYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVPLSDV--PFSLADRK 619
           AY+TIY     +KL++ +Q HN+S+L IF+PL+  W   + ++L P SDV  P +L +R 
Sbjct: 591 AYKTIYSRNQNQKLSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQP-SDVCEPINLNNRN 649

Query: 620 NKKQVFDNIDRINGESIITDFNYCQLYIFSLALQV--DGKISRLNMNEIVTSARYVELAY 677
           NK+ V +    I GES+I D+NYCQLYIFSLALQ+  DG+I  L +NEI  S+ Y+ LAY
Sbjct: 650 NKRVVKEFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEI--LTVNEITKSSTYINLAY 707

Query: 678 RSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGS--ELATNPDARNI 735
           +SAKE + S +RV    MLK+MPVRW+ R+IR+ AF+VKCYL++ G+  EL +  +   I
Sbjct: 708 QSAKEYILSTERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMI 767

Query: 736 LKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEM 782
            KL   S +E  +L++ +A+ L  ++PDELHLC RY++I+M    EM
Sbjct: 768 FKLGGTSANEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 2/45 (4%)

Query: 886  SLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFEN 930
            S + E  DWF AS DIGLEFVE WTE++EQRYM+  D DN  F N
Sbjct: 976  SHANEFLDWFSASGDIGLEFVESWTEMLEQRYMK--DDDNLLFNN 1018

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/962 (37%), Positives = 552/962 (57%), Gaps = 109/962 (11%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           K + T+ AC+ C+ +K+KCDLGP D P +PPCA C+R    C F++ + +  G   N++ 
Sbjct: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKI-GKLGNILD 88

Query: 77  AAS-----------KTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKS---EGVK- 121
           +              + L+   Q ++N        +M L+     N    K+   EGV  
Sbjct: 89  SQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNN--LSNLVGLKNQNLEGVSL 146

Query: 122 -------------------WKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPL 162
                              WK EL+SMQ+ALEFLA+A            + +      P 
Sbjct: 147 NSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKATK----------LRNDYKNNEPF 196

Query: 163 VDPLDTSHQSATDGGLKRLSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGV 222
                 S  ++T    + LS  D+   +  T +         S + + +T      I  +
Sbjct: 197 GST--RSDAASTTSETRDLSEKDNGNESDSTTN---------STSKDTSTRSSYPSIEAI 245

Query: 223 RPS-PTRKIEDFDYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPIL 281
           +P  PT    ++D +G   L+T +EA  L+  FF  MHPF+P IPL L D  EL +YP+L
Sbjct: 246 KPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLL 305

Query: 282 FCAILTVSARYHRFDTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVL 341
              IL +SARY+ FD +G  NG  G R++ +H+KLW +CQ+L+SQT+W++ASTRSIGT L
Sbjct: 306 LHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTL 365

Query: 342 AFIIFTEWNPRSIHYKWSDYANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSW 401
           AF++FTEWNPR+IH++ SD A+    NNV+        +++D +GL G+  ++RSDRM+W
Sbjct: 366 AFLLFTEWNPRAIHWEVSDTAHYLSDNNVS-------SSKEDPDGLGGIATVKRSDRMAW 418

Query: 402 MLTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSD 461
           M TG+A+RLAQ+M  +EN++KI+   +I+E   A NMN +  L ES   ++  +++F+ D
Sbjct: 419 MFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEID 478

Query: 462 GKENNENYFGNEKF--YLDEILPNDEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDE 519
             ++ ++   NE    ++  +  N E  K+W      S    +    L+ D E EFLNDE
Sbjct: 479 NPKSQDD-IENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDE 537

Query: 520 YVLYYSNKNDDTNLAQNHTPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTD 579
           Y + Y ++N  ++  +N     P+ ++  Q+A++E++RI++I Y+TIY EK K+++++ D
Sbjct: 538 YSINYLDEN--SSFLKN-----PIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVD 590

Query: 580 QRHNLSVLSIFSPLMEGWLSNYREVLVPLSD---VPFSLADRKNKKQVFDNIDRINGESI 636
           Q+ NL +L + SP++  W  NY +++ P+SD   V  SL D       F     I GES 
Sbjct: 591 QKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSK----FKRTANIRGESF 646

Query: 637 ITDFNYCQLYIFSLALQVDGKISRLNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAML 696
           I+D+ YCQLY FSLALQV+ K S+L +NE++ SAR+VE AYR+AKEIL SA RV +  ML
Sbjct: 647 ISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDML 706

Query: 697 KFMPVRWVIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDLMRDTAVT 756
           K+MPVRWV+RI+RS +FIVKCY+TL    +ATN +A++ILKLS I VD+T  ++R  AV 
Sbjct: 707 KYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVI 766

Query: 757 LKEATPDELHLCQRYAAILMYLCTEMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDV 816
           LKE+TPDELHL  +++ ILM+LC E+  RK    +  +L+  +      N+  SLE    
Sbjct: 767 LKESTPDELHLASKFSTILMFLCKEIDERKR---DNENLMTGNGL----NNDPSLESQTT 819

Query: 817 TKKSTFYRDIGGNKTDSKFETPEKLPVDEIGDNLNNSNDLSGKAIVNSFVEQN-NDITAA 875
            K+S     +  +  D+     ++ P +      ++S+D + +   NS  +   N I   
Sbjct: 820 HKES-----LEASNHDTISSDAQEPPSEN-----DSSHDTTTQGTANSTRKVGPNSI--- 866

Query: 876 LLNNELFQGPS-LSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNL 934
              +E+ Q  + L E+V DWF AS +IGL+FVEPWTELIEQ+Y+Q  DG   +F+ L++ 
Sbjct: 867 ---DEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDG-FQDFDQLFDE 922

Query: 935 FV 936
           F 
Sbjct: 923 FA 924

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/1002 (37%), Positives = 521/1002 (51%), Gaps = 167/1002 (16%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           K RR Y+AC+NCR+RKV+CDLGPVD P  PPC RC RE K+C F+    E        I 
Sbjct: 24  KWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFT----ELRRGRNRRIR 79

Query: 77  AASKTFLSKSEQQ----IRNRSTSPITADMTLSGKET----GNETSFKSEGVKWK----- 123
            A       +E      + N    P +A    SG+ T    G++ S  S   + +     
Sbjct: 80  VAKNDRAGHAEPDGGICVANAHGDPSSATGRFSGEPTALSAGSDPSPDSASNRGRDDQSS 139

Query: 124 ----------------FELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPR------- 160
                            E +++ N LEFL +AAG+VAK+  + ++   +A  +       
Sbjct: 140 NSDEPEFSERPELSLSSEFTTLHNTLEFLTKAAGSVAKDNGR-LLSSSTAVGKHSAAICE 198

Query: 161 ----PLVDPLDTSHQSATDGGLKRLSRGDSAASATCTPHENVTAMLAASLNANRTTSQLI 216
                L +PL     ++   G +        A+A+ TP E              T   L+
Sbjct: 199 SITLQLYNPLHNGQYASVVSGPRNPEAITDQAAASRTPQE----------EPESTKYPLL 248

Query: 217 REISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELA 276
           R I              +Y+GP+N LT EE I L E FF+T +PFFP+IPL + DP+ELA
Sbjct: 249 RNI--------------EYVGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELA 294

Query: 277 EYPILFCAILTVSARYHRFDTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRS 336
            YPIL C +L++SARYH+F+ +GL N  +  R+I+VH+ LW YCQ++ISQT+W EASTRS
Sbjct: 295 RYPILLCGVLSISARYHKFEDIGLSNRGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRS 354

Query: 337 IGTVLAFIIFTEWNPRSIHYKWSDYAN---------DPELNNVNVRGSKNICTRKD---- 383
           IGTVL F+IFTEWNPR+IH K +DYAN           E  N    GS    T ++    
Sbjct: 355 IGTVLVFLIFTEWNPRAIHRKCNDYANATDRQNEQSHSEKANTAHCGSGIPATERNGPRR 414

Query: 384 ----EEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMN 439
               ++G +G+ A+RRS RM+WML G+AVRLAQDM FI  SSKIF+ TH SET  AMNM 
Sbjct: 415 FVLADQGSSGLSAMRRSKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMG 474

Query: 440 QRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIKKRWKGVFEDSAD 499
           Q S L  S S++N N+   +S    +N              +P+ E ++R+K V +    
Sbjct: 475 QNSTL--SHSLMNANIIGSESSTAISNPP------------MPS-ETEERYKSVLQRLGK 519

Query: 500 ASDNEKYLLTDWEREFLNDEYVLY-----------YSNKNDDTN-------------LAQ 535
                +  L+    EFL DE +LY           Y +  D T              L +
Sbjct: 520 HVPRGRG-LSQLYNEFLEDERILYGLGGGSEYVEAYCDSLDQTKNNVSIETAYESSLLER 578

Query: 536 NHTPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLME 595
                F    SFAQRAKIE++RI+S+ YETIY   N  KL   ++ H LSVL + SP +E
Sbjct: 579 GGQQVF---LSFAQRAKIELLRIMSVGYETIY--SNHAKLVLREKHHILSVLGLLSPQIE 633

Query: 596 GWLSNYREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVD 655
            W + Y  +LVP    PF+     ++    D + RI+ ESII D+ YCQLYI+SLAL VD
Sbjct: 634 NWYTQYNSLLVPAGGAPFNPTADFSRINPLDLVRRIDAESIICDYYYCQLYIYSLALTVD 693

Query: 656 GKISRLN----MNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSI 711
            +  R      ++ ++ SARYVELAY +A+E+L SA RV R  MLK+MP RWV RI+ ++
Sbjct: 694 FRKPRHPNASWLDRLMKSARYVELAYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGAV 753

Query: 712 AFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRY 771
           AFIVKCYLT+  + L  + +A  IL LSAI  DE  + ++  A+TL+EA+PD++HLC +Y
Sbjct: 754 AFIVKCYLTM-AAHLTASHEASAILTLSAIPPDEVVNTIQRAAITLREASPDDVHLCNKY 812

Query: 772 AAILMYLCTEMKLRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKT 831
           + ILMYLC+EMKLR            + T PL                    R + G   
Sbjct: 813 STILMYLCSEMKLRN---------WPTPTPPLP-------------------RSVSGEPI 844

Query: 832 DSKFETPEKLPVDEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPS-LSEE 890
                     P   I    ++  +       +     ++ + A   +   F   S L  E
Sbjct: 845 RVPVFECSATPAARIFSPPHHPAESQTTGGTDPPPLPDHTLAAPSSDPAPFDTTSHLPWE 904

Query: 891 VTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLY 932
           + DW   S++IGL+FVEPWT++IE R M+ G  DN +  +LY
Sbjct: 905 LIDWLHTSDEIGLDFVEPWTDVIE-RLMESGP-DNIDTNSLY 944

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 2   SPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
           S K  S++N   + P +RR  +AC NCR RK+KCD   +D P    C+ C +  K CSFS
Sbjct: 140 SNKPTSNDNFISQHPYKRRVVKACYNCRRRKIKCD--AID-PSKNKCSNCLKLNKICSFS 196

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 6/43 (13%)

Query: 16 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          P+R +T+  C  CRSRKVKCDLG       P C RC+R   +C
Sbjct: 11 PRRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 8/59 (13%)

Query: 1  MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          M P R+SS+ +  E+ +R +T+  C  CRSRKVKCDLG       P C RC++   +C 
Sbjct: 1  MKP-RKSSDTKGKEV-RRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLECG 51

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 4  KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          KR+SS     +  +R +T+  C  CRSRKVKCDLG       P C RC +   +C 
Sbjct: 2  KRQSSAGGKAKEVRRVKTFTGCWTCRSRKVKCDLG------KPTCQRCDKSGLECG 51

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 16 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          P+R +T+  C  CRSRKVKCDL        P C+RC+R    C
Sbjct: 3  PRRAKTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 1  MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          M+ K+R    +A   P+R +T+  C  CRSRKVKCDL        P C RC++   +C
Sbjct: 1  MTSKQRRPRVKAR--PRRAKTFTGCWTCRSRKVKCDL------RRPGCLRCEKSSLEC 50

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 6  RSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          R S     + P+R +T+  C  CRSRKVKCDL        P C RC +   +C
Sbjct: 2  RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 23/113 (20%)

Query: 14  ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPN 73
           E  KR+R   ACI+C + K KC    +D+    PC RC R  K C+F             
Sbjct: 56  EWEKRKRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAFD------------ 103

