Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6945.524ON1504148965370.0
YDR420W (HKR1)5.524ON180294922000.0
Smik_4.6955.524ON1555128921720.0
Suva_2.5975.524ON179795221020.0
SAKL0G04862g5.524ON24442483834e-36
KAFR0E033205.524ON11902863672e-34
TDEL0A038805.524ON16962183532e-32
Ecym_40605.524ON22012523495e-32
KLLA0A01826g5.524ON14642293422e-31
KNAG0C032605.524ON15302703414e-31
Kpol_363.145.524ON7612243365e-31
KLTH0G03696g5.524ON20852273137e-28
TPHA0L003605.524ON11613052796e-24
ADR200C5.524ON23382202681e-22
CAGL0F03003g5.524ON1185952546e-21
ZYRO0D12496g5.524ON23851092441e-19
Kwal_47.186505.524ON2159842233e-17
SAKL0H23188g4.150ON1262972091e-15
NDAI0K025804.150ON9851002043e-15
ZYRO0G11242g4.150ON1487901963e-14
YGR014W (MSB2)4.150ON1306941921e-13
KLLA0C17985g4.150ON908891911e-13
NCAS0A052304.150ON785861873e-13
TBLA0G009505.524ON22531261858e-13
Kwal_47.177034.150ON1568911785e-12
KLTH0E08844g4.150ON1520871776e-12
Skud_7.2994.150ON1169891767e-12
Suva_7.2964.150ON1135891768e-12
KAFR0F034704.150ON949901722e-11
KNAG0D035904.150ON994841695e-11
TPHA0K013904.150ON826831686e-11
TBLA0G012104.150ON1825751696e-11
Ecym_73494.150ON1129991678e-11
TDEL0D030104.150ON1123681679e-11
Smik_7.3024.150ON11891181679e-11
AGR019C4.150ON1105921661e-10
Kpol_1062.374.150ON973821427e-08
CAGL0F08833g4.150ON936871363e-07
Smik_12.855.198ON25061790.94
Ecym_53253.123ON33665763.3
YOR035C (SHE4)5.627ON789116763.7
Ecym_53103.192ON23080744.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.694
         (1504 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...  2522   0.0  
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   852   0.0  
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   841   0.0  
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   814   0.0  
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   152   4e-36
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   145   2e-34
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   140   2e-32
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   139   5e-32
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   136   2e-31
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   135   4e-31
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...   134   5e-31
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   125   7e-28
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...   112   6e-24
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   107   1e-22
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   102   6e-21
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...    99   1e-19
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...    91   3e-17
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...    85   1e-15
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    83   3e-15
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    80   3e-14
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    79   1e-13
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    78   1e-13
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    77   3e-13
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    76   8e-13
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...    73   5e-12
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    73   6e-12
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    72   7e-12
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    72   8e-12
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    71   2e-11
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...    70   5e-11
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    69   6e-11
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    70   6e-11
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    69   8e-11
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...    69   9e-11
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    69   9e-11
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    69   1e-10
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    59   7e-08
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    57   3e-07
Smik_12.85 Chr12 complement(170982..171734) [753 bp, 250 aa] {ON...    35   0.94 
Ecym_5325 Chr5 complement(662187..663197) [1011 bp, 336 aa] {ON}...    34   3.3  
YOR035C Chr15 complement(397735..400104) [2370 bp, 789 aa] {ON} ...    34   3.7  
Ecym_5310 Chr5 (630371..631063) [693 bp, 230 aa] {ON} similar to...    33   4.4  

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score = 2522 bits (6537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1302/1489 (87%), Positives = 1302/1489 (87%)

Query: 16   VNTIEAYSNDTTYPSLYSRRTDIAPSYSTSAIYNTVSNSDDSALRSSPETTALAGQYSDS 75
            VNTIEAYSNDTTYPSLYSRRTDIAPSYSTSAIYNTVSNSDDSALRSSPETTALAGQYSDS
Sbjct: 16   VNTIEAYSNDTTYPSLYSRRTDIAPSYSTSAIYNTVSNSDDSALRSSPETTALAGQYSDS 75

Query: 76   GRVSINERKSTDASNEHTTTTATARNSDSMLTMGKLTEXXXXXXXXXXXXXQFYNERSSA 135
            GRVSINERKSTDASNEHTTTTATARNSDSMLTMGKLTE             QFYNERSSA
Sbjct: 76   GRVSINERKSTDASNEHTTTTATARNSDSMLTMGKLTEMVTPSSSMVPSSVQFYNERSSA 135

Query: 136  LQTSNDNSKSGSRSKDATIPFESSNGMKKSTSDGTAVPRGIXXXXXXXPSLSKDESRPPE 195
            LQTSNDNSKSGSRSKDATIPFESSNGMKKSTSDGTAVPRGI       PSLSKDESRPPE
Sbjct: 136  LQTSNDNSKSGSRSKDATIPFESSNGMKKSTSDGTAVPRGITSTTTTTPSLSKDESRPPE 195

Query: 196  TSGVINIASTVHVASKVLQLFSATPITTTDGSNHEATGNHLISTKLSTASIEEYTIDESD 255
            TSGVINIASTVHVASKVLQLFSATPITTTDGSNHEATGNHLISTKLSTASIEEYTIDESD
Sbjct: 196  TSGVINIASTVHVASKVLQLFSATPITTTDGSNHEATGNHLISTKLSTASIEEYTIDESD 255

Query: 256  FSDYYGSSVNDYFAQELIVDLSSTPFTTKASSVTSQNPDVEYSKLATDLRVSSTSFAETA 315
            FSDYYGSSVNDYFAQELIVDLSSTPFTTKASSVTSQNPDVEYSKLATDLRVSSTSFAETA
Sbjct: 256  FSDYYGSSVNDYFAQELIVDLSSTPFTTKASSVTSQNPDVEYSKLATDLRVSSTSFAETA 315

Query: 316  SSKTVSSSYTHLSSTYASSPVLISSIYTSSPYGSALSPTTPALIXXXXXXXXXXXXXXXX 375
            SSKTVSSSYTHLSSTYASSPVLISSIYTSSPYGSALSPTTPALI                
Sbjct: 316  SSKTVSSSYTHLSSTYASSPVLISSIYTSSPYGSALSPTTPALISSTYTSSPSSPALISS 375

Query: 376  THTXXXXXXXXXXXXXXXXXXTYTSSPYGPVSISSTYTSSPYGPVSSPSRPGLMSSTYTS 435
            THT                  TYTSSPYGPVSISSTYTSSPYGPVSSPSRPGLMSSTYTS
Sbjct: 376  THTSSPYGFASSPSSPALISSTYTSSPYGPVSISSTYTSSPYGPVSSPSRPGLMSSTYTS 435

Query: 436  SKYGFXXXXXXXXXXXXTYTSSPYGPVSSPSRPGLMSSTYTSSKYGFASSPSSPALIXXX 495
            SKYGF            TYTSSPYGPVSSPSRPGLMSSTYTSSKYGFASSPSSPALI   
Sbjct: 436  SKYGFASSPSSPALISSTYTSSPYGPVSSPSRPGLMSSTYTSSKYGFASSPSSPALISFT 495

Query: 496  XXXXXXXXXXXXXXXXXXXXXHTSSPYVFASSITTPALSPSAYTSSPHVSAPSSTAPVIA 555
                                 HTSSPYVFASSITTPALSPSAYTSSPHVSAPSSTAPVIA
Sbjct: 496  HTSSSHGFASSPSSPALISSIHTSSPYVFASSITTPALSPSAYTSSPHVSAPSSTAPVIA 555

Query: 556  SSAYTSSLYGLAPEFSSKQFLSTSDGVTPVISVHIMSSGPTNSLQQNSMETQKSHPTSTG 615
            SSAYTSSLYGLAPEFSSKQFLSTSDGVTPVISVHIMSSGPTNSLQQNSMETQKSHPTSTG
Sbjct: 556  SSAYTSSLYGLAPEFSSKQFLSTSDGVTPVISVHIMSSGPTNSLQQNSMETQKSHPTSTG 615

Query: 616  SSLNSDAYSNTITVISIRFSSSNPAGTSAPISSTKINPSYADEPVESNTPQRQLLTSART 675
            SSLNSDAYSNTITVISIRFSSSNPAGTSAPISSTKINPSYADEPVESNTPQRQLLTSART
Sbjct: 616  SSLNSDAYSNTITVISIRFSSSNPAGTSAPISSTKINPSYADEPVESNTPQRQLLTSART 675

Query: 676  SYDVESQNIESSSTFTIKSNFPYVSSTETPDNEDISITHEKTTTVSSNVHVYSLSDLRSR 735
            SYDVESQNIESSSTFTIKSNFPYVSSTETPDNEDISITHEKTTTVSSNVHVYSLSDLRSR
Sbjct: 676  SYDVESQNIESSSTFTIKSNFPYVSSTETPDNEDISITHEKTTTVSSNVHVYSLSDLRSR 735

Query: 736  HSITEVXXXXXXXXXXXXXXXXXXXXXXXXISSIKYSKETELPSISISITEERLSSLKKT 795
            HSITEV                        ISSIKYSKETELPSISISITEERLSSLKKT
Sbjct: 736  HSITEVSSDIFDSSRSSGSYSTSFGNSFSTISSIKYSKETELPSISISITEERLSSLKKT 795

Query: 796  SQPNNLSEKSTTKRTLSSSQGTHTLSIPSGSMNSKVSSTDSFDKTSKMIIYSRLETPSLI 855
            SQPNNLSEKSTTKRTLSSSQGTHTLSIPSGSMNSKVSSTDSFDKTSKMIIYSRLETPSLI
Sbjct: 796  SQPNNLSEKSTTKRTLSSSQGTHTLSIPSGSMNSKVSSTDSFDKTSKMIIYSRLETPSLI 855

Query: 856  TERTHYIXXXXXXXXXXXXXTRASLGSVVTALQTQTITGSDSVIPVSFTHPTTPYTYSND 915
            TERTHYI             TRASLGSVVTALQTQTITGSDSVIPVSFTHPTTPYTYSND
Sbjct: 856  TERTHYISLSKSSESKSGPSTRASLGSVVTALQTQTITGSDSVIPVSFTHPTTPYTYSND 915

Query: 916  YAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975
            YAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE
Sbjct: 916  YAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975

Query: 976  FLVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGXXXXXXXXXXXX 1035
            FLVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSG            
Sbjct: 976  FLVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGTSTTTLSPKSVS 1035

Query: 1036 XXXXXXXXXXGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTE 1095
                      GEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTE
Sbjct: 1036 SLSIVKKKKKGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTE 1095