Query: 74  MITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFEL 126
                    LSK  ++ ++RS  P+    + S +E  N+    S+ ++    L
Sbjct: 104 ---------LSKRTRKRKSRSIGPLKH--SASSEEVSNQVKISSQSMQHSITL 145

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          KR +T+  C  CRSRKVKCDL        P C RC++   DC 
Sbjct: 20 KRAKTFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDCG 56

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSP 72
          KR+R   ACI C S K KC    ++N    PC RC +  + C+F  ++   N  +P
Sbjct: 34 KRKRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTFDLSKRTRNRRTP 89

>Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106W
           (RDS1) - transcriptional regulator [contig 139] FULL
          Length = 827

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 20/102 (19%)

Query: 16  PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMI 75
           P+  R    C+ CR+RK+KCD         P C RCK+ L  CS+++  G + G S   +
Sbjct: 6   PRVNRPRLVCLECRNRKLKCDKA------RPKCTRCKQNLLTCSYAND-GNSPGGSKLYV 58

Query: 76  TAA---SKTFL--------SKSEQQIRNRSTSPI--TADMTL 104
             A   S  FL        S +E ++ + S SPI    D TL
Sbjct: 59  DKAFPHSSEFLGTQHSESSSTNETRVPSYSNSPIENIGDCTL 100

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 35/73 (47%), Gaps = 10/73 (13%)

Query: 1  MSPKRR--SSENEAHEL-PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKD 57
          M+PK    S +N   +L PKR R   AC NCR +K KCD          PC  CK    +
Sbjct: 1  MNPKVLVLSMDNSTKKLRPKRLRVSHACDNCRLKKKKCD-------GQQPCKLCKNSENE 53

Query: 58 CSFSSTRGETNGT 70
          C +S  R  T GT
Sbjct: 54 CIYSDRRRLTTGT 66

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 12/78 (15%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF---SSTRGETNGTSP- 72
           KRRR  +AC  CR +KVKCD          PC  C     +C++   S+ R  +N ++P 
Sbjct: 58  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSTRRNNSNSSTPI 110

Query: 73  -NMITAASKTFLSKSEQQ 89
             M+ + S T L+    Q
Sbjct: 111 STMVNSHSMTNLTMMSNQ 128

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 6/72 (8%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF-----SSTRGETNGTSP 72
           +R T+ AC++C S KVKC    +D+ +  PC RC +  K C+F     +  R + N  S 
Sbjct: 116 KRNTF-ACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTFDLSKRTKRRKQRNSNST 174

Query: 73  NMITAASKTFLS 84
           + + + + +F S
Sbjct: 175 SSLVSMTGSFQS 186

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 6/41 (14%)

Query: 13 HELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 53
          +E+  +R+++  C  CRSRKVKCDL      + P C RC R
Sbjct: 5  NEMTTKRKSFNGCWTCRSRKVKCDL------NRPKCQRCDR 39

>NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.61
          YOR172W
          Length = 735

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 13/92 (14%)

Query: 13 HELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKDCSFSSTRGETNGT- 70
          +E  KRR+  ++C+ CR RK+KCD         P C +CK R+L DC ++      N   
Sbjct: 11 NEPKKRRKQIKSCMFCRKRKLKCDKA------KPMCGQCKERKLPDCLYTDFNFPVNSMK 64

Query: 71 -----SPNMITAASKTFLSKSEQQIRNRSTSP 97
               +PN+        L +   ++R +   P
Sbjct: 65 DLFDNTPNLELMERIKLLEQEVDELRRQQQLP 96

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          R +T+  C  CR RKVKCDLG       P C RC++   DC 
Sbjct: 37 RAKTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDCG 72

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 16/80 (20%)

Query: 12  AHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTS 71
           + +L K+R+  +ACI CR R +KC       P   PC +C      C FS          
Sbjct: 46  SQQLGKKRKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKFS---------E 89

Query: 72  PNMITAASKTFLSKSEQQIR 91
           PN     S  +L+K    I+
Sbjct: 90  PNKKVIVSINYLTKLHDNIK 109

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 26/45 (57%), Gaps = 9/45 (20%)

Query: 15 LPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          LPKR+R   AC NCR R+ KCDL       + PCA C R   DC+
Sbjct: 51 LPKRKRL--ACTNCRKRRKKCDL-------SYPCASCVRLRIDCN 86

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 40/86 (46%), Gaps = 17/86 (19%)

Query: 1  MSPKRRSSE-NEAHELP---------KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCAR 50
          MS  RR SE  EA   P         +R +T +AC  CR +K +CD     +   P C+ 
Sbjct: 1  MSASRRESEPKEAETSPEAGGAASDRRRSKTSRACDQCREKKTRCDF----SDERPICSA 56

Query: 51 CKRELKDCSFSST---RGETNGTSPN 73
          C+R  K C+F      RG T G + N
Sbjct: 57 CQRMGKTCTFERVPMKRGPTKGYTRN 82

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {ON}
           Anc_2.654
          Length = 902

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 65/168 (38%), Gaps = 21/168 (12%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           KRR    ACI CR R +KC  G        PCARC +    C +           P+   
Sbjct: 21  KRRPKSLACILCRKRHIKCSGG-------NPCARCIKHDLKCEY---------IEPSKKI 64

Query: 77  AASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWK----FELSSMQNA 132
             S  +L + +  + N     +     +S  +TG+    K +    K     E +S +  
Sbjct: 65  VVSLKYLQQLQDSLANMKRENVRLQSLVSRSKTGSPLQGKDDNATLKDENTNEGASRRLP 124

Query: 133 LEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKR 180
           L  L Q +  +  E     +ED+  T   +   L+T+   +T   +K+
Sbjct: 125 LTGLLQESSQMT-EFNNNTVEDRQKTGTAITKKLNTNENGSTSSNMKK 171

>ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserved
          hypothetical protein
          Length = 638

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 3  PKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          P +R ++N+ + +P +RR+   C++CR R+ KCD         P C  C R   +C
Sbjct: 2  PSKRRTQNQYNGIPTKRRSVTGCLSCRRRRKKCD------ETRPNCKACIRNFLEC 51

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {ON}
           Anc_2.565
          Length = 803

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 14/99 (14%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           +R R  +AC  C+ RKVKCD          PC+ C +  KDC+++     T    PNM  
Sbjct: 17  QRLRVQRACAICKKRKVKCD-------GMKPCSNCIKRSKDCTYT-----TAYKIPNMKY 64

Query: 77  AASKTFLSKSEQ-QIRNRSTSP-ITADMTLSGKETGNET 113
           + S +  SK+    I N   +P  + D+ L  K+  + T
Sbjct: 65  SPSLSPSSKTHSVSIENSPAAPDASLDIRLHQKKANHVT 103

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTS 71
          +R+R    CI C+++K++CD         P C+RC+R  +DC + S   E   T+
Sbjct: 23 RRQRRSHVCITCKNQKLRCD------RERPSCSRCRRIGRDCVYESPTPEETMTN 71

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 13/82 (15%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS---------STRGETN 68
           +RR  +AC +CR RK+KC  GP+ NP    C  C +    C+F+            G + 
Sbjct: 96  KRRVSKACDHCRKRKIKC--GPI-NPAKNKCDNCIKYSSACTFTHQPSNQKRQDNGGASQ 152

Query: 69  GTSPNMITAAS-KTFLSKSEQQ 89
           GT+ + I  A  ++ +S +E Q
Sbjct: 153 GTAASHINVAQPESLVSIAEAQ 174

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 10/59 (16%)

Query: 3  PKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          P  R +E   H++ KRRR  +AC  CR +KVKCD          PC  C     +C+++
Sbjct: 18 PSPRQTE---HQIVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYN 66

>KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.512
           YLR451W
          Length = 766

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/343 (19%), Positives = 116/343 (33%), Gaps = 74/343 (21%)

Query: 10  NEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNG 69
           +E+  +  +RR Y AC+ CR +K KCD          PC+RCK++   C+       T  
Sbjct: 4   DESTLMKSKRRKY-ACVECRQQKSKCDYT---TKFPEPCSRCKKKGIICAVKQGFKRTKK 59

Query: 70  TSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSSM 129
                  A ++    K EQ   + +  P++ D  +   +   +                 
Sbjct: 60  ------RATAEAIERKIEQLKNHIADGPVSVDDLIRLAKEDEDVD--------------- 98

Query: 130 QNALEFLAQAAGTVAKEGAKEIIEDKSATPRP-LVDPLDTSHQSATDGGLKRLSRGDSAA 188
                 L Q   T        I+  ++ TP    + PL  +  +  + GL  LSR  SA 
Sbjct: 99  ------LGQFDNTAFTREQLHILRSEARTPVSRAMTPLTNALNTTVNNGL--LSRSLSAE 150

Query: 189 SATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAI 248
              C+P                                         +G D  ++ E+  
Sbjct: 151 ECKCSPKS---------------------------------------LG-DIYMSSEDIA 170

Query: 249 ELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGLR 308
           +L + F    H F P + L     K  +  P LF  I+    R+       +      ++
Sbjct: 171 DLFQEFATNYHQFLPVVDLSKGAEKIFSLSPCLFWVIMLTGLRHRSGSIETMTKLSTLVK 230

Query: 309 HIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNP 351
            I     +    Q   +++     +  S+ +V AF+++T W P
Sbjct: 231 SILAEITISPIIQYTPTESDEPLLNVASVYSVQAFLLYTFWPP 273

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.344
           YML076C
          Length = 903

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 86/219 (39%), Gaps = 40/219 (18%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF---------------- 60
           K +R   AC+ C S K KC     ++ +  PC RC R+ K C F                
Sbjct: 51  KNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKFDLSKRTRKRRRGNSNS 110

Query: 61  -------SSTRGETNGTSPNMITAASK-----TFLSKSEQQIRNRSTSPI---TADMTLS 105
                  SS  G  +GT P++ + +S        ++   Q  + +  +P+     + +L+
Sbjct: 111 EREQSTLSSPSGPGSGTPPSLFSQSSNQVPNFNVMTPGIQSSQRKYLTPLGNANLESSLN 170

Query: 106 GKETGNETSFKSEGVKWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDP 165
            + + N     S G+     L+  QN L+       T A   A EI       P    D 
Sbjct: 171 ERLSQNSPVSTSPGILNSALLNPPQNQLD--THLPITTANAPANEI---SCGNPLLKSDI 225

Query: 166 LDTSHQSATDGGLK-RLSRGDSAASATCTPHENVTAMLA 203
           +D+ +Q   + GL   L+  D   + T   + N TA+LA
Sbjct: 226 VDSLNQ---ERGLSVPLNEHDLLNNGTSPSNTNKTALLA 261

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa]
          {ON} 
          Length = 860

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 6/46 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSS 62
          +++R    C+ CRSRK+KCD         P C RCK++ K C++ S
Sbjct: 7  RKQRPSYVCLECRSRKLKCD------KARPYCNRCKKDGKVCAYES 46

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 9  ENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETN 68
          E +   + KRRR  +AC  CR +KVKC     DN H  PC  C     +C+++     T 
Sbjct: 6  ERQGSRIAKRRRITRACDECRKKKVKC-----DNRH--PCIHCTVYSYECTYNQPARRTG 58

Query: 69 G 69
          G
Sbjct: 59 G 59

>KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa]
           {ON} Anc_3.109 YOL089C
          Length = 1050

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 7   SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           SS N A  +P ++R   AC +CR RK+KC  GP+ N     C+ C +   +C+F
Sbjct: 130 SSSNGASVIPAKKRVSMACDHCRKRKIKC--GPI-NTVENKCSHCIKYNAECTF 180

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 13 HELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          HE   R R+Y  C  CR+RKVKCD         P C RCK+   +C
Sbjct: 8  HEQLHRNRSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 16 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETN 68
          PKRRR  +AC  CR +KVKCD          PC  C     +C+++     +N
Sbjct: 27 PKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYNQPSKRSN 72

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 12/64 (18%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC------SFSSTRGETNGT 70
          KRR+  +AC+ CR RK+KCDL        P C +C     +C      +F  +  E    
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLT------KPKCKQCSSRNLNCIYTNQYNFDLSDAELFAN 59

Query: 71 SPNM 74
           PN+
Sbjct: 60 QPNI 63

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {ON}
           YLR098C (REAL)
          Length = 644

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 11/107 (10%)

Query: 2   SPKRRSSENEAHE--LPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
           S KR  + NE +   +P++R+   AC +CR R+ KCD+         PC+ C +   DC 
Sbjct: 21  SLKRPMANNEENNDNVPRKRKL--ACQSCRRRRRKCDM-------EKPCSNCIKFQTDCV 71

Query: 60  FSSTRGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSG 106
           F+         S   + A      S  EQ +  +S+S   A+  LS 
Sbjct: 72  FAQQDLRNKRYSTTYVEALQSQIRSLKEQLLILKSSSSTIAENNLSS 118

>Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar
          to Ashbya gossypii AGL206C
          Length = 739

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 19 RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPN 73
          +R+   C+ CR+R+ KCD         P C  C+R L  C +S   G +  TSPN
Sbjct: 45 KRSRNGCLTCRARRKKCD------ETKPKCIGCQRNLLLCRWSDKEGGSTETSPN 93

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
          Anc_4.344 YML076C
          Length = 894

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 11 EAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          E +E+ K +R   AC+ C S K KC    V++ +  PC RC R  + C F
Sbjct: 48 EVNEVGKLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKF 97

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 7/66 (10%)

Query: 7   SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST--- 63
           S+ N    + KR +  +AC  CR +K+KCD     N     C+ C+R  + C+F      
Sbjct: 73  SNTNNTTTVKKRTKASRACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTFERVPLK 128

Query: 64  RGETNG 69
           RG + G
Sbjct: 129 RGPSKG 134

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 12/99 (12%)

Query: 3   PKRRSSENEAHE-LPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
           P+ R  ++ A + + KRRR  +AC  CR +KVKCD          PC  C     +C+++
Sbjct: 16  PQNRLLQDPAQQHMAKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYN 68

Query: 62  STRGET----NGTSPNMITAASKTFLSKSEQQIRNRSTS 96
                +       +P+    +S + L ++  Q+++ S+S
Sbjct: 69  QPTKRSLQHLTTYAPSKTNNSSSSPLKQTTNQVKSTSSS 107

>KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserved
          hypothetical protein
          Length = 631

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 16 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRG 65
          PKR+R+   C+ CR+R+ KCD       + P C  C+R    C++    G
Sbjct: 5  PKRKRSVHGCLTCRTRRKKCD------ENKPVCGGCERNFVQCTWPQHTG 48

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 52/129 (40%), Gaps = 23/129 (17%)

Query: 11  EAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGT 70
           E  E  K +R   AC+ C S K KC+   V++ +  PC RC +  K C F  ++  T   
Sbjct: 62  ETTEKGKTKRNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKFDLSK-RTRKR 120

Query: 71  SPNMITAASKTFLSKSEQQIRNRSTSPITADM----TLSGKETGNETSFKSEGVKWKFEL 126
            P                  R+RS +P  + M    T S   T +E S   +G  +    
Sbjct: 121 KP------------------RSRSPTPFESPMVNVSTKSKGPTDSEESSLKDGTSYLASF 162

Query: 127 SSMQNALEF 135
            S  NA +F
Sbjct: 163 PSDPNAKQF 171

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          +R +T+  C  CR+RKVKCDL        P C RC+R    C
Sbjct: 14 QRAKTFTGCWTCRARKVKCDLT------RPSCTRCERSGLKC 49

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPP--CARCKRELKDCSF-SSTRG 65
          KR+   +AC+ CR RK+KCD     +P   P  C  C R   +C F +S RG
Sbjct: 19 KRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVASNRG 70

>Smik_4.801 Chr4 complement(1403910..1406225) [2316 bp, 771 aa] {ON}
           YDR520C (REAL)
          Length = 771

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 69/173 (39%), Gaps = 10/173 (5%)

Query: 7   SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTR-G 65
           S +N  ++ P+++R   +C  CR  K +CD  P        C RC     DCS +  +  
Sbjct: 54  SPKNNGNKKPRKKRKTFSCNTCRRVKTRCDFEPF----IGKCYRCNVLQLDCSLAKNKDN 109

Query: 66  ETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFE 125
           +T  T  +         +S +     + ST  +  D ++ GK      S  SE       
Sbjct: 110 KTLNTLRDDGLLKKINSISSNLSSFSHLSTDALNEDQSIVGK----NDSMTSENHMINKR 165

Query: 126 LSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGL 178
           LSS++N ++ L Q    +    AK    + +  PR     LD S  +  D  L
Sbjct: 166 LSSLENQIKSLHQKMDLIIT-SAKLFSNNDAKDPRKGDQSLDISLSNTHDRSL 217

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          KR +T++ C  CR RK+KCDL        P C +C+     CS
Sbjct: 15 KRAKTFEGCWTCRLRKIKCDL------KKPKCDKCRSSAISCS 51

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          KR +T+  C  CRSRKVKCDL        P C RC++    C 
Sbjct: 32 KRGKTFTGCWTCRSRKVKCDL------RRPHCQRCEKSGLVCG 68

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
          KRRR  +AC  CR +KVKCD          PC  C     +C+++         +P  IT
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRGGSCAPQTIT 59

Query: 77 A 77
           
Sbjct: 60 V 60

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 6/46 (13%)

Query: 14 ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAP-PCARCKRELKDC 58
          E+P  RR Y AC+ CR +K KCD     N  AP PC++C R+   C
Sbjct: 9  EIPMGRRKY-ACVECRQQKSKCDA----NDKAPNPCSKCARKGVPC 49

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 20 RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          +TY  C  CR+RKVKCDL        P C RC+R    C
Sbjct: 10 KTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 7/61 (11%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
          KRRR  +AC  CR +KVKCD          PC  C     +C+++     TN +    ++
Sbjct: 10 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKRTNSSVTGSMS 62

Query: 77 A 77
          A
Sbjct: 63 A 63

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 6/41 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          R RTY  C  CRSRK+KCD         P C RC +    C
Sbjct: 9  RNRTYSGCWTCRSRKIKCD------QQKPQCKRCLKANLKC 43

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 817

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 9/79 (11%)

Query: 19  RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGT--SPNMIT 76
           R+T QACI+CR RKVKC+          PC+ CK    +C++ +   E       P++ T
Sbjct: 45  RKTPQACISCRRRKVKCN-------GCRPCSSCKTNGLECAYDTPSLEQVNIKGKPHIDT 97

Query: 77  AASKTFLSKSEQQIRNRST 95
           + +   +S     +RN S+
Sbjct: 98  SEALRLISNLHSTLRNLSS 116

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 9/53 (16%)

Query: 11 EAHE--LPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          E H+  +P   R   ACI CR R VKC       P+  PC RC +    C +S
Sbjct: 24 EGHQDIVPPIPRKSNACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYS 69

>Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172W
          (REAL)
          Length = 784

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 13/74 (17%)

Query: 8  SENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELK-DCSFSS---- 62
          SE+   +  KRR+  ++C  CR RK++CD         P C+ CK + + DC ++     
Sbjct: 14 SEDSGKKTQKRRKPIRSCAFCRKRKLRCD------RQKPICSTCKTKGRSDCIYTEEFAH 67

Query: 63 --TRGETNGTSPNM 74
              GE  G++PN+
Sbjct: 68 RVESGELFGSTPNV 81

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST---RGETNG 69
          +R +T +AC  CR +K +CD    +    P C  C+R  K C+F      RG T G
Sbjct: 31 RRSKTSRACDQCRGKKTRCDFSDEN----PVCTSCQRMSKTCTFERVPMKRGPTKG 82

>AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON}
          NOHBY711; No homolog in Saccharomyces cerevisiae
          Length = 735

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 19 RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPN 73
          +R+   C+ CR+R+ KCD         P C  C+R L  C ++   G  +G SPN
Sbjct: 44 KRSRNGCLTCRARRKKCD------ETRPKCIGCQRNLLLCHWADDDGNYDGHSPN 92

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa]
          {ON} Anc_1.128 YJL206C
          Length = 658

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 16 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63
          P R R ++ACI CR +K +CD          PC+ C R    C +++T
Sbjct: 23 PTRLRVFKACIACRKKKRRCD-------GKSPCSHCARTSIICEYTNT 63

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++R  +AC +CR RK+KCD  PV NP    C+ C +   +C+F
Sbjct: 111 KKRVARACDHCRRRKIKCD--PV-NPQTNKCSNCTKYDANCTF 150

>Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343
          bp, 780 aa] {ON}
          (9848..11548,11550..11612,11615..12193) [2343 nt, 781
          aa]
          Length = 780

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 13/65 (20%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDC------SFSSTRGETNG 69
          +RR+  ++C  CR RK+KCD G       P C +C  REL +C      +F  T  E   
Sbjct: 28 RRRKVIKSCTFCRKRKLKCDHG------RPMCNQCSSRELPECIYTEGFNFQITTKELFD 81

Query: 70 TSPNM 74
           SPN+
Sbjct: 82 NSPNI 86

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 15/130 (11%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS--STRGETNGTS--- 71
           KRRR  +AC  CR +KVKCD          PC  C     +C++   + R + +G S   
Sbjct: 13  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNSGNSGVL 65

Query: 72  --PNMITAASKTFLSKSEQQIRNRSTSPI-TADMTLSGKETGNETSFKSEGVKWKFELSS 128
              N+ T  S + +  +     N+  S I T    L G  T   ++  S+  K+K + + 
Sbjct: 66  TLGNVTTGPSSSTVVAAAASNPNKLLSNIKTERAILPGASTIPASNNPSKPRKYKTKSTR 125

Query: 129 MQNALEFLAQ 138
           +Q+ ++   Q
Sbjct: 126 LQSKIDRYKQ 135

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa]
          {ON} YGL013C (REAL)
          Length = 1000

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 7/48 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRG 65
          R +  +AC NCR RK+KC+ G        PCA C+  L +C+F++  G
Sbjct: 36 RSKVSKACDNCRKRKIKCN-GKF------PCASCEIYLCECTFTTRHG 76

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          R +T+  C  CR RKVKCDLG       P C RC++    C 
Sbjct: 39 RAKTFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSCG 74

>Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172W
          (REAL)
          Length = 790

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 13/73 (17%)

Query: 9  ENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKDCSFSSTRG-- 65
          E+    + KRR+  ++C  CR RK++CD         P C+ CK R   DC ++   G  
Sbjct: 15 EDAGKNVRKRRKPIKSCAFCRKRKLRCD------QQKPVCSTCKARRRTDCLYTEEFGHS 68

Query: 66 ----ETNGTSPNM 74
              E  G +PN+
Sbjct: 69 IESEELFGNTPNI 81

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 9/80 (11%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
          KR R    C  CR RK+KCD         P C+RC +   +C ++  R +     P  + 
Sbjct: 7  KRNRRLHVCDACRIRKLKCDKA------KPNCSRCAKHGLECIYNPYRQK---EEPETVV 57

Query: 77 AASKTFLSKSEQQIRNRSTS 96
          A  K  L    Q + N   S
Sbjct: 58 ALKKELLELRAQLVANSPAS 77

>KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly
           similar to uniprot|P12383 Saccharomyces cerevisiae
           YGL013C PDR1 Zinc cluster protein that is a master
           regulator involved in recruiting other zinc cluster
           proteins to pleiotropic drug response elements (PDREs)
           to fine tune the regulation of multidrug resistance
           genes
          Length = 938

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 97/243 (39%), Gaps = 53/243 (21%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS--------------S 62
           KR +  +AC NCR RK+KC         A PC  C+    +C+++              +
Sbjct: 15  KRSKVSRACNNCRRRKIKCT-------GANPCLNCQTYKCECTYNLQSPPTIGTGDFSLN 67

Query: 63  TRGETNGTSPNMITAASKTFLSKSEQQ-IRNRSTSPI-TADMTLSGKET---------GN 111
           TRG    T+ + I+A   T  +K+    I   S  P+ T+  +L    T         G 
Sbjct: 68  TRGVPLKTAASGISAPKPTIAAKAPVGFIPCDSVPPVCTSSSSLDADSTSVPQAKIFAGL 127

Query: 112 ETSFKSEGVKWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQ 171
                 +  +   +LS +  AL+ L     +    GA + I+D+       +D + TS +
Sbjct: 128 PNGLYEDDSEILKQLSRLSEALKALKCMPPSARMTGAIQNIQDQ-------IDDIQTSWR 180

Query: 172 SATDGGLKRLSRGDSAASATCTPHENVTAMLAASLNANRTTSQL-IREISGVRPSPTRKI 230
            A      R++  +S + AT +        L   L  N+ T  + +   S ++PSP    
Sbjct: 181 PAV-----RMNATNSVSEATTS--------LETRLMINKYTDNVSLTRFSTIQPSPVLSQ 227

Query: 231 EDF 233
            +F
Sbjct: 228 SNF 230

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 8/51 (15%)