Query: 1096 AISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGLTVYGAEDGSYISGLSSSVAD 1155
            AISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGLTVYGAEDGSYISGLSSSVAD
Sbjct: 1096 AISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGLTVYGAEDGSYISGLSSSVAD 1155

Query: 1156 SSKENPAGKVGTSKYGALDDFINSLTDYSPAGCYXXXXXXXXXXXXXXXXXXXXXXXXXF 1215
            SSKENPAGKVGTSKYGALDDFINSLTDYSPAGCY                         F
Sbjct: 1156 SSKENPAGKVGTSKYGALDDFINSLTDYSPAGCYALRIIVILIILTAAVLLWLLLVFLAF 1215

Query: 1216 XXXXXXXXXXXXXCIEKSFGNESKLQNVAISRSSSDNQTYNEKTSKTENKSIHSIVGDHY 1275
                         CIEKSFGNESKLQNVAISRSSSDNQTYNEKTSKTENKSIHSIVGDHY
Sbjct: 1216 RYRNELLRRRPRNCIEKSFGNESKLQNVAISRSSSDNQTYNEKTSKTENKSIHSIVGDHY 1275

Query: 1276 IVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRECVYDKDQD 1335
            IVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRECVYDKDQD
Sbjct: 1276 IVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRECVYDKDQD 1335

Query: 1336 TTEAYLNDGESVSSILDVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKIQLH 1395
            TTEAYLNDGESVSSILDVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKIQLH
Sbjct: 1336 TTEAYLNDGESVSSILDVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKIQLH 1395

Query: 1396 GLGTRSCTTDDPDTVNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKFHTLHHAESSLQEPN 1455
            GLGTRSCTTDDPDTVNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKFHTLHHAESSLQEPN
Sbjct: 1396 GLGTRSCTTDDPDTVNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKFHTLHHAESSLQEPN 1455

Query: 1456 QAFFSAAEELKIDDIDDNGSVSDVQVEELDALDEELYKRMSKVVKQQNQ 1504
            QAFFSAAEELKIDDIDDNGSVSDVQVEELDALDEELYKRMSKVVKQQNQ
Sbjct: 1456 QAFFSAAEELKIDDIDDNGSVSDVQVEELDALDEELYKRMSKVVKQQNQ 1504

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/949 (53%), Positives = 622/949 (65%), Gaps = 14/949 (1%)

Query: 559  YTSSLYGLAPEFSSKQFLSTSDGVTPVISVHIMSSGPTNSLQQNSMETQK--SHPTSTGS 616
            Y SS Y    EFSS+++ ST+  + P   +H   S  T+ L Q SM  Q   S   ST S
Sbjct: 860  YFSSAYAF--EFSSERY-STTSTIAPT-QIHSTLSRITDFLLQTSMAIQSIVSQQISTSS 915

Query: 617  SLNSDAYSNTITVISIRFSSSNPAGTSAPISSTKINPSYADEPVESNTPQRQLLTSARTS 676
            +LN + +S+ ++V +   S+SN   TS  ISST+ + +      + ++ Q QL +S +  
Sbjct: 916  TLNDEIHSSALSVFNP--SASNLVETSLIISSTQASITSPKNSAKISSLQSQLSSSTKNP 973

Query: 677  YDVESQNIESSSTFTIKSNFPYVSSTETPDNEDISITHEKTTTVSSNVHVYSLSDLRSRH 736
            YD  ++N E+S   T+ SNF Y SS   PDNE  S T  + TT+SS+ H YSLS   S +
Sbjct: 974  YDTANKNTETSGRSTVVSNFLYTSSAAKPDNEKFSATPTEITTISSSSHAYSLSIPSSHN 1033

Query: 737  SITEVXXXXXXXXXXXXXXXXXXXXXXXXISSIKYSKETELPSISISITEERLSSLKKTS 796
            S+T +                         SSIK SKET   S S+S T+ER++S   T 
Sbjct: 1034 SVTGLSHNFVDSSKSATSFGYSSSSI----SSIKLSKETIPASKSVSNTQERITSFTSTL 1089

Query: 797  QPNNLSEKSTTKRTLSSSQGTHTLSIPSGSMNSKVSSTDSFDKTSKMIIYSRLETPSLIT 856
            + N+ SEKS  + ++ S Q +H  S PS S N+KV S     K SK +  +  ET  L T
Sbjct: 1090 RANSQSEKSEGRNSVGSLQSSHISSNPSLSTNTKVDSKSLSRKVSKTMGENGEET-GLTT 1148

Query: 857  ERTHYIXXXXXXXXXXXXXTRASLGSVVTALQTQTITGSDSVIPVSFTHPTTPYTYSNDY 916
             +T Y              T+ S+G   TA+QTQ  T S    P   T+PTTPY   N Y
Sbjct: 1149 TKTQYKSSSETSGSYSRSFTKISIGPATTAVQTQASTNSVFTAPALSTYPTTPYPSPNSY 1208

Query: 917  AWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEF 976
            AWLPT IIVE S+TG +TA FNPSITGSLP+ IEPAVAVSEP NHTLIT+GFTA LNY F
Sbjct: 1209 AWLPTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALNYVF 1268

Query: 977  LVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGXXXXXXXXXXXXX 1036
            LVQNPLSSAQIFNFLPLVL YPFSNT  E+ +S   LS+F+LSY+SG             
Sbjct: 1269 LVQNPLSSAQIFNFLPLVLKYPFSNTSSELDNSIGELSTFILSYRSGSSTTTLSPKSISS 1328

Query: 1037 XXXXXXXXXGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEA 1096
                      +K+NAT ST DL+ P ++TSSI VK+IVPMV+SSKAY+++VAEVYFPTEA
Sbjct: 1329 LSVVKKKKNQQKKNATKSTEDLHPPQVDTSSIAVKKIVPMVDSSKAYIVSVAEVYFPTEA 1388

Query: 1097 ISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGLTVYGAEDGSYISGL-SSSVAD 1155
            ++YLQ+LILD +S +Y+NPQTPLR+LAGLIDS IPLGGLT+YG+ DG Y+  L SSSV D
Sbjct: 1389 VTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPLGGLTLYGSGDGGYVPSLTSSSVLD 1448

Query: 1156 SSKENPAGKVGTSKYGALDDFINSLTDYSPAGCYXXXXXXXXXXXXXXXXXXXXXXXXXF 1215
            SSK N     GT KYGALDDFINS TD + AG Y                         F
Sbjct: 1449 SSKGNSQNIDGTYKYGALDDFINSFTDSASAGKYAVKIIIFLIVLTIGVLLWLFVAFFAF 1508

Query: 1216 XXXXXXXXXXXXXCIEKSFGNESKLQNVAISRSSSDNQTYNEKTSKTENKSIHSIVGDHY 1275
                         CI KS  NE +L++  +SRSSS NQ YNEK  ++EN+S++S V DHY
Sbjct: 1509 RHRNILLKRHPRNCIGKSLNNERELESTELSRSSSGNQVYNEKPPESENESVYSAVDDHY 1568

Query: 1276 IVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRECVYDKDQD 1335
            IVTGENT+Y+T H LHYT+NDDGDL YR+A+P D +Q NG +   ID IVR+CVYDK+QD
Sbjct: 1569 IVTGENTVYNTIHRLHYTINDDGDLLYRDAIPLDFDQTNGDDGSGIDSIVRDCVYDKNQD 1628

Query: 1336 TTEAYLNDGESVSSILDVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKIQLH 1395
             TEA+LND ES+S ILDVDENG+IRL+DSYSD+ ESN +HL DEVI++YN +HL + +LH
Sbjct: 1629 ATEAFLNDEESISGILDVDENGDIRLYDSYSDNEESNSFHLPDEVIENYNKNHLCETKLH 1688

Query: 1396 GLGTRSCTTDDPDTVNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKFHTLHHAESSLQEPN 1455
            GLGT SCTTDDPDT N +TN FS+GSQT LPSTAYTTPLHTNSIK HTL + ESSL +PN
Sbjct: 1689 GLGTESCTTDDPDTGNQITNEFSTGSQTCLPSTAYTTPLHTNSIKLHTLRYTESSLPKPN 1748

Query: 1456 QAFFSAAEELKIDDIDDNGSVSDVQVEELDALDEELYKRMSKVVKQQNQ 1504
            Q  FS  E+L+I+DIDDNGSVSDV +EELDALDEELYKRMSKV+KQQN 
Sbjct: 1749 QTLFSNLEDLEIEDIDDNGSVSDVHIEELDALDEELYKRMSKVIKQQNH 1797

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 130/409 (31%), Positives = 164/409 (40%), Gaps = 125/409 (30%)

Query: 243 TASIEEYTIDESDFSDYYGSSVNDYFAQELIVDLSSTPFTTKASSVTSQNPDVEYSKLAT 302
           T SI+ +++ E + S YY  S  +Y  QELIVD  +T  T + SS  SQ    E +  A 
Sbjct: 317 TTSIDSFSMSEVELSTYYDLSAGNYPDQELIVDRPATSSTAETSSEASQGVSRESNTFAV 376

Query: 303 DLRVSSTSFAETASSKTVSSS-------YTHLSSTY------------------------ 331
              +S+T+F  +++S TV S+       Y+ + ST+                        
Sbjct: 377 S-SISTTNFIVSSASDTVVSTSSTNTVPYSSVHSTFVHATSSSTYISSSLYSSPSLSASV 435

Query: 332 ----------------ASSPVLISSIYTSSPYGSAL-------SPTTPALIXXXXXXXXX 368
                           +S PV +SS YTSSP  S +       SP+ P  +         
Sbjct: 436 SSHFGVAPFPSAYISFSSVPVAVSSTYTSSPSASVVVPSAYASSPSVPVAVSSTYTSSPS 495

Query: 369 XXXXXXXTHTXXXXXXXXXXXXXXXXXXTYTSSPYGPVSISSTYTSSPYGPV-------S 421
                  T+T                  TYTSSP  P +ISSTYTSSP  PV       S
Sbjct: 496 APAAISSTYT-------SSPSAPVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYTS 548

Query: 422 SPSRPGLMSSTYTSSKYG-------FXXXXXXXXXXXXTYTSSPYGPV-------SSPSR 467
           SPS P  +SSTYTSS          +            TYTSSP  PV       SSPS 
Sbjct: 549 SPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPVAISSTYTSSPSVPVAVSSTYTSSPSA 608

Query: 468 PGLMSSTYTSSKYG-------FASSPSSPALIXXXXXXXXXXXXXXXXXXXXXXXXHTSS 520
           P  +SSTYTSS          + SSPS+PA I                        +TSS
Sbjct: 609 PAAISSTYTSSPSAPVAVSSTYTSSPSAPAAI---------------------SSTYTSS 647

Query: 521 PYV-------FASSITTPALSPSAYTSSPHVSAPSSTAPVIASSAYTSS 562
           P V       + SS + PA   S YTSSP V       PV  SS YTSS
Sbjct: 648 PSVPVAVSSTYTSSPSAPAAISSTYTSSPSV-------PVAVSSTYTSS 689

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 127/233 (54%)

Query: 16  VNTIEAYSNDTTYPSLYSRRTDIAPSYSTSAIYNTVSNSDDSALRSSPETTALAGQYSDS 75
           +N IEAYSNDT Y + Y+   +  PSYSTSAI +T S++ ++A+ SS ETT +AGQY +S
Sbjct: 16  LNAIEAYSNDTIYSTSYNNGIESTPSYSTSAISSTGSSNKENAITSSSETTTMAGQYGES 75

Query: 76  GRVSINERKSTDASNEHTTTTATARNSDSMLTMGKLTEXXXXXXXXXXXXXQFYNERSSA 135
           G  +I + + T  S+++ + T T + SD+M ++ K TE             Q Y++ S  
Sbjct: 76  GSTTIMDEQETGTSSQYISVTTTTQTSDTMSSVKKSTEIATPSSSIVPTPLQSYSDESQI 135

Query: 136 LQTSNDNSKSGSRSKDATIPFESSNGMKKSTSDGTAVPRGIXXXXXXXPSLSKDESRPPE 195
            QT + N KS + S   T   ESS+ +  STSD +AVPR I         +SK+E    +
Sbjct: 136 SQTLSHNPKSVAESDSDTTSSESSSSVIISTSDSSAVPREISPIITTDSQISKEEGTLAQ 195

Query: 196 TSGVINIASTVHVASKVLQLFSATPITTTDGSNHEATGNHLISTKLSTASIEE 248
           TS +        + ++V Q+ S T  +T DG + E+T     +T     S+EE
Sbjct: 196 TSSISETTRIAQMVTRVSQISSITAASTIDGFSSESTQTDFSNTVSFENSVEE 248

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1289 (45%), Positives = 742/1289 (57%), Gaps = 128/1289 (9%)

Query: 237  ISTKLSTASIEEYTIDESDFSDYYGSSVNDYFAQELIVDLSSTPFTTKASSVTSQ----- 291
            IS+K+ST   +EYT+ + +F   YGSS  +Y  QELIV+   T  T KASS+ +Q     
Sbjct: 372  ISSKVST---DEYTVSDLEFPINYGSSAGNYPDQELIVNSPYTYSTNKASSLITQSTRIE 428

Query: 292  -NPDVEYSKLATDLRVSSTSFAETASS--KTVSSSYTHLSSTYASSP-----VLISSIYT 343
             NP +E S   T +  SS S  +T++S  KT+S +  H   +++S P     V +SS  T
Sbjct: 429  SNPIMESSISTTKILFSSISHTKTSTSAFKTMSFASIH---SFSSVPSPLDSVAVSSSRT 485

Query: 344  SSPYGSALSPTTPALIXXXXXXXXXXXXXXXXTHTXXXXXXXXXXXXXXXXXXTYTSSPY 403
            S P G  ++P                                              SSP 
Sbjct: 486  SFPNG--IAP----------------------------------------------SSPL 497

Query: 404  GPVSISSTYTSSPYGPVSSPSRP--GLMSSTYTSSKYGFXXXXXXXXXXX-XTYTSSPYG 460
              V + S++TSSP   VSS SRP    +SSTY SS+  F             + TSSP  
Sbjct: 498  ASVVVPSSHTSSP-NEVSS-SRPTSAAISSTYLSSQNRFPPSSPLASVVVPSSRTSSPNE 555

Query: 461  PVSSPSRPGLMSSTYTSSKYGFASSPSSPALIXXXXXXXXXXXXXXXXXXXXXXXXHTSS 520
              SSP     +SSTY SS  G A  P SP                               
Sbjct: 556  VSSSPPTSAAISSTYLSSPNGVA--PPSP------------------------------- 582

Query: 521  PYVFASSITTPALSPSAYTSSPHVSAPSSTAPVIASSAYTSSLYGLAPEFSSKQFLSTSD 580
                AS +      PS+ TSSP+  + S  A     SAY S       EFSS  + +TS 
Sbjct: 583  ---LASVVV-----PSSRTSSPNEVSSSPLASAAVPSAYISLSSDYTLEFSSVDYSTTS- 633

Query: 581  GVTPVISVHIMSSGPTNSLQQNSMETQK--SHPTSTGSSLNSDAYSNTITVISIRFSSSN 638
             V P I VH  S G TNSLQQ S+  Q   S  TS  S+ + + Y + I+V+S+  S+SN
Sbjct: 634  -VVPAIPVHSPSLGITNSLQQTSLAIQNIVSEFTSASSTFSQETYPSAISVVSMSSSTSN 692

Query: 639  PAGTSAPISSTKINPSYADEPVESNTPQRQLLTSARTSYDVESQNIESSSTFTIKSNFPY 698
               TS    ST++ P+Y    + S+TP+R + T+A+ SY+V +QNIESSST T+ SNFPY
Sbjct: 693  LFETSQMFLSTQLTPTYNTNLLASSTPRRLISTNAKASYEVTTQNIESSSTSTMVSNFPY 752

Query: 699  VSSTETPDNEDISITHEKTTTVSSNVHVYSLSDLRSRHSITEVXXXXXXXXXXXXXXXXX 758
             SS+   D E  S   + T  +SS +  +S+    S HS T +                 
Sbjct: 753  FSSSA--DKEKFSTIPKMTMVISSGIQAHSIYASSSHHSSTGISIGVLDSSKTSGLFASS 810

Query: 759  XXXXXXXISSIKYSKETELPSISISITEERLSSLKKTSQPNNLSEKSTTKRTLSSSQGTH 818
                    SS  +  +T     S S T+E  +S+K  SQPN+    S  + TLS+    H
Sbjct: 811  LDHAPPSTSSANHPGKTASTGKSASSTQESSNSIKFASQPNSQFRNSEVRSTLSTGSNAH 870

Query: 819  ---TLSIPSGSMNSKVSSTDSFDKTSKMIIYSRLETPSLITERTHYIXXXXXXXXXXXXX 875
               T S+P+   NSKV+S +S  K     I    E  S  T +T                
Sbjct: 871  FSFTSSLPA---NSKVNSENSSKK--GKTITDNDEKTSSATRKTQNSGLSKTSESYSRPS 925

Query: 876  TRASLGSVVTALQTQTITGSDSVIPVSFTHPTTPYTYSNDYAWLPTTIIVEPSQTGSSTA 935
            T+ S G++ TA+QTQ I+  +S  PV   + T   + SN YAWLPT IIV+ S+T +ST 
Sbjct: 926  TKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETDTSTT 985

Query: 936  PFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVL 995
             FNP+ITGSLP+LIEPAV  SEP NHTLITVGFTA LNY FLVQNPLSSAQIFNFLPLVL
Sbjct: 986  LFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVL 1045

Query: 996  GYPFSNTRLEVQSSTQGLSSFVLSYQSGXXXXXXXXXXXXXXXXXXXXXXGEKRNATAST 1055
             YPFS+T   V+SS   LSSF+LSY+SG                      G+K     ST
Sbjct: 1046 KYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSIVRKKKKGDKEKPPTST 1105

Query: 1056 ADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNP 1115
             DLY PSI  SSI VKQIVPM++SSKAY+IAVAEVYFPTEA+SYLQ+LILD +S +YNNP
Sbjct: 1106 MDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNP 1165

Query: 1116 QTPLRTLAGLIDSRIPLGGLTVYGAEDGSYISGL-SSSVADSSKENPAGKVGTSKYGALD 1174
            Q+PLRTLAGLID+ IPLG LT+Y + +  ++S L  S V DSSKEN  G V T KYGALD
Sbjct: 1166 QSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSKENSKGIVATYKYGALD 1225

Query: 1175 DFINSLTDYSPAGCYXXXXXXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXCIEKSF 1234
            DF NS TD +P   Y                         F             CIEKS 
Sbjct: 1226 DFTNSFTDSAPGWSYAARTIVFLAILTIGALLWLLFAFFVFHYRNILLKRYPKDCIEKSL 1285

Query: 1235 GNESKLQNVAISRSSSDNQTYNEKTSKTENKSIHSIVGDHYIVTGENTIYSTTHGLHYTM 1294
            GNE K  + A+SRSSS NQ +NEK S +EN+S+HS+  DHYI+TGENT+YSTTHGLHYT+
Sbjct: 1286 GNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHYIITGENTVYSTTHGLHYTI 1345

Query: 1295 NDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRECVYDKDQDTTEAYLNDGESVSSILDVD 1354
            NDDGDLFY+EA  NDL +    ED  ID I+R+CVYD+ Q++TEAYLND ES+SSI+DVD
Sbjct: 1346 NDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTEAYLNDEESISSIVDVD 1405

Query: 1355 ENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKIQLHGLGTRSCTTDDPDTVNLVT 1414
            ENGNIRL+DSYSDD E N ++L +EVI++YNN+++YKI+ +   T SCTTDDP+  N++T
Sbjct: 1406 ENGNIRLYDSYSDDEEPNSFYLPNEVIEEYNNNNVYKIKHNTPETGSCTTDDPEAGNMIT 1465

Query: 1415 NVFSSGSQTFLPSTAYTTPLHTNSIKFHTLHHAESSLQEPNQAFFSAAEELKIDDIDDNG 1474
            N FSS SQT LPST YTTPLHTNSIK  TL ++E SL +PN+A FS  E+L+IDDIDDNG
Sbjct: 1466 NEFSSSSQTCLPSTTYTTPLHTNSIKLQTLRYSEISLSQPNKALFSNHEDLEIDDIDDNG 1525

Query: 1475 SVSDVQVEELDALDEELYKRMSKVVKQQN 1503
            SVSD+Q+EELDALDEELYKR+SK+ KQQN
Sbjct: 1526 SVSDIQIEELDALDEELYKRISKIAKQQN 1554

 Score =  107 bits (267), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 144/293 (49%), Gaps = 37/293 (12%)

Query: 16  VNTIEAYSNDTTYPSLYSRRTDIAPSYSTSAIYNTVSNSDDSALRSSPETTALAGQYSDS 75
           +N IEAYSNDTTY  LYS   +I  SY TS  +N+ S+++++++ SSPETT LAGQYS+S
Sbjct: 16  LNAIEAYSNDTTYSRLYSSEIEIGTSYLTSTAFNSRSSNNENSITSSPETTTLAGQYSES 75