Query: 14 ELPK-RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63
          ELP  +RR  +AC  CR  K KCD          PC+RC +E K C++S++
Sbjct: 10 ELPTIKRRVSKACDACRKSKTKCD-------GERPCSRCLKENKLCTYSNS 53

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          KR +T+  C  CRSRK+KCDL        P C +C     +C
Sbjct: 18 KRIKTFTGCWTCRSRKIKCDLT------KPSCRKCTNSRIEC 53

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 6/46 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSS 62
          K +RT   CI C+S+K++C      N   P C+RC+R  K C + +
Sbjct: 27 KSKRTVSVCIPCKSQKLRC------NKARPICSRCQRLGKHCHYGA 66

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           K +R   AC NC S+K KC    V + +  PC RC +  K C F
Sbjct: 104 KPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRKLCKF 147

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
          RGT1Glucose-responsive transcription factor that
          regulates expression of several glucose transporter
          (HXT) genes in response to glucose; binds to promoters
          and acts both as a transcriptional activator and
          repressor
          Length = 1170

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 7  SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST--- 63
          S+   +H + KR +  +AC  CR +K+KCD           C+ C+R    CSF      
Sbjct: 29 SAAAASHAIKKRTKASRACDQCRKKKIKCDY----KDEKGVCSNCQRNGDRCSFDRVPLK 84

Query: 64 RGETNG 69
          RG + G
Sbjct: 85 RGPSKG 90

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTS-PNMI 75
          +R +  +AC+NCR +K KCD         P C +C+    +C +   + + N  S PN I
Sbjct: 8  RRNKAIKACLNCRRKKQKCDQA------RPQCYQCRIRKTECVYLGEKADKNSISIPNSI 61

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 15/130 (11%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS--STRGETNGTS--- 71
           KRRR  +AC  CR +KVKCD          PC  C     +C++   + R +  G S   
Sbjct: 13  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNPGNSGVL 65

Query: 72  --PNMITAASKTFLSKSEQQIRNRSTSPITAD-MTLSGKETGNETSFKSEGVKWKFELSS 128
              N +   S + +  +     N+  S + A+ + L G  T   +S  S+  K+K + + 
Sbjct: 66  ALDNAVAGPSSSAVVAAAASNPNKLLSSVKAERIVLPGSSTMPASSNSSKPRKYKTKSTR 125

Query: 129 MQNALEFLAQ 138
           +Q+ ++   Q
Sbjct: 126 LQSKIDRYKQ 135

>Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {ON}
           YML076C (REAL)
          Length = 946

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 11/112 (9%)

Query: 11  EAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF---------- 60
           E  E  K +R   AC+ C S K KC     ++ +  PC RC +  K C F          
Sbjct: 61  ETTENGKIKRNSFACVCCHSLKQKCVPSDANDIYRKPCQRCLKHKKVCKFDLAKRTRKRK 120

Query: 61  SSTRGETNGTSPNMITAASKTF-LSKSEQQIRNRSTSPITADMTLSGKETGN 111
             +R  T+  SP    +    F ++  E  ++N ++ PIT  +  + K+  N
Sbjct: 121 QRSRSSTSLESPIQDVSKKGEFPVNFKESSLKNNTSYPITFPLDSNTKQVSN 172

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGE 66
          KR R    C+NCR RK KCD G       P C+ C +  + C +S    E
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRG------KPSCSNCLKLGETCVYSEDTDE 56

>Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W
          (REAL)
          Length = 801

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 7  SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDCSFSSTRG 65
          SSE+ A +  KRR+  ++C  CR RK++CD         P C  C  R   DC +  T G
Sbjct: 13 SSEDTAKKGRKRRKPIKSCAFCRKRKLRCD------QQKPMCLTCVSRGRPDCFY--TDG 64

Query: 66 ETNGTSPNMITAAS 79
           T+   PN +  ++
Sbjct: 65 FTHSIEPNELFGST 78

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 10/100 (10%)

Query: 11  EAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS--------- 61
           E  E  K +R   AC+ C S K KC+    ++ +  PC RC +  K C F          
Sbjct: 61  ETTENGKIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLCKFDLSKRTRKRK 120

Query: 62  -STRGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITA 100
             +R  T+  SP +  +    F + SE+     +TS +T+
Sbjct: 121 PRSRSPTSFESPMVNISTKSKFPTDSEESSLKDTTSYLTS 160

>Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa]
           {ON} YBL066C (SEF1) - putative transcription factor
           [contig 33] FULL
          Length = 1046

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
           K  S+E++A  +P   R   +C +CR  K+KC+    DN  A PC+RC+R    C
Sbjct: 79  KNGSAESKAVSVPTGHRPVTSCTHCRQHKIKCNAN--DNFPA-PCSRCERMGLHC 130

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 6/71 (8%)

Query: 2   SPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
           SP++   + + +    ++R  +AC +CR RK+KCD  PVD P    C+ C +    C F 
Sbjct: 120 SPQQEKIQQDTYY--SKKRATRACESCRKRKIKCD--PVD-PITNKCSNCTKFHMICVFD 174

Query: 62  S-TRGETNGTS 71
           +  R  TN  +
Sbjct: 175 NRKRKATNANT 185

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST---RGETNGTS 71
           KR +  +AC  CR +K+KCD   + N     C  C+R  + CSF      RG T G S
Sbjct: 47  KRTKASRACDQCRRKKIKCDYNDMRN----ICTNCQRIGERCSFERVPLKRGPTKGYS 100

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 7/61 (11%)

Query: 12 AHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST---RGETN 68
          +H + KR +  +AC  CR +K+KCD           C+ C+R    CSF      RG + 
Sbjct: 34 SHAMKKRTKASRACDQCRKKKIKCDY----KDERGVCSNCQRNGDRCSFERVPLKRGPSK 89

Query: 69 G 69
          G
Sbjct: 90 G 90

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 13/83 (15%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMITA 77
           R +  +AC NCR RK+KC+ G        PCA C+    +C+FS+ +G         I  
Sbjct: 39  RSKVSKACDNCRKRKIKCN-GKF------PCASCEIYSCECTFSTRQGGAR------IKN 85

Query: 78  ASKTFLSKSEQQIRNRSTSPITA 100
             KT L  +  Q++  + S  T+
Sbjct: 86  LHKTSLEGTTVQVKEETDSSSTS 108

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 7/48 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRG 65
          R +  +AC NCR RK+KC+ G        PCA C+    +C+F+S +G
Sbjct: 36 RSKVSKACDNCRKRKIKCN-GKF------PCASCEIYSCECTFTSRQG 76

>TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584
          aa] {ON} 
          Length = 584

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 16 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          P++R ++  C  C+ RK+KCD G       P C  C R  K C +
Sbjct: 8  PRKRYSHNGCKECKRRKIKCDEG------KPVCWHCDRLEKSCQY 46

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON}
          similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 809

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          K +R   AC NC S K KC    ++N +  PC RC +  + C F
Sbjct: 56 KPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMKCNRTCKF 99

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 6/64 (9%)

Query: 1  MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          M P ++  E    ++ KR R    C+ CR RK+KCD         P C +C  +   C +
Sbjct: 1  MDPLKKPMEYSVGKVQKRNRLSFVCLECRRRKIKCD------KQRPCCIQCAEQGLTCVY 54

Query: 61 SSTR 64
             R
Sbjct: 55 DIER 58

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPN 73
          K+ R  + C+ CR RKVKCD         P C RC +    C+++ +   ++ + P+
Sbjct: 7  KKPRPSKVCLTCRRRKVKCD------QQHPSCMRCIKSSTLCTYTYSTPVSDDSLPD 57

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 5/44 (11%)

Query: 18 RRRTYQACINCRSRKVKCD-LGPVDNPHAPPCARCKRELKDCSF 60
          +RR+ +AC +CR RK++CD + PV N     C+ C +   +C+F
Sbjct: 34 KRRSTKACDHCRKRKIRCDEVNPVTN----KCSNCVKFKVECTF 73

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          R+R  +AC +CR RK+KC  GPV NP    C  C +    C+F
Sbjct: 22 RKRVPKACDHCRKRKIKC--GPV-NPITGTCENCNKFNTSCTF 61

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
          similar to uniprot|P35995 Saccharomyces cerevisiae
          YKL222C Hypothetical ORF and similar to uniprot|Q12340
          Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 7/53 (13%)

Query: 9  ENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDCSF 60
          +++A  + KRR+  ++C+ CR RK+KCD         P C+ C  R L +C +
Sbjct: 3  DSQASVIRKRRKVIKSCLFCRKRKLKCD------HKKPKCSTCAARNLPECVY 49

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON}
          YKL038W (REAL)
          Length = 1169

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query: 12 AHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST---RGETN 68
           H + KR +  +AC  CR +K+KCD           C  C+R    CSF      RG + 
Sbjct: 34 GHAMKKRTKASRACDQCRKKKIKCDY----KDERGVCTNCQRNGDRCSFERVPLKRGPSK 89

Query: 69 G 69
          G
Sbjct: 90 G 90

>TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.61
          YOR172W
          Length = 878

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 13/83 (15%)

Query: 7  SSENEAHELP----KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDCSF- 60
          SS+N  +E P    KRR   + C  CR RK+KCD         P C+ C  R L +C + 
Sbjct: 4  SSDNIGNENPPLKKKRRTIIKTCTFCRKRKLKCD------KRKPRCSSCVTRNLPECVYI 57

Query: 61 -SSTRGETNGTSPNMITAASKTF 82
            +  G T+  +P+  T  +K +
Sbjct: 58 DGTGSGATSPDTPSSSTGNAKNY 80

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 7  SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST--- 63
          S+   +H + KR +  +AC  CR +K+KCD           C+ C+R    CSF      
Sbjct: 29 SAAAASHAIKKRTKASRACDQCRKKKIKCDY----KDEKGLCSNCQRNGDRCSFERVPLK 84

Query: 64 RGETNG 69
          RG + G
Sbjct: 85 RGPSKG 90

>Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106W
          (REAL)
          Length = 867

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 8/45 (17%)

Query: 17 KRRRTYQACINCRSRKVKCD-LGPVDNPHAPPCARCKRELKDCSF 60
          +R R    CI C+SRK+KCD L PV       C RC++  K C++
Sbjct: 8  RRPRPSFVCIPCKSRKLKCDRLRPV-------CTRCRKTSKQCTY 45

>Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          R +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 14 RAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa]
          {ON} similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 856

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 6/36 (16%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 53
          R +T+  C  CRSRKVKCDL        P C RC++
Sbjct: 7  RVKTFTGCWTCRSRKVKCDL------RRPGCERCEK 36

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
          extends into a gap in the genome sequence
          Length = 729

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 7/69 (10%)

Query: 1  MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKDCS 59
          M  KR +++    +  K+R+  + C  CR RKV+CD G       P C+ CK R   +C 
Sbjct: 1  MDGKRSATDPATQDTRKKRKHIRTCTFCRQRKVRCDQG------RPLCSSCKARGFSECI 54

Query: 60 FSSTRGETN 68
          +      TN
Sbjct: 55 YLEDADITN 63

>NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETN 68
           ++R  +AC +CR RK+KCD   VD P    C+ C +   +C+F   RG  N
Sbjct: 99  KKRVSKACDHCRKRKIKCD--KVD-PSTGKCSNCLKYNANCTFK--RGRDN 144

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++RR  +AC  CR RK+KCD   + N     C+ C +   +C+F
Sbjct: 115 QKRRVARACDRCRKRKIKCD--EIKNLKVNKCSNCVKYGAECTF 156

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTR 64
          R++  +AC+NCR RK+KC           PC+ C     +C F  T+
Sbjct: 10 RKKVVKACLNCRRRKIKCT-------GTFPCSNCAAYQCECVFDETK 49

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 9/57 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS--STRGETNGTS 71
          KRRR  +AC  CR +KVKCD          PC  C     +C++   + R + +G S
Sbjct: 13 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNSGNS 62

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 12/69 (17%)

Query: 6   RSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST-- 63
           RSS N+     +R +  +AC  CR +KVKCD G  D+     C  C+R  + C+F     
Sbjct: 49  RSSSNK-----RRTKASRACDQCRKKKVKCDNG--DDRSV--CTNCQRNGEKCTFERVPL 99

Query: 64  -RGETNGTS 71
            RG + G S
Sbjct: 100 KRGPSKGYS 108

>Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 6/41 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          R +T+  C  CR RKVKCDL    +PH   C RC++    C
Sbjct: 14 RAKTFTGCWTCRGRKVKCDLR---HPH---CQRCEKSNLPC 48