Query: 76  GRVSINERKSTDASNEHTTTTATARNSDSMLTMGKLTEXXXXXXXXXXXXXQFYNERSSA 135
            RV++NE +ST   ++++    T++++DS L+  + TE              +Y+  S  
Sbjct: 76  ARVAVNEEQSTGTPHQYSGALTTSQDADSTLSTQRSTEKAIPSSSEVPTPTNYYSGTSLF 135

Query: 136 LQTSNDNSKSGSRSKDATIPFESSNGMKKSTSDGTAVPRGIXXXXXXXPSLSKDESRPPE 195
            QT +DNSKS   S +         G+  STSDGTAVP  I        SLSK+ES   +
Sbjct: 136 SQTLDDNSKSILESSNEVTSSGFLTGIIISTSDGTAVPGKINPTFS---SLSKEESTSSQ 192

Query: 196 --------------------------------TSGVINIASTVHVASKVLQLFSATPITT 223
                                           TSG++    T  + S++ Q  S  P T 
Sbjct: 193 DFSYNDADTTTEMISGVSWLPSAATATRTDSFTSGLVRTEFTSAL-SRISQPSSIKPTTL 251

Query: 224 TDGSNHEATGNHLISTKLSTA-SIEEYTIDESDFSDYYGSSVNDYFAQELIVD 275
            D  +  +    L ST  S   + EEY I E + S+ Y SS+  Y +  LI +
Sbjct: 252 VDSFSMGSVQTQLASTISSEVPTEEEYIISELEISENYDSSLAIYLSAALIAE 304

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/952 (52%), Positives = 613/952 (64%), Gaps = 21/952 (2%)

Query: 567  APEFSSKQFLSTSDGVTPVISVHIMSSGPTNSLQQNS----METQKSHPTSTGSSLNSDA 622
            AP  S  + LST+  VTPVISVH MSS  T S QQ        T +S P S   S++SD 
Sbjct: 851  APGLSPVRSLSTAVTVTPVISVHTMSSKSTTSSQQVPPTPYKTTLQSRPIS---SISSDV 907

Query: 623  -YSNTITVISIRFSSSNPAGTSAPISSTKINPSYADEPVESNTPQRQLLTSARTSYDVES 681
             +S T++V SI   +SN   T+   S T+++ +Y  E  +SNTP  QL +    SY + S
Sbjct: 908  TFSTTVSVTSIGSFASNRVETTPLSSPTQLSSTYVAESPKSNTPLTQLSSGTEASYIMSS 967

Query: 682  QNIESSSTFTI--KSNFPYVSSTETPDNEDISITHEKTTTVSSNVHVYSLSDLRSRHSIT 739
            QNI SSS  T   +SN PYVSS +T DN   S T + + T S+ +H ++ S   SRHS+ 
Sbjct: 968  QNIASSSKLTTARQSNIPYVSSMKTSDNGFFSTTLQASPTGSTKMHTFTSSTSTSRHSMP 1027

Query: 740  EVXXXXXXXXXXX-XXXXXXXXXXXXXISSIKYSKETELPSISISITEERLSSLKKTSQP 798
            ++                         +SS KYSKET + + S S T ERL+   +T Q 
Sbjct: 1028 QIAASDVSGSSKDPGSHITSLYHSASSVSSKKYSKETNIVTQSFSETHERLTGSTRTYQS 1087

Query: 799  NNLSEKSTTKRTLSSSQGTHTLSIPSGSMNSKVSSTDSFDKTSKMIIYSRLETPSLITER 858
            N+    S  K T+++     T ++ S S  SK  ST S +K  + I  SR +  SL T +
Sbjct: 1088 NSQPSISNVKTTVNTQSHVLTTAL-SKSTKSKAGSTSSSNKLPETITDSRGKL-SLTTTK 1145

Query: 859  THYIXXXXXXXXXXXXXTRASLGSVVTALQTQTITGSDSVIPVSFTHPTTPYTYSNDYAW 918
            T +              T+ S G++  A QTQ IT S S+  V FT+ T PYT SNDYAW
Sbjct: 1146 TSHDSSLKTGESNSGVSTKLSTGTISIATQTQAITASTSITAVPFTYATNPYTTSNDYAW 1205

Query: 919  LPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFLV 978
            LPT IIVEP+++ +ST  FNPSIT SLP++I PA+AV+EPANHTLIT+GFTAGLNY FLV
Sbjct: 1206 LPTAIIVEPTKSDTSTTSFNPSITASLPNVIAPAIAVTEPANHTLITIGFTAGLNYVFLV 1265

Query: 979  QNPLSSAQIFNFLPLVLGYPFSNTRLEVQSST---QGLSSFVLSYQSGXXXXXXXXXXXX 1035
            QNPLSSAQIFNFLPLVL YPFS+T  + + S+    G SSFVLSYQSG            
Sbjct: 1266 QNPLSSAQIFNFLPLVLKYPFSDTTSQQEESSTYEMGSSSFVLSYQSGSSTTTLSPESVS 1325

Query: 1036 XXXXXXXXXXGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTE 1095
                         +N+  STA+L LPSI  SSIVVKQIVPM++SS++YVIAVAEVYFPTE
Sbjct: 1326 SIPIVRKKKKKGGKNSVMSTANLDLPSIGNSSIVVKQIVPMIDSSRSYVIAVAEVYFPTE 1385

Query: 1096 AISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGLTVYGAEDGSYISGLSSSVAD 1155
            AIS LQ+LILD +S +YNNPQT L+TLAGLIDS +PLGGLT+YG+ +G  I   SSS   
Sbjct: 1386 AISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLGGLTLYGSNNGCSICDSSSSSVS 1445

Query: 1156 SSKE-NPAGKVGTSKYGALDDFINSLTDYSPAGCYXXXXXXXXXXXXXXXXXXXXXXXXX 1214
                 N     GT+KYGALDDF NSLTD+ P                             
Sbjct: 1446 EVSNTNSTKNGGTNKYGALDDFTNSLTDHMPWRI-TKRFIIYLTCLTAGVLLWLLLALFA 1504

Query: 1215 FXXXXXXXXXXXXXCIEKSFGNESKLQNVAI--SRSSSDNQTYNEKTSKTENKSIHSIVG 1272
            F             CIEK+  NE  L+ V +  SRSSSDN  YNEK   TE++S +S+  
Sbjct: 1505 FRHRNVLLGRRPSNCIEKTPNNERGLEGVGVSTSRSSSDNHNYNEKKPNTESESFYSMED 1564

Query: 1273 DHYIVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRECVYDK 1332
            D YI TGENT+YS THGLHYT+++DGDLFYR+++PND++++N  ED  ID I+RECVYD+
Sbjct: 1565 DQYIPTGENTVYSATHGLHYTVDEDGDLFYRKSMPNDIDEINENEDSGIDSILRECVYDR 1624

Query: 1333 DQDTTEAYLNDGESVSSILDVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKI 1392
             QDTTE YLND ES+SSILDVDENGNIRL+DSYS+D E N  HLQ+EVI+DYNNSH+YK+
Sbjct: 1625 HQDTTEVYLNDEESMSSILDVDENGNIRLYDSYSEDDEPNCPHLQEEVIEDYNNSHVYKM 1684

Query: 1393 QLHGLGTRSCTT-DDPDTVNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKFHTLHHAESSL 1451
            QL GL   S TT DDPDT NL+ N FSSGSQT LPSTAYTTPL TNSIK H L HA SSL
Sbjct: 1685 QLQGLEIGSYTTEDDPDTENLIANEFSSGSQTCLPSTAYTTPLDTNSIKLHILGHAGSSL 1744

Query: 1452 QEPNQAFFSAAEELKIDDIDDNGSVSDVQVEELDALDEELYKRMSKVVKQQN 1503
            Q+P+QAF S  +EL+I+DIDDNGSVSD+QVEELDALDEELYKRMSK+VKQQN
Sbjct: 1745 QKPDQAFISNHDELEIEDIDDNGSVSDIQVEELDALDEELYKRMSKIVKQQN 1796

 Score =  130 bits (326), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 139/271 (51%), Gaps = 17/271 (6%)

Query: 16  VNTIEAYSNDTTYPSLYSRRTDIAPSYSTSAIYNTVSNSDDSALRSSPETTALAGQYSDS 75
           +N I AYSNDT+Y  LYS   D  PSYS SA+Y T S++D +   S+PETT LAGQYS+S
Sbjct: 16  MNAIAAYSNDTSYSYLYSSGIDSTPSYSISAMYATESSNDANGETSNPETTTLAGQYSES 75

Query: 76  GRVSINERKSTDASNEHTTTTATARNSDSMLTMGKLTEXXXXXXXXXXXXXQFYNERSSA 135
           GR+S N  +S+  S ++TT   T  NSD    M K T              Q  +E SS+
Sbjct: 76  GRISTNREQSSTTSQQYTTAAITVGNSD---FMSKSTTIATPSSSRVPTSIQATSEASSS 132

Query: 136 LQTSNDNSKSGSRSKDATI---PFESSNGMKKSTSDGTAVPRGIXXXXXXXPSLSKDESR 192
           LQ           S D T+      S +    STSDGT VPRG         S SK E  
Sbjct: 133 LQI---------HSFDTTLVSKSELSESSSSLSTSDGTTVPRGTNPITTTTFSSSKGEII 183

Query: 193 PPETSGVINIASTVHVASKVLQLFSATPITTTDGSNHEATGNHLISTKLSTASIEEYTID 252
             +TSG    AS   V  +  QL   T  TTT  S+ E T     ST  S  S E+YTID
Sbjct: 184 STQTSGASRTASLAQVVPESSQLSRMTLTTTTHVSSGEITQTQFFSTISSMISTEDYTID 243

Query: 253 ESDFSDYYGSSVNDYFAQELIVDLSSTPFTT 283
             DFS++Y S   +Y  +ELIV+ SS+  TT
Sbjct: 244 --DFSEFYDSGFTNYPGEELIVEYSSSSPTT 272

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  152 bits (383), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 135/248 (54%), Gaps = 30/248 (12%)

Query: 916  YAWLPTTIIVEPSQTGS-STAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNY 974
            + WLP ++IVE   T + S+   +   T +LP  I P  AV +PA H+LIT+GF   LNY
Sbjct: 1472 HNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNY 1531

Query: 975  EFLVQNPLSSAQIFNFLPLVLGYPFSNT--------RLEVQ----------SSTQGLSSF 1016
             FL+ +PLSSAQIF+FLP VL YPFS+T        R +++          SS   + + 
Sbjct: 1532 PFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTC 1591

Query: 1017 VLSYQS---------GXXXXXXXXXXXXXXXXXXXXXXGEKRNATASTADLYLPSIETSS 1067
             LS+Q+                                 +K +   ST+D    +I+ S 
Sbjct: 1592 SLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSD--SSNIDYSQ 1649

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            IVVKQI+P+V+SS  Y+++VAEVYFP  +I  LQ+L+ + +S +Y NP+  L+ LA LID
Sbjct: 1650 IVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLID 1709

Query: 1128 SRIPLGGL 1135
              +PL GL
Sbjct: 1710 PSVPLTGL 1717

 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 15/130 (11%)

Query: 1273 DHYIVTGENTIYSTTHGLHYTMNDDGDLFY--REAVPNDLNQLNGGEDLEIDVIVRECVY 1330
            D  +VTG+NT+YST+ GL Y ++++G+ +Y   + + N+  Q N   D    +   E +Y
Sbjct: 1881 DDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHN-QLQSMEHIY 1939

Query: 1331 DKDQDTTEAYLNDGESVSSI--LDVDENGNIRLHDSYSD------DGESNRYHLQDEVID 1382
            +         L D E    I  +DVDE GNI L DS  +      D E  +     + ++
Sbjct: 1940 EGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGK----TDTVE 1995

Query: 1383 DYNNSHLYKI 1392
             YNN+  YK+
Sbjct: 1996 SYNNNQYYKM 2005

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score =  145 bits (367), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 138/286 (48%), Gaps = 34/286 (11%)

Query: 918  WLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFL 977
            WLP ++I    Q+ S+ +  NP IT +LP+ I       +P N TL+T+GF   LNY FL
Sbjct: 592  WLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFL 651

Query: 978  VQNPLSSAQIFNFLPLVLGYPFSNTRLEVQS-STQGLSSFVLSYQ-SGXXXXXXXXXXXX 1035
            + NPL+SAQIF FLPL L YPF  T+    S     L S  L Y+  G            
Sbjct: 652  IDNPLASAQIFEFLPLTLSYPFLLTQYNASSEEITSLCSSSLYYEDDGRTILTTHESTTV 711

Query: 1036 XXXXXXXXXXGEKRNATASTADLYL------------------PSIETSSIVVKQIVPMV 1077
                      G   N    TA L                    P   +S++VVK I+PM+
Sbjct: 712  DSTQFVKKIMGPASNLL--TAQLASSPSSSPTQRPHPRESSPPPFFNSSNVVVKHILPMI 769

Query: 1078 NSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGL-- 1135
            ++ + Y+++VAEVYFPT+ +  LQK I   +SP+Y+NP TP  TL  LID  I L  L  
Sbjct: 770  SNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLFQ 829

Query: 1136 -----TVYGAEDGSYISGLSSSVADSSKENPAGKVG--TSKYGALD 1174
                      +DGS  S  SS    ++K NP+      T + G+LD
Sbjct: 830  QNGMNNQGNNQDGSLSSNDSSF---NTKTNPSNLTSTETERSGSLD 872

 Score = 41.6 bits (96), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 19/23 (82%)

Query: 1480 QVEELDALDEELYKRMSKVVKQQ 1502
            QV ELD LDEELYKRMS ++K Q
Sbjct: 1163 QVGELDGLDEELYKRMSSIMKLQ 1185

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  140 bits (353), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 113/218 (51%), Gaps = 12/218 (5%)

Query: 918  WLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFL 977
            WLP++I V+   T S T+ F+P++T +LP LI P  AV  P N + ITVGF   LNYEFL
Sbjct: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128

Query: 978  VQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGXXXXXXXXXXXXXX 1037
            V +  ++AQIF+FLP VL +PF            G   F  SY+                
Sbjct: 1129 VSSSTTAAQIFHFLPFVLSFPFEE---------NGTKDF--SYKRRGTLLVSSFEFNNTT 1177

Query: 1038 XXXXXXXXGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAI 1097
                     E     +  +D   P    S++ V QI+PM+   + Y+ ++A +YFP+  +
Sbjct: 1178 TLMPAQFHQETVTGISKRSDSEFP-FNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYV 1236

Query: 1098 SYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGL 1135
            S LQ ++ D +S ++NNP   L  LA LID  IPL GL
Sbjct: 1237 SELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGL 1274

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 135/286 (47%), Gaps = 49/286 (17%)

Query: 1257 EKTSKTENKSIHSIVGDHYIVTGENTIYSTTHGLHYTMNDDGDLFYREAVP--NDLNQLN 1314
            EK   + ++S +S+  D  ++TGENT+YS + GL Y + +DG  +Y   +   ++ N+  
Sbjct: 1400 EKDVASASQSRYSLPED-LMITGENTVYSVSQGLQYFVAEDGSFYYAGPLQSTSEENETT 1458

Query: 1315 GGEDLEIDVIVRECVYDKDQDTTEAYLNDGESVSSI--LDVDENGNIRLHDSYSDDGESN 1372
             G+  +I+ I  + +Y  DQ+   + + + +S   I  L +DE GN  + D   ++ E  
Sbjct: 1459 KGDSADIEDI-NDYLYSADQE--RSIVTNEQSSCDIGSLQIDEEGNFVVSDPSPNEEEHE 1515

Query: 1373 RYHLQDEVIDDYNNSHLYKIQLHGLGTRSCTTD--------DPDTVNLVTN--VFSSGSQ 1422
                    I+ YNN++LYK+      TR+  ++        D D+   +++  +   G+ 
Sbjct: 1516 ITSSNSATIELYNNNNLYKM------TRTVNSNEISSPRYLDQDSQGEISDAGMGQEGNP 1569

Query: 1423 TFLPSTA----YTTPLHTNSIKFHTLHHAESSLQEPNQAFFSAAEELKIDDI----DDNG 1474
             FL ST      ++P  + +    ++     S  + N    S   E  ID+      D+ 
Sbjct: 1570 DFLSSTEQNWHISSPDESENFPGRSVFGFYGS-DDSNNIVQSLPAENCIDEYLYVSGDDD 1628

Query: 1475 SVSD----VQVEELDA------------LDEELYKRMSKVVKQQNQ 1504
            S+ D    V++EE+D             LDEE+YKR SK++ QQ +
Sbjct: 1629 SLLDSPLGVRIEEIDDDAVDVHVDDLDELDEEMYKRRSKLMTQQQR 1674

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  139 bits (349), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 95/252 (37%), Positives = 132/252 (52%), Gaps = 21/252 (8%)

Query: 894  GSDSVIPV-SFTHP-TTPYTYSNDY--AWLPTTIIVEPSQTGSSTAPFNPSITGS----- 944
            GS +V+P  SF  P + P + S D    WLPTTI+    QT    +P   +  GS     
Sbjct: 1299 GSSNVVPSPSFIAPKSNPSSTSIDEKTGWLPTTIVTASMQT----SPKESTTVGSAATYT 1354

Query: 945  LPSLIEPAVAVSEPANHTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPF-SNTR 1003
            LP  I PA  V++P N+ LIT+GF  GLNY FLV NP++SAQIF+FLP +L YP+  N  
Sbjct: 1355 LPRAITPATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKE 1414

Query: 1004 LEVQSSTQGLSSFVLSYQ---SGXXXXXXXXXXXXXXXXXXXXXXGEKRNATASTADLYL 1060
              +       ++ +L  +   SG                        ++N    T+D + 
Sbjct: 1415 ALLLRHINESNNNILGNRGSVSGSYFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEH- 1473

Query: 1061 PSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLR 1120
                 S IVVKQIVP +     Y  +VAEVYFP+EA++ L+K++ D +S +Y NP   L 
Sbjct: 1474 ---GYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLN 1530

Query: 1121 TLAGLIDSRIPL 1132
             LA L+D RIP+
Sbjct: 1531 QLASLVDPRIPV 1542

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 115/283 (40%), Gaps = 67/283 (23%)

Query: 1269 SIVGDHYIVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVREC 1328
            S   D  IVTGENT+YS + G+ Y ++++G+ +Y       +N  +   + E D++ +E 
Sbjct: 1688 SFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYAR-----INPFSNSFEPEADIMYQES 1742

Query: 1329 VYDKDQDTTEAYLNDGESVSSILDVDENGNIRLHDSYSDDGESNRYHLQ--DEVIDDYNN 1386
              +        Y++ G  +    D+D+ GNI + +      E    HLQ  D +I+ YN 
Sbjct: 1743 GGETININEAQYMSSGIDLE---DIDQEGNIEISELEFHHPEL-LSHLQKDDGIIEHYNK 1798

Query: 1387 SHLYK---------------------------------------IQLHGLGTRS----CT 1403
            +  Y                                        I+LHG  + +      
Sbjct: 1799 NQYYNMSTIVTESSNPQCNTVGLSSEPGMSVNVEDLSNENSVGFIRLHGSSSDNYDDYLY 1858

Query: 1404 TDDPDTVNLVTN-----VFSSGSQTFLPSTAYTTPLHTNSIKFHTLHHAESSLQEPNQAF 1458
              D D + LV +       S+   +   S   T P   +  +   +   E  + E ++  
Sbjct: 1859 EGDEDDIELVNDDAIAIPISTSRGSVTRSLIITEP---SGFRLGEVEAIEEIMPECDE-- 1913

Query: 1459 FSAAEELKIDDIDDNGS---VSDVQVEELDALDEELYKRMSKV 1498
            F+ A+  K    D NG    VSD+ VEE DALDEE+Y+ +S +
Sbjct: 1914 FTDADYDKDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLSVI 1956

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 124/229 (54%), Gaps = 50/229 (21%)

Query: 918  WLPTTIIVEPSQTGSSTAPFNPSI--TGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975
            WLPTT+++EP+   +++A  +  +  T +LP  I PA  V  P  +T+ITVGF   LNY 
Sbjct: 722  WLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEPLNYP 781

Query: 976  FLVQNPLSSAQIFNFLPLVLGYPFSNT--------RLEVQSSTQGLSSFVLSYQSGXXXX 1027
            FL+ NPL+SAQIFNFLP VL  PF  T        R       +G+++ +LS        
Sbjct: 782  FLIANPLASAQIFNFLPKVLVRPFQLTTTGAAPVYRRSWNIFKKGINTHLLSSS------ 835

Query: 1028 XXXXXXXXXXXXXXXXXXGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAV 1087
                                            LP+ +   + VK IVP+V  + +Y++++
Sbjct: 836  --------------------------------LPTYD--DVQVKSIVPLVIQNVSYIVSI 861