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 7/44 (15%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          R+R  +AC  CR++K+KCD          PC+ CK+  ++C ++
Sbjct: 7  RKRVSKACDACRAKKIKCD-------GCDPCSNCKKVSQECGYT 43

>Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}
          YLL054C (REAL)
          Length = 842

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 24 ACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSP 72
           C+ C+ RK+KCD         P C++CK     C++    G TN + P
Sbjct: 14 VCLRCKQRKIKCD------KLWPTCSKCKASSSACTYEIEPGRTNISPP 56

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 6/41 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          R +T+  C  CR RKVKCDL    +PH   C RC++    C
Sbjct: 14 RAKTFTGCWTCRGRKVKCDL---RHPH---CQRCEKSNLPC 48

>SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]
           {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
           AFR171Wp and some similarites with YDR034C
           uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 645

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 9/86 (10%)

Query: 15  LPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNM 74
           + KR+ +   C  C+ RKVKCD         P C +C    K+C +SS          N 
Sbjct: 11  IKKRKYSKLGCTECKRRKVKCD------ETKPMCWQCSHLGKNCVYSSPSTRITFCEANF 64

Query: 75  ITAASKTFLSKSEQQIRNRSTSPITA 100
               SK   +K E++++ +    I A
Sbjct: 65  SGVGSK---AKEERKVKKQIDKGIKA 87

>TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa]
          {ON} Anc_6.60 YLR266C
          Length = 699

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 15/66 (22%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPP-CARC-KRELKDC------SFSSTRGETN 68
          +RR+  ++C  CR RK+KCD       HA P C +C +R+L +C      +F  T  E  
Sbjct: 10 RRRKIVRSCTFCRRRKLKCD-------HAKPMCNQCLERKLPNCLYTDDFNFQLTTDELF 62

Query: 69 GTSPNM 74
            SPN+
Sbjct: 63 SDSPNV 68

>Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON}
          similar to Ashbya gossypii ACL195C
          Length = 114

 Score = 37.0 bits (84), Expect = 0.039,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 8  SENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          SE   H+  K ++  ++C+ CR  KVKCD   +  P   PC+ C ++   C  
Sbjct: 19 SEGYIHDTWKMKKPLRSCVRCRKNKVKCD-SAIRRPK--PCSSCLKKGVSCEL 68

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 7/55 (12%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTS 71
          KRRR  +AC  CR +KVKCD          PC  C     +C+++     +N ++
Sbjct: 12 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRSNTSA 59

>Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}
          YML099C (REAL)
          Length = 882

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          R +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 14 RAKTFTGCWTCRGRKVKCDL------RRPHCQRCEKSNLPC 48

>NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {ON} 
          Length = 757

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 20/120 (16%)

Query: 7   SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDCSFSST-- 63
           SS  +     +RR+  ++C  CR RK+KCD       + P C +C  R+   C ++ T  
Sbjct: 3   SSSTQNIGFKRRRKPIKSCAFCRGRKLKCD------KNKPICNQCLMRKHPTCIYTETFN 56

Query: 64  ----RGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPIT----ADMTLSGKETGNETSF 115
               + +  G  PN+   A    L K+ +++  R +  ++    AD   SGK T N   F
Sbjct: 57  IPIPQEQLYGKMPNIELLAKIQELEKTIEEMNKRISDQVSNLKAAD---SGKSTINTEVF 113

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 9/57 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS--STRGETNGTS 71
          KRRR  +AC  CR +KVKCD          PC  C     +C++   + R + +G S
Sbjct: 13 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNSGNS 62

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa]
          {ON} YGL013C (REAL)
          Length = 1069

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 7/48 (14%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRG 65
          R +  +AC NCR RK+KC+ G        PCA C+    +C+F++ +G
Sbjct: 36 RSKVSKACDNCRKRKIKCN-GKF------PCASCEIYSCECTFTTRQG 76

>Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 15/77 (19%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR--ELKDCSFSSTRGETNGTSPNM 74
          KR R    C NC+ RK KCD          PC  C R  ++  C + S R     T P +
Sbjct: 11 KRHRITVVCTNCKKRKSKCD-------RIKPCGTCVRLGDMDSCVYLSDRLGQRETGPTL 63

Query: 75 ITAASKTFLSKSEQQIR 91
                T +   E+QIR
Sbjct: 64 ------TGIDHLEKQIR 74

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON}
          Anc_1.277 YJL089W
          Length = 725

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 10/63 (15%)

Query: 10 NEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS---STRGE 66
          N + EL K R + QAC  CR +K+KCD         P C+ CK+   +C+ S   S RG 
Sbjct: 2  NTSSELSKFRVS-QACDRCRLKKIKCD------GQKPRCSNCKKINFNCAISTKLSRRGL 54

Query: 67 TNG 69
            G
Sbjct: 55 PKG 57

>Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON}
          YBL066C (REAL)
          Length = 1159

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 4  KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          +R S  +++H++    R   +C +CR  K+KCD    + PH  PC+RC++    C
Sbjct: 34 QRISHHDDSHQI--NHRPVTSCTHCRQHKIKCDAS-QNFPH--PCSRCQKIGLHC 83

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST---RGETNGTSPN 73
           KR +  +AC  CR +K+KCD     +     C+ C+R  + C+F      RG + G + N
Sbjct: 67  KRTKASRACDQCRKKKIKCDF----SEEKTLCSNCQRNGEKCTFERVPLKRGPSKGYTRN 122

Query: 74  MITAASKT 81
              +  +T
Sbjct: 123 HSKSTPQT 130

>SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON}
          conserved hypothetical protein
          Length = 750

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 9/53 (16%)

Query: 19 RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTS 71
          +R+   C+ CR RK KCD         P C  CKR L DC + +   E  GT+
Sbjct: 30 KRSKSGCLTCRKRKKKCDEA------RPRCTGCKRNLLDCVWVN---EAQGTA 73

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          +R T+ AC NC ++K KC    V + +  PC RC++  K C+F
Sbjct: 54 KRNTF-ACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>KLTH0F00990g Chr6 (77084..79441) [2358 bp, 785 aa] {ON} similar
          to uniprot|Q04411 Saccharomyces cerevisiae YDR520C
          Hypothetical ORF
          Length = 785

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 4/59 (6%)

Query: 8  SENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGE 66
          SE EA   P+++R   +C  CR  K +CD  P+       C RC      CS +  R E
Sbjct: 40 SETEAARKPRKKRKTYSCEVCRKFKTRCDFEPL----VGRCHRCSVLKIQCSLTKEREE 94

>YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}
          SEF1Putative transcription factor, has homolog in
          Kluyveromyces lactis
          Length = 1148

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 4  KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          +R S  +++H++    R   +C +CR  K+KCD    + PH  PC+RC++    C
Sbjct: 38 QRISHHDDSHQI--NHRPVTSCTHCRQHKIKCD-ASQNFPH--PCSRCEKIGLHC 87

>Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON}
          (88566..91013) [2448 nt, 816 aa]
          Length = 815

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 7/50 (14%)

Query: 24 ACINCRSRKVKCDLGPVDNPHAPPCARCKRELK-DCSFSSTRGETNGTSP 72
          AC+ CR RK+ CD G       P C  C +  K DC +    G    +SP
Sbjct: 14 ACVQCRRRKIGCDRG------KPICGNCAKSHKTDCFYPDVPGAYVTSSP 57

>TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.61
          YOR172W
          Length = 799

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 8/57 (14%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDCSFSSTRGETNGTSP 72
          KR +  ++C  CR RK+KCD       + P C+ C  R+ K+CS++ T   +  +SP
Sbjct: 19 KRNKLIKSCTFCRMRKLKCD------KNKPMCSTCVVRQRKECSYTYTTS-SRASSP 68

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 38/90 (42%), Gaps = 3/90 (3%)

Query: 8   SENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF---SSTR 64
           S+ E  E  K +R   AC+ C S K KC     ++ +  PC RC R  K C F     TR
Sbjct: 69  SKMETTENGKIKRNTFACVRCHSLKQKCVPSDTNDIYRRPCERCLRTGKLCKFDLSKRTR 128

Query: 65  GETNGTSPNMITAASKTFLSKSEQQIRNRS 94
                + P   ++   T LS  +    N S
Sbjct: 129 KRRLKSDPTSRSSTPLTLLSSGDTTALNAS 158

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
          (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          K+ R  + C+ C+ RK++CD         P C RCKR    C++
Sbjct: 7  KKPRPSRVCVQCKKRKLRCD------RQRPTCTRCKRSSTICTY 44

>NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa]
          {ON} 
          Length = 704

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST---RGETNG 69
          KR++  +AC  C  R++KCD     NP    C+ C++  + C F+     RG   G
Sbjct: 36 KRKKASRACDQCHHRRIKCDF----NPETRNCSGCEKTEEKCLFNRIPMKRGPAKG 87

>Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON}
          YBL066C (REAL)
          Length = 1150

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 4  KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          +R S  +++H++    R   +C +CR  K+KCD    + PH  PC+RC++    C
Sbjct: 42 QRISHHDDSHQI--NHRPVTSCTHCRQHKIKCDAS-QNFPH--PCSRCEKIGLHC 91

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 13/65 (20%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKDC------SFSSTRGETNG 69
           KRR+  ++C  CR RK+KCD         P C  CK R L +C      +F  +  +   
Sbjct: 82  KRRKVIKSCTFCRKRKLKCD------RKRPMCTGCKMRGLSECVYTDGYNFDISHDDVYN 135

Query: 70  TSPNM 74
            SPN+
Sbjct: 136 KSPNL 140

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
             ++   C+NC+ R+VKCD G       P C +C     DC +
Sbjct: 196 HNKSKNGCVNCKRRRVKCDEG------KPTCKKCLNMKLDCVY 232

>KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserved
           hypothetical protein
          Length = 1004

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 8/56 (14%)

Query: 7   SSENEAHELPKRRRTY--QACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           SS  E     KR+ TY  + C+ C+    KCD         P C+RC++   DC++
Sbjct: 51  SSSEEKLSTKKRKSTYSRKGCLQCKKAHTKCD------ERKPKCSRCEKRSIDCTY 100

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
          274] FULL
          Length = 628

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 9/83 (10%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
          K+ R    C  CR RK+KC      N   P C+RC +    C ++  R E +   P+ I 
Sbjct: 7  KKNRISHVCDACRIRKLKC------NKQKPSCSRCVKHDLQCVYTPYRREGD---PSAIE 57

Query: 77 AASKTFLSKSEQQIRNRSTSPIT 99
          +  K  L   +Q     S++ ++
Sbjct: 58 SLQKELLHLKQQLASAHSSNSLS 80

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 40/85 (47%), Gaps = 3/85 (3%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMITA 77
           ++R  +AC +CR RK+KCD      P    C+ C +   +C+F            ++++ 
Sbjct: 132 KKRVSKACDHCRKRKIKCD---DVKPRTGKCSNCTKFNAECTFDHHNAMEKKRKAHLMST 188

Query: 78  ASKTFLSKSEQQIRNRSTSPITADM 102
           A+        ++++ ++  P+  D+
Sbjct: 189 AAAATADAQTKRVKQQTFQPLHKDI 213

>ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 1035

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 8   SENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++ E  E  K +R   ACI+C S K KC     ++ +  PC RC +  K C F
Sbjct: 91  TQMETSEGGKLKRNSFACISCHSLKQKCVPSDFNDIYRKPCIRCLKNGKLCRF 143

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 19/78 (24%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTR---------GETN 68
          R R  +AC  C+ RKVKCD        + PCA C +  ++C + S           G ++
Sbjct: 10 RLRVRKACEICKRRKVKCD-------GSQPCANCVKHGQECKYISGTVRRRYRRDIGNSS 62

Query: 69 GTS---PNMITAASKTFL 83
          G S   P+ +T +S T L
Sbjct: 63 GASILIPSRLTPSSSTAL 80

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON}
          Anc_2.565 YMR019W
          Length = 707

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
          +R R  +AC  C+ RKVKCD          PC+ C R   DC++   R   +   P  IT
Sbjct: 8  QRLRVQKACDICKRRKVKCD-------GLSPCSNCIRHNVDCTY-DYRTFASRKKPRFIT 59

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          KRRR  +AC  CR +KVKCD          PC  C     +C++
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 43

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          ++ R    C+ CRS+KVKCD         P C RC++  K C +
Sbjct: 7  RKARPSFVCLVCRSKKVKCDKA------RPSCGRCRKTNKLCVY 44

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 38.9 bits (89), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++RR  +AC  CR RK KCD     +P+   C+ C +   DC F
Sbjct: 170 EKRRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIF 210

>TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa]
          {ON} 
          Length = 633

 Score = 38.5 bits (88), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 7/39 (17%)

Query: 23 QACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDCSF 60
          Q C+NC+ + VKCD         P C+RC  R +K C +
Sbjct: 10 QGCLNCKKKHVKCD------EKKPKCSRCLSRNIKHCKY 42

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          KRRR  +AC  CR +KVKCD          PC  C     +C++
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 43

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 38.9 bits (89), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++R  +AC +CR RK+KCD     +P+   C+ C +   +C+F
Sbjct: 246 KKRVSRACDHCRKRKIKCD--EKRDPNTNKCSNCIKYNSECTF 286

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1020

 Score = 38.9 bits (89), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 14 ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST---RGETNG 69
          E  KR +  +AC  CR +K+KCD+   DN   P C+ C +    C+F      RG + G
Sbjct: 25 ETKKRSKVSRACDQCRKKKIKCDVSE-DN---PVCSGCFKVGDRCTFERVPLKRGPSKG 79

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 1148

 Score = 38.9 bits (89), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 16 PKRRRTYQACINCRSRKVKC-DLGPVDNPHAPPCARCKRELKDCSF 60
          P ++R  +AC  CR RK+KC DL PV    +  C+ C +    C+F
Sbjct: 25 PAKKRVSKACDRCRRRKIKCDDLDPV----SGKCSNCIKYKVPCTF 66

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {ON} 
          Length = 847

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 44/107 (41%), Gaps = 19/107 (17%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF-------SSTRGETNG 69
           ++ R    C+ CR++K+KCD         P C RC +  + C +       S        
Sbjct: 7   RKIRPSYVCVTCRTQKLKCD------KQRPSCGRCLKNKRKCVYEINSSLDSLHENSMRS 60

Query: 70  TSPNMITAASKTFLSKSEQQIRNRSTSPITADMTL-----SGKETGN 111
            S N I+ AS +  S +   I N  +SP    +TL      GK+  N
Sbjct: 61  HSNNQISPASSSGHSNA-TLIENSISSPEALTLTLDTSRIKGKQADN 106

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          KRRR  +AC  CR +KVKCD          PC  C     +C++
Sbjct: 6  KRRRVTRACDECRKKKVKCD-------GKQPCIHCTVYNYECTY 42

>NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON}
          Anc_2.565
          Length = 759

 Score = 38.5 bits (88), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 12/82 (14%)

Query: 5  RRSSENEAHELPKRR-RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--- 60
          R + +N + E  K+R R  +AC  C+ RKVKCD          PC  C ++  DC +   
Sbjct: 13 RNAMDNTSPERKKQRIRVQRACNICKRRKVKCD-------GNKPCLNCIKKEIDCEYNNS 65

Query: 61 -SSTRGETNGTSPNMITAASKT 81
           ++T+ E N    ++  A S T
Sbjct: 66 SNTTKKEPNDPPADIDAAESST 87

>KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa]
          {ON} similar to uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
          mediated Activation Ty1 enhancer activator and to
          YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
          CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain; DNA-binding transcriptional
          activator or CHA1
          Length = 652

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 7  SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          SSE+ +   P   +   AC NCR R+ KCD+G        PCA C +   DC
Sbjct: 16 SSEDFSSGSPLLSQKRLACSNCRRRRKKCDMG-------YPCASCVKMKLDC 60

>NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON}
           Anc_1.199
          Length = 875

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 39/104 (37%), Gaps = 20/104 (19%)

Query: 3   PKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKD---CS 59
           P   +S+N      KR R    C NC+ RK KCD G        PC+ C R L D   C 
Sbjct: 6   PTEYNSQNSK----KRNRPTVVCTNCKKRKSKCDRG-------RPCSTCAR-LGDGDRCI 53

Query: 60  FSSTRGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMT 103
           + S  G  +    N         L  S     NR   P + DM 
Sbjct: 54  YVSDTGSESPVPMNQFMPKRVKVLKPS-----NRHAFPRSPDMV 92

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 38.5 bits (88), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 33/72 (45%), Gaps = 17/72 (23%)

Query: 9  ENEA---HELPKR-----RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          EN+A   H  PKR      +  +AC NCR RK+KC           PC+ C+     C +
Sbjct: 4  ENKASVPHMPPKRVTKSSSKVSRACDNCRRRKIKCT-------GKQPCSNCQAYQCHCEY 56

Query: 61 SSTRGETNGTSP 72
          S  RG  NG  P
Sbjct: 57 SIRRG--NGIIP 66

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 9/46 (19%)

Query: 14 ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCS 59
          + PKR+R   AC NCR R+ KCDL         PCA C R   +C+
Sbjct: 28 DYPKRKRL--ACSNCRRRRKKCDLN-------FPCANCIRLGLNCN 64

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 13 HELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          H    R +  +AC NCR RK+KC           PCA CK    +C FS
Sbjct: 5  HATRPRSKVSKACDNCRRRKIKCS-------GERPCAGCKTYNCECIFS 46

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {ON}
           weakly similar to uniprot|Q6B2M3 Saccharomyces
           cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
           transcription factor that activates genes involved in
           multidrug resistance paralog of Yrr1p acting on an
           overlapping set of target genes
          Length = 771

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 13/65 (20%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDC------SFSSTRGETNG 69
           +RR+  ++C  CR RK+KCD         P C  C +R+L +C      +F  T  E   
Sbjct: 60  RRRKVIKSCTFCRQRKMKCD------QQKPMCGSCVERKLSECIYTDGFNFQLTSDELFS 113

Query: 70  TSPNM 74
             PN+
Sbjct: 114 RQPNV 118

>TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {ON}
           Anc_4.344 YML076C
          Length = 806

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 8/79 (10%)

Query: 19  RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF------SSTRGETNGTSP 72
           +R   AC++C S K KC      + +  PC RC R  K C F         R      SP
Sbjct: 70  KRNSFACVSCHSLKQKCVPSDPHDIYRKPCERCLRNFKLCKFDLSKRTRKRRRRDTTDSP 129

Query: 73  NMITAASKTFLSKS--EQQ 89
             + +++K  LS S  EQQ
Sbjct: 130 VYMESSTKAQLSSSLPEQQ 148

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 7/44 (15%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           KRRR  +AC  CR +KVKCD          PC  C      CS+
Sbjct: 64  KRRRVTRACDECRKKKVKCD-------GQNPCIHCTVYSYKCSY 100

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          KRRR  +AC  CR +KVKCD          PC  C     +C++
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 65

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 8/50 (16%)

Query: 3  PKRRSSENEAHELPKR-RRTYQACINCRSRKVKCDLGPVDNPHAPPCARC 51
          P      +E  +L KR +R+  AC+ CR R VKC       P   PC++C
Sbjct: 25 PLLEDLHDEGGQLRKRQKRSSMACVRCRRRHVKC-------PGGNPCSKC 67

>Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {ON}
           YML076C (REAL)
          Length = 944

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 11  EAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           E  E  K +R   AC+ C S K KC+    ++ +  PC RC +  K C F
Sbjct: 61  ETTEKGKIKRNSFACVCCHSLKQKCEPSDANDIYRKPCRRCLKHRKLCKF 110

>Skud_4.795 Chr4 complement(1401165..1403492) [2328 bp, 775 aa] {ON}
           YDR520C (REAL)
          Length = 775

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 7   SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGE 66
           SS+++ ++ P+++R   +C  CR  K +CD      P    C RC     DCS +  + +
Sbjct: 57  SSKSDGNKKPRKKRKTFSCDTCRRVKTRCDF----EPFIGKCYRCNVLQLDCSLAKNKDD 112

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 6/51 (11%)

Query: 14 ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTR 64
          +L KR R    C NCR  K+KCD         P C RC ++   C +   R
Sbjct: 39 QLKKRNRISFVCQNCRKSKMKCD------REKPECTRCLKQGIKCVYDEER 83

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 15/90 (16%)

Query: 16  PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMI 75
           P ++R  +AC  CR RK+KCD     +     C+ C +   +C+FS+             
Sbjct: 94  PPKKRASKACDLCRRRKIKCD---AFDDRLKKCSNCIKYHSECTFSNQNKRKGD------ 144

Query: 76  TAASKTFLSKSEQQIRNRSTSPITADMTLS 105
                  + K+E+  R+RS + I + +  S
Sbjct: 145 ------LIEKAEESKRSRSKADIASALMQS 168

>KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conserved
           hypothetical protein
          Length = 946

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 88/253 (34%), Gaps = 60/253 (23%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           +R+R   +C+ C  RK+KC          P C++C +   DCS+      + G  P   T
Sbjct: 27  RRQRKILSCVPCHKRKIKC------TREQPSCSKCLKRNWDCSYFLNDRVSRGGQP---T 77

Query: 77  AASKTFLSKS-EQQIRNRSTSPITADMTLSGKETG-----NETSFKSEGVKWKFELSSMQ 130
           A ++T  S      I +    P      L   E       +E +      K K E    +
Sbjct: 78  AETRTEGSAQLPTNIVSGKHDPQKKKQLLMAIEKAKSMINDERNLLELNRKQKREYPRRK 137

Query: 131 NALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASA 190
            A E     +GTV   G     E   A+                      ++ G S ++ 
Sbjct: 138 QAWETDQPVSGTVTPSGGHNQHEYPVAS----------------------VTSGTSQSTP 175

Query: 191 TCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIEL 250
           T +P  + ++M  +            R +SG    P              L T++ A+EL
Sbjct: 176 TISPPMSYSSMQDSP-----------RPLSGENSLPMY------------LPTRQRAVEL 212

Query: 251 IEAFFLTMHPFFP 263
            E +  T+HP  P
Sbjct: 213 FEVYRNTVHPIIP 225

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 7/48 (14%)

Query: 16 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63
          PKR R  +AC  CR RKV+CD          PC  C     +C+++ T
Sbjct: 23 PKRLRVSRACDVCRQRKVRCD-------GRQPCIHCTVYSYNCTYNPT 63

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 8/51 (15%)

Query: 11 EAHELPKRRRTY-QACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          E  E+ KRRR   +AC NCR RK+KC           PC  C+     C F
Sbjct: 8  EQTEISKRRRKVNRACDNCRKRKIKCS-------ETTPCTNCQIYQCKCVF 51

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 7/45 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          KR +  +AC NCR RK+KC         A PC  C+    +C++S
Sbjct: 11 KRSKVSRACNNCRRRKIKCT-------GAQPCLNCQTYRCECTYS 48

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 13/104 (12%)

Query: 11  EAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST----RGE 66
           ++ +LP R+R  +AC  CR++K+KC+          PC+ C +   +C+++      R  
Sbjct: 14  KSMQLP-RKRVSKACDTCRAKKIKCN-------GEEPCSNCGKHDLECAYTHVIKRRRPV 65

Query: 67  TNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETG 110
               S   +     + L + E Q+  R +S + A     GKE G
Sbjct: 66  PTRISNRKLLGDLSSRLQRLE-QLLERVSSKLGAGAGRQGKECG 108

>KNAG0M01560 Chr13 (276011..278863) [2853 bp, 950 aa] {ON}
          Anc_5.322 YHR056C
          Length = 950

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELK-DCSFSSTRG 65
          KR +   ACI CR RK+ CD         P C  C++  K +CSF S  G
Sbjct: 7  KRAKRPPACIQCRKRKIGCDRV------KPICGNCRKGNKPNCSFPSDSG 50

>TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.60
           YLR266C
          Length = 793

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHA-PPCARC-KRELKDCSFSSTRGETNGTSPNM 74
           K+R+  ++C  CR RK+KCD       H+ P C +C  R+L  C +         +S  +
Sbjct: 43  KKRKIPKSCYFCRKRKLKCD-------HSRPTCNQCSSRQLTGCVYMEAYNYNVTSSELL 95

Query: 75  ITAASKTFLSK 85
           + A  +  L K
Sbjct: 96  VDAPHEILLKK 106

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 41/100 (41%), Gaps = 18/100 (18%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF-----------SSTRG 65
           KR+ +   C  C+ R++KCD G       P C +C R  ++C +            ST  
Sbjct: 141 KRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYVIRTKNRKRRPKSTDN 194

Query: 66  ETNGTSPNM-ITAASKTFLSKSEQQIRNRSTSPITADMTL 104
             + + P   +  + K  L ++   +     SP++   TL
Sbjct: 195 SKDTSKPGQRVQKSEKGILPRTNTVVEKAIASPVSLQATL 234

>KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.264
           YDR034C
          Length = 741

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 11/64 (17%)

Query: 2   SPKRRSSENEAH-----ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELK 56
           SP   S+    H      + KR+ +   C+ C+ R++KCD         P C +C R  +
Sbjct: 111 SPCNESNSESTHGSKNGHIVKRKYSRNGCVECKRRRMKCD------ETKPKCWQCDRLNR 164

Query: 57  DCSF 60
           DC +
Sbjct: 165 DCVY 168

>Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON}
          YBL066C (REAL)
          Length = 1155

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 4  KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          +R    +++H++    R   +C +CR  K+KCD    + PH  PC+RC++    C
Sbjct: 39 QRMPHHDDSHQI--NHRPVTSCTHCRQHKIKCD-ASQNFPH--PCSRCEKIGLHC 88

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON}
          conserved hypothetical protein
          Length = 639

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 6/50 (12%)

Query: 14 ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63
          E+ K  R+Y  C  C+S K KCD         P C  CK+    C +S T
Sbjct: 6  EMKKVARSYMGCQKCKSLKKKCD------EVKPHCGYCKKRGFQCDYSRT 49

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa]
          {ON} similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          K +R+  ACI+C S K KC+     + +  PC RC +  K C F
Sbjct: 56 KVKRSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKICQF 99

>KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa]
          {ON} conserved hypothetical protein
          Length = 701

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 7/58 (12%)

Query: 2  SPKRRSSENEAHEL-PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          SP   +  +  H L PKR R+   C  CR R+ KC     D  H P C  C + +  C
Sbjct: 9  SPDNPTKHDSGHALRPKRNRSRAGCFTCRLRRKKC-----DEVH-PKCGTCTKHVLKC 60

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++R  +AC +CR RK++CD   VD P    C+ C +    C+F
Sbjct: 126 KKRVSKACDHCRKRKIRCD--EVD-PQTNKCSNCVKFQSACTF 165

>CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa]
          {ON} similar to uniprot|P19541 Saccharomyces cerevisiae
          YPL133c
          Length = 462

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 8/40 (20%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KREL 55
          K+++ Y++CI CR   V CD       H  PC+RC KRE+
Sbjct: 8  KQKKLYKSCIFCRRSHVNCD-------HQRPCSRCIKREI 40

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 10/61 (16%)

Query: 5  RRSSENEAHELP---KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKDCSF 60
          + S E+ A   P   KRR T ++C  CR RK+KCD         P C+ C+ R   +C +
Sbjct: 12 KNSPESSAVNKPPRKKRRSTIKSCSFCRRRKLKCD------KSKPLCSTCRARNFTECIY 65

Query: 61 S 61
          S
Sbjct: 66 S 66

>SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]
           {ON} conserved hypothetical protein
          Length = 632

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 45/119 (37%), Gaps = 26/119 (21%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST--------RGETNG 69
           ++RT   C+ CR RK KCD         P C  C+R    C +           R E++ 
Sbjct: 5   KKRTITGCLTCRKRKKKCD------EVKPVCTGCQRNFLQCEWPDYSDGRIRRRRKESDN 58

Query: 70  TSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELSS 128
             P       K  L ++ +Q           D+  +  +   +   +   +KW+FEL +
Sbjct: 59  LKPE--QTPRKLLLERNSRQ----------PDLQFNITKCDCQEFVRYGRLKWQFELYT 105

>ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON}
          similar to uniprot|Q6B2M3 Saccharomyces cerevisiae
          YOR172W and similar to uniprot|Q06149 Saccharomyces
          cerevisiae YLR266C PDR8
          Length = 758

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 14/69 (20%)

Query: 14 ELPKRRR-TYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDC------SFSSTRG 65
          ++P+RRR   ++C  CR RK+KCD         P C +C  R+L +C      +F  T  
Sbjct: 7  KIPRRRRKAVKSCTFCRKRKLKCD------HRKPMCRQCLDRKLPNCVYTDDFNFPLTTD 60

Query: 66 ETNGTSPNM 74
          E    SPN+
Sbjct: 61 ELFSDSPNV 69

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 7/45 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          KRR+  +AC +CR +KVKCD          PC  C     +C+++
Sbjct: 12 KRRKVTRACDDCRKKKVKCDGN-------QPCIHCTVYSYECTYN 49

>Ecym_3384 Chr3 complement(728692..732132) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii ACR165W
          Length = 1146

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 12/89 (13%)

Query: 865 FVEQNNDITAALLNNELFQGPSLSEEVTDWFGAS----EDIGLEFVEPWTELIEQRYMQC 920
            VE+++   + LLN+ LF   +LS EV++  GAS    ED  ++ V    E  EQ++  C
Sbjct: 13  IVEEHDTFDSQLLNDLLFS--TLSSEVSNTSGASSGRQEDNEIDDVGRKQEADEQQF--C 68

Query: 921 GDGDNNNFENLYNLFVNTNDIDNETDSSR 949
           G  D    E L+N F+NT+ + +E   S 
Sbjct: 69  GGSD----EELFNAFINTDILPHEAGGSH 93

>Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON}
          YKL222C - Hypothetical ORF [contig 17] FULL
          Length = 735

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 7/45 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDCSF 60
          KRR++ + C+ CR RK+KCD       + P C  C  R L +C +
Sbjct: 28 KRRKSIKQCLFCRKRKLKCD------KNRPVCGTCASRGLTECVY 66

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 8/52 (15%)

Query: 11 EAHELPKRR-RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          + H++ K R +  QAC NCR RK+KC           PC+ C+    DC +S
Sbjct: 8  QEHKVTKPRIKVRQACDNCRKRKLKC-------TGKQPCSTCEAYSCDCIYS 52

>ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKR064W
          Length = 795

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 11/69 (15%)

Query: 15 LPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR--ELKDCSF---SSTRGETNG 69
          L KR+R    C NC+ RK +CD G       P C  C R    + C +    S +G   G
Sbjct: 4  LKKRQRQTLVCSNCKRRKSRCDRG------KPACGNCIRLGNRETCHYFISPSEKGGDGG 57

Query: 70 TSPNMITAA 78
           SP   T +
Sbjct: 58 DSPGESTGS 66

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 9/58 (15%)

Query: 15  LPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS---STRGETNG 69
           +P  RR  QAC  CR +K+KCD G +     P C  C++   +C  +   S RG   G
Sbjct: 91  IPTGRRHSQACDRCRLKKIKCD-GLI-----PHCTNCRKINFNCQTTHKLSRRGLPKG 142

>SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some
          similarities with uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 2  SPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC 51
          S  +   E+E     KR+RT   C NC+ RK+KCD         P C+ C
Sbjct: 5  SADKHFCESEHFPKKKRQRTTVVCTNCKKRKIKCDRK------RPACSNC 48

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          K++R   AC+ CR R +KC       P+  PC +C +    C +
Sbjct: 26 KQKRQQIACLECRKRHIKC-------PNGNPCFKCLKNNLKCEY 62

>ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conserved
           hypothetical protein
          Length = 680

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 9/84 (10%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRG-------ETNG 69
           K +R  +AC  CR  K +C L P+ N     C RC+     CSF    G       E  G
Sbjct: 25  KGKRAVRACDTCRRLKTRCILSPIPNEFY--CLRCESLKIHCSFQDMFGRPESKADEPEG 82

Query: 70  TSPNMITAASKTFLSKSEQQIRNR 93
           + P  +    K      + +I ++
Sbjct: 83  SDPETLKMLIKHGYGTKDAEITSK 106

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 11/63 (17%)

Query: 4  KRRSSENEAH-----ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDC 58
          KR+     AH     EL   +R+ QAC  CR +K+KCD         P C  CK+    C
Sbjct: 3  KRKYGSLSAHDGQTIELSNMKRSSQACDRCRLKKIKCD------GLRPSCTSCKKIGYQC 56

Query: 59 SFS 61
            S
Sbjct: 57 KTS 59

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++R  +AC +CR RK++CD   VD P    C+ C +    C+F
Sbjct: 129 KKRVSKACDHCRKRKIRCD--EVD-PQTDKCSNCVKFQSVCTF 168

>TBLA0G01090 Chr7 complement(275031..277499) [2469 bp, 822 aa]
          {ON} 
          Length = 822

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 8/61 (13%)

Query: 4  KRRSSENEAHELPKRRRTY--QACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          K   S+     LPK R  Y    C  C+   +KCD         P C+RCK     C + 
Sbjct: 3  KNNRSKKYLTNLPKNRAVYSRHGCFRCKKMHLKCDEA------KPVCSRCKNTQNLCQYQ 56

Query: 62 S 62
          S
Sbjct: 57 S 57

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 10/55 (18%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS---STRGETNG 69
          ++R  QAC  CRS+K+KCD          PC+ C +   +C  S   S RG   G
Sbjct: 22 KKRHSQACDRCRSKKIKCD-------GLQPCSNCAKIGYNCVTSDKLSRRGLPKG 69

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 7/44 (15%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          KRRR  +AC  CR +KVKC     D+ H  PC  C     +C++
Sbjct: 10 KRRRVTRACDECRKKKVKC-----DSRH--PCIHCTVYSYECTY 46

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 7   SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           +S N   +  KR+ +   C  C+ R++KCD G       P C +C R  ++C +
Sbjct: 131 ASSNSNGKTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVY 178

>Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 44]
           FULL
          Length = 676

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 55/155 (35%), Gaps = 37/155 (23%)

Query: 16  PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSS--------TRGET 67
           P ++R+   C+ CR R+ KCD         P C  C+     C++           RG  
Sbjct: 3   PPKKRSVTGCLTCRKRRKKCD------ERKPVCTGCESNFLQCTWPDYNGGRVRRKRGCA 56

Query: 68  NGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELS 127
           +   P ++  ++ TF     Q +   + S          +  G  T   + G    FE  
Sbjct: 57  SANQPPVLGTSALTF-----QVVEGPAPS----------RAVG--TPRTNGGAILPFECY 99

Query: 128 SMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPL 162
           S        A  A T      K+ IE +  TP PL
Sbjct: 100 STS------ASGALTKYDSAKKKFIESRGFTPDPL 128

>NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa]
          {ON} Anc_1.199
          Length = 995

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 7/37 (18%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 53
          KR R+   C NC+ RK KCD        + PC  CKR
Sbjct: 64 KRHRSTVVCTNCKKRKSKCD-------RSRPCGTCKR 93

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 10/73 (13%)

Query: 18  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF---SSTRGETNGTSPNM 74
           R R  +AC  C+ RKVKCD          PC  C +  K+C +   ++ R        + 
Sbjct: 80  RLRVQKACELCKKRKVKCDGN-------NPCLNCSKHQKECRYDFKATNRKRRRRQVASA 132

Query: 75  ITAASKTFLSKSE 87
           +   SKT+   SE
Sbjct: 133 VRDVSKTYAETSE 145

>YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON}
           Putative protein of unknown function with similarity to
           Pip2p, an oleate-specific transcriptional activator of
           peroxisome proliferation; YLL054C is not an essential
           gene
          Length = 843

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 40/94 (42%), Gaps = 19/94 (20%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76
           K+ +    C+ C+ RK+KCD         P C++CK     CS+    G  N  SP +  
Sbjct: 7   KKVKPSFVCLRCKQRKIKCD------KLWPTCSKCKASSSICSYEVEPGRINK-SPTIEN 59

Query: 77  AASKTFLSKSEQQIRNRSTSPITADMTLSGKETG 110
           A  +         IRN   +P  A M+ SG  T 
Sbjct: 60  APHR--------DIRN--ITP--ASMSASGSFTS 81

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
          Ashbya gossypii AER141C
          Length = 665

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          +RRT + C NC+  KVKC+          PC+RC R   +C F
Sbjct: 8  KRRT-KPCSNCKQNKVKCEYN-----EGLPCSRCTRNGLECYF 44

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 230 IEDFDYIGPDNLLTKEEAIELIEAF--FLTMHPFFPNIPLQLHDPKELAEYPILFCAILT 287
           + DF +   D++LTK++A EL+  F    + H F   I   LH        P+L  AI T
Sbjct: 148 VNDFRF---DHVLTKQQAQELLALFDKNCSNHLFHYTIG-DLHIDDLWVNSPLLLAAICT 203

Query: 288 VSARYH 293
           V++RYH
Sbjct: 204 VASRYH 209

>TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON} 
          Length = 722

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 12/105 (11%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKDCSFS-----STRGETNGT 70
           KRR+  ++C  CR RK++CD         P C+ C  R L +C +S     +   ET   
Sbjct: 5   KRRKAIKSCAFCRRRKLRCD------QKKPRCSTCVARNLAECVYSQGLQHNASTETREL 58