Query: 1088 AEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGLT 1136
            AEVYFPTE++  LQ+L+LD+SS +Y+NP + L  LA LI+  IPL GLT
Sbjct: 862  AEVYFPTESVHTLQELVLDSSSILYSNPVSYLADLASLINPAIPLTGLT 910

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 72/140 (51%), Gaps = 24/140 (17%)

Query: 1237 ESKLQNVAISRSS-SDNQTYNEKTSKTENKSIHSIVGDHYIVTGENTIYSTTHGLHYTMN 1295
            +S ++N+  S S  SD+ T  E +   E       + D  I+TGENT+YS + G+ Y ++
Sbjct: 1033 DSPMRNMFYSGSQFSDSDTTEEDSHSAE------YIDDDLIITGENTVYSISQGITYYVD 1086

Query: 1296 DDGDLFY-------REAVPNDLNQL--NGGEDLEIDVIVRECVYDKDQDTTEAY--LNDG 1344
            +DG+ F+         + P  L ++  +  E + ++ I+     +KD D T+     + G
Sbjct: 1087 EDGNFFFAGVGKDVHTSEPEKLEKIIHDKTETVTVEPIL-PYYNEKDDDLTDETEPFDMG 1145

Query: 1345 ESVSSILDVDENGNIRLHDS 1364
            E     L+VDE+GNI L +S
Sbjct: 1146 E-----LEVDEDGNIALPES 1160

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  135 bits (341), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 136/270 (50%), Gaps = 26/270 (9%)

Query: 884  VTALQTQTITGSDSVI----PV---SFTHPTTPYTYSN--DYAWLPTTIIVEPSQTGSST 934
            VT     +ITGS  V+    P+   S  +P +P + S+  D  WLPT II+  +   + T
Sbjct: 845  VTDTMVSSITGSVGVVQTPNPLGGSSILNPASPTSGSDSTDTVWLPTNIIIASNADSTHT 904

Query: 935  APFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLV 994
            A      T SLP+ I PA  +  P +  LIT+GF +GLNY FLV NPLSSAQ+F+FLP V
Sbjct: 905  A--RAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHV 962

Query: 995  LGYPFSNTRLEVQSSTQGLSSFVLSYQSGXXXXXXXXXXXXXXXXXXXXXXGEKRNATAS 1054
            L +P  +   E   + Q  SS + +                            +  AT+S
Sbjct: 963  LFFPIEDAA-EKSKAIQPQSSDITT-----TLVAPLRKNRKTVTDMTRANVVNQNEATSS 1016

Query: 1055 TADLYLPSIETSS---------IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLIL 1105
            + +L + S  T S         I VKQI+P+V     Y+ +VAEVYFPT  I  L  LI 
Sbjct: 1017 SLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALIS 1076

Query: 1106 DASSPIYNNPQTPLRTLAGLIDSRIPLGGL 1135
            D +S +Y+NP+    TLA LID  IPL  L
Sbjct: 1077 DPNSTLYSNPKKNFATLASLIDKAIPLTSL 1106

 Score = 32.7 bits (73), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 19/24 (79%)

Query: 1480 QVEELDALDEELYKRMSKVVKQQN 1503
            +V ++D LD ELYKR+SK+ K +N
Sbjct: 1479 RVGDIDELDVELYKRLSKIEKFKN 1502

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score =  134 bits (336), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 85/224 (37%), Positives = 120/224 (53%), Gaps = 8/224 (3%)

Query: 916  YAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975
            +AWLPT I+V+ S T  + +P   + T  LP  I P  AV++PA+  LI++GF   LNY 
Sbjct: 518  FAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPT-AVTQPADSILISIGFKIELNYP 576

Query: 976  FLVQNPLSSAQIFNFLPLVLGYPF----SNTRLEVQSSTQGLSSFV-LSYQSGXXXXXXX 1030
            FL++   +SAQIFNFLPL+L YPF    SN +L+   S Q  +S +   YQ         
Sbjct: 577  FLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFSYE 636

Query: 1031 XXXXXXXXXXXXXXXGEKR--NATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVA 1088
                           GE     A+ + A +     +TSSI VKQI+P++     Y+ ++A
Sbjct: 637  TTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYITSLA 696

Query: 1089 EVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPL 1132
            E  FP E +  LQ  I + +S IY NP   L+ +A LIDS IP+
Sbjct: 697  EGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI 740

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  125 bits (313), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 118/227 (51%), Gaps = 17/227 (7%)

Query: 918  WLPTTIIVEPSQTGSS--TAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975
            WLP+ I+   S TGS+   + F+   T +LP  I P   V+ P N++ IT+GF   LNY 
Sbjct: 1228 WLPSNIVTA-SYTGSAHTQSSFDADATATLPQAIMPPTPVTMPPNYSQITIGFKESLNYP 1286

Query: 976  FLVQNPLSSAQIFNFLPLVLGYPFS-------NTRLEVQSSTQGLSSFVLSYQSGXXXXX 1028
            FL++NPL+SAQIF FLP +L YPFS       ++   V+    G S  +L   S      
Sbjct: 1287 FLIENPLASAQIFGFLPEILRYPFSVRASRSNSSTSSVKRDLVGDSGNLLLDNS--TLIL 1344

Query: 1029 XXXXXXXXXXXXXXXXXGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVA 1088
                                RN + +        +  SSIV     P++ S   Y+ +VA
Sbjct: 1345 DKLNWKTSIMNSLSSNVSVSRNGSHNAFRANFSGVAVSSIV-----PLIVSGNDYITSVA 1399

Query: 1089 EVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGL 1135
             VYFPTEA+  LQK+I++ +S IY NP   LR +A LIDS+IP+ G+
Sbjct: 1400 VVYFPTEAVEVLQKMIINGASRIYKNPDQSLRDMALLIDSKIPITGI 1446

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 72/171 (42%), Gaps = 31/171 (18%)

Query: 1351 LDVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKI-QLHGLGTRSCTTDDPDT 1409
             DVDE+GN+ L  S SD    +      + I+ YNN   YK+ QL     ++   DD + 
Sbjct: 1700 FDVDEDGNVEL--SVSDLERLSLDEHNSDTIESYNNQQYYKMKQL----LQNLNNDDIEG 1753

Query: 1410 VNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKF------------HTLHHAESSLQ----- 1452
                 N  ++G+ +   + +   PL + S K                +  E+ L+     
Sbjct: 1754 AFSTENEGAAGNISSTGNESKLMPLSSESSKLLVQLSTDDDNLEEYFYSEEAQLEGIGKT 1813

Query: 1453 -----EPNQAFFSAAEELKID-DIDDNGS-VSDVQVEELDALDEELYKRMS 1496
                 EP        E+  ID D ++ G  V+DV V E D LDE +Y+R S
Sbjct: 1814 TSPQPEPESEDNDDVEDFNIDSDSEEEGEDVNDVHVGEFDELDEVMYRRFS 1864

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score =  112 bits (279), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 97/305 (31%), Positives = 142/305 (46%), Gaps = 51/305 (16%)

Query: 916  YAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975
            + WLP+ I ++   T  S  P     T  LP++I    A++ P+N TLITV F   LNY 
Sbjct: 514  FDWLPSEIAIQSDSTAESMEPSFLIDTSGLPNIITAPTAITIPSNTTLITVAFKRELNYA 573

Query: 976  FLVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQG------LSSFVLS---------- 1019
            FLV N  SSAQIFNFLP+++ +PF  T L  +S           + ++L+          
Sbjct: 574  FLVNNFYSSAQIFNFLPIIIKHPF--TALVSESCNDDSVCSPLFTEYILNSYASSAASSM 631

Query: 1020 ---------YQSGXXXXXXXXXXXXXXXXXXXXX-XGEKRNATASTADLYLPSIETSSIV 1069
                     +QSG                       G + N T+    L    +  ++ +
Sbjct: 632  STSSVNNVDFQSGGKHSVNINLSLHSTIVQTAISPTGFQTNMTSQIPSLAKKDLSKNASL 691

Query: 1070 VKQ----------IVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPL 1119
             KQ          I+P +  +  Y+I++AEVY P E +  LQ+LIL+ +S  YN+  + L
Sbjct: 692  QKQEISMDITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFYNSESSSL 751

Query: 1120 RTLAGLIDSRIPLGGLTVYGAEDGSYIS-GLSSS---VADSSKENPAG------KVGTSK 1169
            +TLA LID  IPL G+      +G+ IS GLSSS   + +SS ++  G         T K
Sbjct: 752  KTLAFLIDPNIPLTGML---DSNGNLISGGLSSSNGNIQNSSTKHSHGSGISDISSQTLK 808

Query: 1170 YGALD 1174
             G LD
Sbjct: 809  LGTLD 813

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 107/236 (45%), Gaps = 37/236 (15%)

Query: 1283 IYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNG----------GEDLEIDVIVRECVYDK 1332
            +Y+ +  + Y +++ G+ +Y      +L+ + G          G     DV   + VYD 
Sbjct: 920  VYNRSQDMTYLVDEQGNFYY-----TNLDNVQGRTVHIMRTPEGSIYSKDVSYNKYVYDS 974

Query: 1333 DQDTTEAYLNDGESVSSILDVDENGNIRLHDSYSDD--GESNRYHLQD-EVIDDYNNSHL 1389
            +  T+  YL+D    +++   D+     L  +Y D    E    H    E +  +NN+ L
Sbjct: 975  NNSTSNTYLDDQYHENTVNKGDD-----LEITYPDFLLNEVKESHTNIIENVKRFNNNGL 1029

Query: 1390 YKIQLHGLGTRSCTTDD-----PDTVNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKF--H 1442
            YK+ L  LGT    ++       D +    + +   + ++     Y      +S  F  H
Sbjct: 1030 YKMIL-PLGTSGTDSETHKGSAQDNLKRHFDNYQGDTNSW---NQYDAVDDNSSFNFDDH 1085

Query: 1443 T-LHHAESSLQEPNQAFFSAAEELKIDDIDDNGSVSDVQVEELDALDEELYKRMSK 1497
            T L++A SS+        +  ++  + DI+D+  V+DV V ELD LDEE+YKR+++
Sbjct: 1086 TYLNNATSSVACQGNTNITY-DQSSVSDIEDD-EVNDVHVGELDELDEEIYKRITR 1139

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  107 bits (268), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 96/220 (43%), Gaps = 15/220 (6%)