Query: 71  SPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSF 115
            P      S T  + + + +   S + +    TL  KE+G +  +
Sbjct: 59  VPLPGFGESTTTYNVTIEPLAGASRNQLDTFFTLQCKESGRKVYY 103

>NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}
          Anc_7.512
          Length = 906

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 2  SPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAP-PCARCKRELKDC 58
          SP   + +++     KR+R + AC+ CR +K KCD        AP PC +C+++   C
Sbjct: 24 SPANSTDQHQQDTNHKRKRKF-ACVECRQQKSKCDAY----EKAPDPCTKCQKKGVPC 76

>Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa]
          {ON} YLR266C (REAL)
          Length = 694

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 14/81 (17%)

Query: 1  MSPKRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKDCS 59
          M P  R S     +  KRR+  ++C  CR RK+KC      N   P C +C  R+L  C 
Sbjct: 1  MLPTTRESVTGGTK-GKRRKIIKSCAFCRKRKLKC------NQVRPMCQQCVLRKLPQCI 53

Query: 60 FSS------TRGETNGTSPNM 74
          ++       +  E  G  PN+
Sbjct: 54 YTEEFNYPLSNTELFGQMPNV 74

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 14  ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++ KR+ +   C  C+ R++KCD G       P C +C R  ++C +
Sbjct: 153 KISKRKYSRNGCTECKKRRMKCDEG------KPSCWQCTRLNRECVY 193

>TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 6/61 (9%)

Query: 6  RSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRG 65
          R  +N+ +    + R+   C++CR R+ KCD         P C  C R   +C +    G
Sbjct: 4  RKRQNQCYPFQTKGRSNTGCLSCRRRRKKCD------ERRPSCKACARNFLECIWPHRSG 57

Query: 66 E 66
          +
Sbjct: 58 K 58

>AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YDR303C
          (RSC3) and YHR056C (RSC30)
          Length = 809

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 29/72 (40%), Gaps = 7/72 (9%)

Query: 24 ACINCRSRKVKCDLGPVDNPHAPPCARCKRELK-DCSFSSTRGETNGTSPNMITAASKTF 82
          AC+ CR RK+ CD         P C  C R  K DC +    G    +     T   K+ 
Sbjct: 15 ACVQCRKRKIGCDRA------KPLCGNCVRNGKSDCFYPDIPGVYAQSGGGGATPPGKSA 68

Query: 83 LSKSEQQIRNRS 94
             S +QIR  S
Sbjct: 69 ELASVEQIREYS 80

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 20  RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSS 62
           ++   CINC+ R+VKCD G       P C +C      C + S
Sbjct: 92  KSKTGCINCKKRRVKCDEG------KPACKKCTNMSLSCVYIS 128

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
          (REAL)
          Length = 759

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 9/42 (21%)

Query: 12 AHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 53
           H    R+R   AC NCR+R+ KCDLG        PC  C R
Sbjct: 59 VHGSSTRKRL--ACTNCRNRRKKCDLG-------FPCGNCSR 91

>TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa]
          {ON} 
          Length = 767

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 13 HELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          ++ P  R +   CINC++  +KCD         P C+ C ++ K C++
Sbjct: 7  YKKPIARYSKHGCINCKTSHIKCD------EEKPQCSNCAKKSKACTY 48

>KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]
          {ON} conserved hypothetical protein
          Length = 661

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 9/53 (16%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS---STRGET 67
          RRRT + C NC+  KVKC         + PC RC R    C F+   S R ET
Sbjct: 7  RRRT-KPCTNCKKNKVKCLYQD-----SLPCERCARHQLQCHFAENNSLRNET 53

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
          MAL33MAL-activator protein, part of complex locus MAL3;
          nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 10/73 (13%)

Query: 24 ACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMITAASKTFL 83
          AC  CR R+VKCD          PC+RC     DC++     +  G+ P  I   S  ++
Sbjct: 7  ACDYCRVRRVKCD-------GKKPCSRCIEHNFDCTYQQPL-KKRGSKP--IGTRSLKYI 56

Query: 84 SKSEQQIRNRSTS 96
           K++  I N+S +
Sbjct: 57 PKAKMFIDNKSCT 69

>Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON}
          (44110..46518) [2409 nt, 803 aa]
          Length = 802

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 7/44 (15%)

Query: 10 NEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 53
          NE     KR R    C NC+ RK KCD G        PC+ C R
Sbjct: 4  NENKVRKKRHRITVVCTNCKKRKSKCDRG-------KPCSNCTR 40

>KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON}
          Anc_2.565 YMR019W
          Length = 608

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 19 RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETN 68
          RR   AC  C+ RK+KCD          PC+RC R  + C ++  + +T 
Sbjct: 7  RRVRAACAVCQRRKLKCD-------GKQPCSRCARTDRICRYAKVQVQTQ 49

>KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 7/47 (14%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKDCSFSS 62
          +RR+  + C+ CR RK+KCD         P C++C+ R L  C +++
Sbjct: 22 RRRKEVRNCLFCRKRKLKCDRA------KPKCSQCRNRNLPTCLYTN 62

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63
          ++R  +AC  CR  K KCD          PC RC  E K C++S++
Sbjct: 4  KKRVSKACDTCRKSKTKCD-------GERPCQRCLSENKICTYSNS 42

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 7/54 (12%)

Query: 18 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTS 71
          R++  +AC NCR RK+KC           PC+ C     +C F   + +++  S
Sbjct: 30 RKKVSKACANCRRRKIKC-------TGTYPCSNCAAYQCECIFDDLKEDSSNPS 76

>TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {ON}
           Anc_1.26 YDR520C
          Length = 822

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 7   SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTR 64
           S    + +  K+RRT+ +C  CR  K +CD  P+       C RC     +CS ++ R
Sbjct: 96  SGNENSRKFRKKRRTF-SCDTCRKFKTRCDFEPL----VGKCHRCNMLQINCSLTTER 148

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 5  RRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          +R S+N   +     ++   C NC+ R+VKCD G       P C +C     +C F+
Sbjct: 14 KRVSKNSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECVFT 64

>NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON}
          Anc_2.547
          Length = 924

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST---RGETNG 69
          KR +  +AC  C  R+++C+   V N     CA CKR  + C F+     RG   G
Sbjct: 43 KRSKVSRACDQCHKRRIRCNYNKVTN----MCAGCKRIGEHCLFTRIPLKRGPVKG 94

>Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to
          Ashbya gossypii AGL206C
          Length = 607

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          +R+RT   C++CR RK KCD         P C  C+R    C +
Sbjct: 3  QRKRTVTGCLSCRRRKKKCD------EQKPVCKGCQRNFIRCQW 40

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 3/34 (8%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCAR 50
           KR R   +C  CR RKVKCD      PH  PC++
Sbjct: 74  KRNRIPLSCTICRKRKVKCD---KTRPHCDPCSK 104

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 10/83 (12%)

Query: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--SSTRGETNGTSPNM 74
           KR+ +   C  C+ R++KCD         P C +C R  ++C +  +    + NG S   
Sbjct: 111 KRKYSRNGCAECKRRRMKCD------ETKPTCWQCSRLNRECVYVLNPKNKKRNGKSTEN 164

Query: 75  ITA--ASKTFLSKSEQQIRNRST 95
           I     S T ++ S+ ++RN  T
Sbjct: 165 IVEEHCSSTVVTPSKIELRNTYT 187

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 6/48 (12%)

Query: 17 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTR 64
          KR R    C  CR  KVKCD         P C+RC +   +C +  T+
Sbjct: 32 KRYRLSFVCQGCRRSKVKCD------QEKPVCSRCSKHDLECVYDVTK 73

>YDR520C Chr4 complement(1481085..1483403) [2319 bp, 772 aa] {ON}
           URC2Putative Zn(II)2Cys6 motif containing transcription
           factor; non-essential gene identified in a screen for
           mutants with increased levels of rDNA transcription;
           similar to S. kluyveri Urc2p involved in uracil
           catabolism
          Length = 772

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 7   SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTR 64
           S +N  ++ P+++R   +C  CR  K +CD  P        C RC     DCS +  +
Sbjct: 54  SPKNNGNKKPRKKRKTFSCDTCRRVKTRCDFEPF----IGKCYRCNVLQLDCSLARNK 107

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa]
          {ON}
          Length = 812

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 24 ACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETN 68
          AC+ C   K KC    + + +  PC++CKR    C F  T+ + N
Sbjct: 48 ACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVFDLTKRKRN 92

>YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}
          YRM1Zn2-Cys6 zinc-finger transcription factor that
          activates genes involved in multidrug resistance;
          paralog of Yrr1p, acting on an overlapping set of
          target genes
          Length = 786

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 13/74 (17%)

Query: 8  SENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKDCSFSST--- 63
          SE    +  KRR+  ++C  CR RK++CD         P C+ CK R    C ++     
Sbjct: 14 SEETVKKAQKRRKPIKSCAFCRKRKLRCD------QQKPMCSTCKTRGRSGCLYTEKFTH 67

Query: 64 ---RGETNGTSPNM 74
               E  G++PN+
Sbjct: 68 KIETKELFGSTPNI 81

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 10/57 (17%)

Query: 16 PKRRRTYQACINCRSRKVKCD------LGPVDNPHAPPCARCKRELKDCSF-SSTRG 65
          PKR+   +AC+ CR +K+KCD      LG  D P    C+ C      C F +S RG
Sbjct: 10 PKRKVARRACLTCREKKIKCDGEVRASLGGSD-PGI--CSNCAASGSKCVFVASMRG 63

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
          YJL206C (REAL)
          Length = 833

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 16 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          P R R ++AC+ CR RKV+C           PC  C+    +C +
Sbjct: 25 PTRGRAHRACVACRKRKVRCS-------GQTPCRLCQNNSFECKY 62

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
          Anc_4.344 YML076C
          Length = 936

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%)

Query: 5  RRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          R  ++ E  +  K +R   AC+ C S K KC     ++ +  PC RC R+   C F
Sbjct: 34 REPTKLETKKDGKTKRHAFACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKF 89

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
          YOR363C
          Length = 1232

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 2  SPKRRSSENEAHELPKRR-RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
          S  R +++ + H + K+R R    C +CR  K KCD         P CARC +    C +
Sbjct: 28 SEPRYTNDEKLHRIRKKRNRISFVCQHCRKSKTKCD------KKQPHCARCIKHGIQCVY 81

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
          similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 6/55 (10%)

Query: 7  SSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFS 61
          S E    EL   +R+ QAC  CR +K+KCD         P C  CK+    C  S
Sbjct: 12 SHEERTIELSSVKRSSQACDRCRLKKIKCD------GVRPSCTSCKKIGYQCRTS 60

>Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {ON}
           YKR064W - Hypothetical ORF [contig 108] FULL
          Length = 797

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 37/95 (38%), Gaps = 22/95 (23%)

Query: 17  KRRRTYQACINCRSRKVKCD-LGPVDNPHAPPCARCKR--ELKDCSFSSTRGE--TNGTS 71
           KRRR    C NC+ RK KCD L P+       C  C R  +   C +    G       S
Sbjct: 15  KRRRPTVVCTNCKRRKSKCDRLKPI-------CGNCSRLGDQATCVYGPELGNKPVKSES 67

Query: 72  PNMITAASKTFLSKSEQQIRNRSTSPITADMTLSG 106
           P +I+   +T           RS  P   D+T  G
Sbjct: 68  PRLISHYFETV----------RSNQPTIIDLTPGG 92

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 14  ELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF 60
           ++ KR+ +   C+ C+ R++KCD G       P C +C R  + C +
Sbjct: 144 KIVKRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVY 184

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 7/78 (8%)

Query: 5   RRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST- 63
           R SS   A      ++  +AC  CR RK+KCD     N     C+ C R    C F+   
Sbjct: 55  RSSSTGSAKGSIGGKKATRACDQCRKRKIKCDYDNDKN----VCSSCNRNGDRCQFNRVQ 110

Query: 64  --RGETNGTSPNMITAAS 79
             RG + G + N  T+++
Sbjct: 111 LKRGPSKGFNRNNSTSSA 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 106,332,325
Number of extensions: 4999663
Number of successful extensions: 19196
Number of sequences better than 10.0: 629
Number of HSP's gapped: 19647
Number of HSP's successfully gapped: 642
Length of query: 954
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 835
Effective length of database: 39,836,145
Effective search space: 33263181075
Effective search space used: 33263181075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)