Query: 918  WLPTTIIVEPSQTGSSTAPFNPSITGS-----LPSLIEPAVAVSEPANHTLITVGFTAGL 972
            WLP TII E  Q      P   S TG      LP+ I P   V     + LI++GF  GL
Sbjct: 1498 WLPATIITESVQ---QHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGL 1554

Query: 973  NYEFLVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGXXXXXXXXX 1032
            NY F+    LSSAQIF FLP VL YPF +   E            L              
Sbjct: 1555 NYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASR 1614

Query: 1033 XXXXXXXXXXXXXGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYF 1092
                            +  T+   DL    ++       Q+ P V+  + Y+  +A VYF
Sbjct: 1615 DTTTLSSFTHSQVIAVQKETSDVPDLSFVKVK-------QLAPDVSEERGYIATLAHVYF 1667

Query: 1093 PTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPL 1132
            P++ +  LQ+LILD+ SP+YNNP   L+  A LID  I +
Sbjct: 1668 PSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707

 Score = 60.1 bits (144), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 18/125 (14%)

Query: 1273 DHYIVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRE--CVY 1330
            D  IVTGENT+YS + G+ Y ++++G+ +Y             G D   D   +E  C+Y
Sbjct: 1853 DDIIVTGENTVYSLSQGIAYHIDEEGNYYY------------AGIDPFTDAFEQEADCLY 1900

Query: 1331 DKDQDTTEAYLNDGESVSSIL---DVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNS 1387
              + +     +N+ + +SS +   ++D +GNI L+DS  D    ++     E I+ YNN+
Sbjct: 1901 -HESEVESVNVNNLDHLSSDIKEENIDLDGNIELYDSDFDHTSLDQVPKATETIEKYNNN 1959

Query: 1388 HLYKI 1392
              YK+
Sbjct: 1960 QYYKM 1964

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score =  102 bits (254), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 50/95 (52%), Positives = 62/95 (65%)

Query: 906  PTTPYTYSNDYAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLIT 965
            PT P T S+D  WLP+ II +     + ++ FNP+ T SLP  I P     +  N TL+T
Sbjct: 705  PTGPKTLSSDENWLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVT 764

Query: 966  VGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPFS 1000
            +G   GLNY+FL+ NPLSSAQIFNFLP VL YPFS
Sbjct: 765  IGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFS 799

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 1066 SSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGL 1125
            S+I V  IVP++     + ++V EVYFP + +  L  LI D +S +Y+NP   L  LA L
Sbjct: 828  STISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARL 887

Query: 1126 IDSRIPLGGLTVYGAEDGSYISGLSSSVADSSKENPAGKVGTSKYG 1171
            ID  IPL GL       GS I   S+S AD + +  +G    S+ G
Sbjct: 888  IDPSIPLTGLI-----SGSSIESTSNSDADYNSDQ-SGNTRQSRKG 927

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 19/22 (86%)

Query: 1476 VSDVQVEELDALDEELYKRMSK 1497
            V D+Q+E++D  DEELYKR+SK
Sbjct: 1152 VKDLQIEDVDEFDEELYKRLSK 1173

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score = 98.6 bits (244), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 68/109 (62%), Gaps = 5/109 (4%)

Query: 891  TITGSDSVIPVSFTHPTTPYTYSNDYAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIE 950
            TIT   S +P + + PT   T      WLP +II++ + + SS   FNP +T +LP  I 
Sbjct: 1626 TITNIGSSVPSATSAPTESNTN-----WLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIA 1680

Query: 951  PAVAVSEPANHTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPF 999
            P   VSEP N + IT+GF   ++Y+FLV NPLSSAQIF FLP VL YPF
Sbjct: 1681 PQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPF 1729

 Score = 75.9 bits (185), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 139/310 (44%), Gaps = 53/310 (17%)

Query: 1240 LQNVAISRSSSDNQTYNEK-TSKTENKS------IHSIVGDHYIVTGENTIYSTTHGLHY 1292
             Q  A +  S + +T +   T K EN +        S + D  IVTGENT+YST HGL Y
Sbjct: 1970 FQEKATNNDSQNQETVDRNATPKLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEY 2029

Query: 1293 TMNDDGDLFYREAVPNDLNQLNGGEDLEIDVI--VRECVYDKDQDTTEAYLNDGESVSSI 1350
             +++DG   Y  A    ++  +G    E D I    + +Y   ++ +       E   S 
Sbjct: 2030 FVDEDGQFHY--AGNRQISDESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSS 2087

Query: 1351 LDVDENGNI-----RLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKIQL----HGLGTRS 1401
            L+VDE GN       ++D+  ++  S   +   + ++ YNN+HLYK+       G+   +
Sbjct: 2088 LEVDEEGNFVLMNDEIYDNLQENSRSGSGNKNSDTVESYNNNHLYKMTRSSDSEGVTKDA 2147

Query: 1402 CTTDDPDTVNLVTNVFSSGSQTFLPSTA---------------YTTPLHTNS-------- 1438
              + D  +  +      +G +  +PS+                Y+ P    S        
Sbjct: 2148 FLSSDEGSPEIYGYGTEAGDEYMIPSSVHDYGNLEPATDYDQYYSPPYMIGSSTDDTNNN 2207

Query: 1439 ------IKFHTLHHAESSLQEPNQAFFSAAEELKIDDIDDNGSVSDVQVEELDALDEELY 1492
                  + F    + E     P   + S  ++++I+DIDD G V D+Q+++ D LDEE+Y
Sbjct: 2208 GLTDLPLDFDEYMYQEGDGDAP---YISDMDDVRIEDIDD-GKVDDLQIDDFDDLDEEMY 2263

Query: 1493 KRMSKVVKQQ 1502
            +R+SK++ ++
Sbjct: 2264 QRLSKIMIER 2273

 Score = 69.7 bits (169), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 51/73 (69%)

Query: 1063 IETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTL 1122
            I T+++ V QI+PM++  K+Y++AVAE+YFP + ++ L+  + +++S +YNN    L  L
Sbjct: 1773 ISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFAL 1832

Query: 1123 AGLIDSRIPLGGL 1135
            A LID  IPL G+
Sbjct: 1833 ADLIDPSIPLTGM 1845

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 3/84 (3%)

Query: 918  WLPTTIIVEPSQTGS--STAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975
            WLPT ++V  S T S  + + F+ + T +LP  I P+  VS PAN++ IT+GF   LNY 
Sbjct: 1304 WLPT-LLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNYP 1362

Query: 976  FLVQNPLSSAQIFNFLPLVLGYPF 999
            FL++NPL+SAQIF FLP VL YPF
Sbjct: 1363 FLIKNPLASAQIFGFLPDVLRYPF 1386

 Score = 75.9 bits (185), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 51/70 (72%)

Query: 1066 SSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGL 1125
            S +VV  I+P++ S   Y+ +VA VYFPT A++ LQK+IL+++S +Y+NP +   +LA L
Sbjct: 1457 SEVVVSSIIPLIISGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALL 1516

Query: 1126 IDSRIPLGGL 1135
            ID +IP+ GL
Sbjct: 1517 IDPKIPITGL 1526

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 111/285 (38%), Gaps = 77/285 (27%)

Query: 1273 DHYIVTGENTIYSTTHGLHYTMNDDGDLFYR----EAVPNDLNQLN----GGEDLEIDVI 1324
            +  +  G    +S + GL Y +  DG+ +Y     +  P +         G +D  ++ +
Sbjct: 1672 EDLLAVGNGLFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAV 1731

Query: 1325 VRECVYDKDQDTTEA-YLND-GESVSSILDVDENGNIRLHDSYSDDGESNRYHLQDEVID 1382
                ++ + +   EA +L+  G+ +  I+ VDE+GN+ L    +D  + +      + I+
Sbjct: 1732 T--TLFKEGEVNNEALHLSQVGQDLDEII-VDEDGNVELP--LADLEQLSFEENNTDTIE 1786

Query: 1383 DYNNSHLYKI-QLHGLGTRSCTTDDPDTVNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKF 1441
             YNN   YK+ QL    T +   D          + SSG +T    T    P + N +K 
Sbjct: 1787 SYNNQQYYKMNQLLSAITGADIQD---------ALTSSGHET----TGEGIPSNYNEVKD 1833

Query: 1442 HTLHHAESSL----------------------QEPNQAFFSAAEELKIDDIDD------- 1472
              L    S+L                      ++P +A  + ++    +D++D       
Sbjct: 1834 APLSSESSNLVAQLSGGDENLEDYFYSEIEPLEDPEEAHIAQSDSEDSNDVEDFNVDSDT 1893

Query: 1473 -------------------NGSVSDVQVEELDALDEELYKRMSKV 1498
                                  V+D+ + E D LDEE+Y+R+S V
Sbjct: 1894 EEEWEREEHYEEGDEEGDEADDVNDIHIGEFDELDEEMYRRLSSV 1938

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (62%), Gaps = 7/97 (7%)

Query: 918  WLPTTIIVEPSQTGSSTAPFNPSITG-------SLPSLIEPAVAVSEPANHTLITVGFTA 970
            WLPT ++VE + T +  A    S TG       +LP  I  A  VS+P  +TLIT+GF  
Sbjct: 902  WLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFKK 961

Query: 971  GLNYEFLVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQ 1007
             LNY F+V +P+SSAQ+F++LP VL YPF+ T  +VQ
Sbjct: 962  SLNYPFVVSHPVSSAQLFSYLPNVLNYPFNYTFSDVQ 998

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 48/70 (68%)

Query: 1066 SSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGL 1125
            S + V Q+VP+ +SS+ Y+I VA+VYFP+E +  LQKLI + ++ +Y N     ++LA L
Sbjct: 995  SDVQVYQLVPLKSSSRDYLITVAKVYFPSEQVEVLQKLISNTAANLYFNSNPTEKSLASL 1054

Query: 1126 IDSRIPLGGL 1135
            ID  IPL G+
Sbjct: 1055 IDPTIPLTGI 1064

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
            Anc_4.150
          Length = 985

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 1/100 (1%)

Query: 904  THPTTPYTYSNDYAWLPTTIIVEPSQ-TGSSTAPFNPSITGSLPSLIEPAVAVSEPANHT 962
            T PT     S+   W+PT +I + +Q + S++ P + + T +LP +I     + EP  ++
Sbjct: 592  TTPTQTRASSDTNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGTTIPEPEGYS 651

Query: 963  LITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPFSNT 1002
            LIT+GF   LNYEF+V NP SSAQIF+FLP VL  PF+NT
Sbjct: 652  LITIGFKKPLNYEFIVANPKSSAQIFSFLPDVLNAPFNNT 691

 Score = 55.8 bits (133), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 2/70 (2%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSP--IYNNPQTPLRTLAGL 1125
            I V Q+VP+ N S  Y++ VA+VYFPT+ I  L  LI D ++P  IY   Q    +LA L
Sbjct: 695  ITVLQLVPLQNPSLNYLVTVAKVYFPTDMIDTLSSLIEDYTTPSLIYTINQGAKGSLANL 754

Query: 1126 IDSRIPLGGL 1135
            I S IPL GL
Sbjct: 755  ISSDIPLTGL 764

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/90 (46%), Positives = 55/90 (61%), Gaps = 5/90 (5%)

Query: 914  NDYAWLPTTIIVEPSQ--TGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAG 971
            ND  W+PT II +P+   T SST+      T +LP  I  A     P  ++L+T+GF + 
Sbjct: 1155 NDNWWVPTKIITQPAPNTTASSTSS---QATATLPQAIAAATQQVRPKGYSLLTIGFKSA 1211

Query: 972  LNYEFLVQNPLSSAQIFNFLPLVLGYPFSN 1001
            LNY FL+ +PLSSAQIF FLP +L  PF N
Sbjct: 1212 LNYNFLISSPLSSAQIFAFLPSILNDPFQN 1241

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 7/88 (7%)

Query: 1059 YLPSI-------ETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPI 1111
            +LPSI       + +++ + QIVP+ + S  Y+  VAEVYFPT+ IS L  LI + +S +
Sbjct: 1230 FLPSILNDPFQNQFNNVSIYQIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNASSL 1289

Query: 1112 YNNPQTPLRTLAGLIDSRIPLGGLTVYG 1139
            Y +     + LA LID  IPL GL   G
Sbjct: 1290 YTDAHGSAKYLAELIDPTIPLTGLVPTG 1317

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 5/94 (5%)

Query: 911  TYSNDYAWLPTTIIV---EPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVG 967
            T S++  W+PT +I    E + T SST     ++T  LP  I  A  V EP  +TLIT+G
Sbjct: 954  TSSDNNWWIPTELITQAPEAASTASSTVGGTQTMT--LPHAIAAATQVPEPEGYTLITIG 1011

Query: 968  FTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPFSN 1001
            F   LNYEF+V  P SSAQIF +LP  L  PF N
Sbjct: 1012 FKKALNYEFVVSEPKSSAQIFGYLPEALNTPFKN 1045

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V QIVP+ + S  Y+++VAEVYFPT  I  L  LI ++SS  Y +     +++A ++D
Sbjct: 1050 ITVLQIVPLQDDSLNYLVSVAEVYFPTAEIEELSNLITNSSSAFYTDGMGTAKSMAAMVD 1109

Query: 1128 SRIPLGGL 1135
            S IPL GL
Sbjct: 1110 SSIPLTGL 1117

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa] {ON}
            some similarities with uniprot|P32334 Saccharomyces
            cerevisiae YGR014W MSB2 Mucin family member at the head
            of the Cdc42p- and MAP kinase-dependent filamentous
            growth signaling pathway also functions as an osmosensor
            in parallel to the Sho1p-mediated pathway potential
            Cdc28p substrate
          Length = 908

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (62%), Gaps = 2/89 (2%)

Query: 917  AWLPTTIIVE--PSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNY 974
             WLPTT++ E   S T S++   +   T +LP  I  A  + +PA +TLITVGF   LNY
Sbjct: 534  VWLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGYTLITVGFKKELNY 593

Query: 975  EFLVQNPLSSAQIFNFLPLVLGYPFSNTR 1003
             F V NP+S+AQIF FLP VL YPF+  +
Sbjct: 594  PFTVNNPVSNAQIFEFLPKVLNYPFNGAQ 622

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%)

Query: 1070 VKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSR 1129
            V ++VP+  +S  Y++ VA+VYFP +++S LQ  IL++SS IYNN  T L+ L+  ID+ 
Sbjct: 629  VLELVPLKVTSLDYLVTVAKVYFPEDSVSTLQAQILNSSSVIYNNDVTALKQLSSYIDAS 688

Query: 1130 IPLGGL 1135
            IPL GL
Sbjct: 689  IPLTGL 694

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON}
           Anc_4.150
          Length = 785

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 56/86 (65%), Gaps = 3/86 (3%)

Query: 915 DYAWLPTTIIVEPSQ-TGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLN 973
           D  W+PT +I   +Q TGS  A  + + T +LP +I  A +V  P  +T+IT+GF   LN
Sbjct: 449 DNWWIPTQLITASTQVTGS--AMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALN 506

Query: 974 YEFLVQNPLSSAQIFNFLPLVLGYPF 999
           YEF+V +P SSAQIF+FLP VL  PF
Sbjct: 507 YEFIVSSPKSSAQIFSFLPYVLNTPF 532

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 38/68 (55%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V ++VP+      Y I VAEV FP  AI+ L   I D +S +Y      LR+LA LID
Sbjct: 539  ITVSRLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLALLID 598

Query: 1128 SRIPLGGL 1135
              IPL GL
Sbjct: 599  PSIPLTGL 606

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 75.9 bits (185), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 69/126 (54%), Gaps = 8/126 (6%)

Query: 876  TRASLGSVVTALQTQTITGS--DSVIPVSFTHPTTPYTYSNDYAWLPTTIIVEPSQTGSS 933
            TRA   + +  + T TI GS   S I  +FT      + SN   WLP+T++VE + +GS+
Sbjct: 1516 TRAISDNPIGYIDTATIDGSTYSSTIKSTFTT----KSVSNGSNWLPSTLVVENNPSGSA 1571

Query: 934  TAPFNPSITGSLPSLIEPAVAVSEPA--NHTLITVGFTAGLNYEFLVQNPLSSAQIFNFL 991
               FNPS T   P  I P     +PA  +  LI V     LNY FL++N +SSAQ+ N++
Sbjct: 1572 NMQFNPSETFKWPRAITPENQNEKPAPVDSQLILVALDRPLNYPFLIENLVSSAQVMNYI 1631

Query: 992  PLVLGY 997
            P +L Y
Sbjct: 1632 PFILSY 1637

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 52/101 (51%), Gaps = 9/101 (8%)

Query: 1047 EKRNATASTADLY---LPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKL 1103
            E  + T +++ LY    P IE     VKQI+P++   + Y +A  +VY P   +  LQ  
Sbjct: 1758 ETSDITPTSSSLYPSLYPGIE-----VKQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAY 1812

Query: 1104 ILDASSPIYNNPQTPLRTLAGLIDSRIPLGGLTVYG-AEDG 1143
            I D  S +Y+NP    R L+  IDS IP+ G   Y  A DG
Sbjct: 1813 IYDLDSILYHNPVYIARELSNFIDSSIPIVGSGKYWTAYDG 1853

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score = 73.2 bits (178), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 8/91 (8%)

Query: 918  WLPTTIIVEPSQTGSSTAPFNPS-------ITGSLPSLIEPAVAVSEPANHTLITVGFTA 970
            WLPT +I   + T S+ +P + S        T +LP  I     V +P  +TLITVGF  
Sbjct: 1224 WLPTAMITANANTESA-SPTDSSDPKDAQQATKTLPQAIGAPTEVVQPEGYTLITVGFKK 1282

Query: 971  GLNYEFLVQNPLSSAQIFNFLPLVLGYPFSN 1001
             LNY F+V NP++SAQIF FLP  L  PF N
Sbjct: 1283 ALNYPFVVGNPVTSAQIFAFLPDTLNSPFDN 1313

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 62/110 (56%), Gaps = 10/110 (9%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V ++ P+  SS+ Y++ VAEVYFP+  +  LQKLI + +S  Y    T    +A L+D
Sbjct: 1318 ITVARLGPLKVSSRDYLLTVAEVYFPSAQVENLQKLIQNDASKFYFVNGTSRNVVASLVD 1377

Query: 1128 SRIPLGGL--------TVYGAEDGSYISGLSSS--VADSSKENPAGKVGT 1167
            + IPL GL        +  G+E GS  +  SSS    DSS+++  G +GT
Sbjct: 1378 ATIPLTGLLQDDGSTTSETGSESGSPSNTGSSSNEGTDSSEQSSHGNLGT 1427

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 72.8 bits (177), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 5/87 (5%)

Query: 918  WLPTTIIVEPS-----QTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGL 972
            WLPT ++   S     Q+GS+ +  +   T +LP  I     VS+P  +TLIT+GF   L
Sbjct: 1179 WLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGFKQAL 1238

Query: 973  NYEFLVQNPLSSAQIFNFLPLVLGYPF 999
            NY F+V N ++SAQIF +LP  L +PF
Sbjct: 1239 NYPFVVTNAVTSAQIFAYLPETLNFPF 1265

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 1066 SSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGL 1125
            S I V ++ P+  S++ Y++ +AEVYFP+  +  LQ LI +  S  Y    T    LA  
Sbjct: 1270 SDITVARLGPLKVSNRDYLLTIAEVYFPSAQVENLQTLIQNDESKFYAKNAT-KNLLAAF 1328

Query: 1126 IDSRIPLGGL 1135
            +D+ IPL GL
Sbjct: 1329 VDATIPLTGL 1338

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 914  NDYAWLPTTIIVEPSQTGSS-TAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGL 972
            N++ W+PT +I +  +T S+ ++    + T +LP  +  A  + E   ++LITVGF   L
Sbjct: 820  NNW-WIPTELITQAPETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKPL 878

Query: 973  NYEFLVQNPLSSAQIFNFLPLVLGYPFSN 1001
            NYEF+V  P SSAQIF +LP  L  PF N
Sbjct: 879  NYEFVVSEPKSSAQIFGYLPAALNTPFKN 907

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V QIVP+ + S  Y+I+VAEVYFPT  +  L  LI++ SS  Y +     +++A ++D
Sbjct: 912  ITVLQIVPLQDDSLNYLISVAEVYFPTAEVEELSNLIMNTSSTFYTDGTGTAKSMAAMVD 971

Query: 1128 SRIPLGGL 1135
              IPL GL
Sbjct: 972  PSIPLTGL 979

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 72.4 bits (176), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 914  NDYAWLPTTIIVEPSQTGSSTAPFNPSITGS-LPSLIEPAVAVSEPANHTLITVGFTAGL 972
            N++ W+PT +I + ++  SS +          LP  I  A  ++EP  ++LIT+GF   L
Sbjct: 787  NNW-WIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKAL 845

Query: 973  NYEFLVQNPLSSAQIFNFLPLVLGYPFSN 1001
            NYEF+V  P SSAQIF +LP  L  PF +
Sbjct: 846  NYEFVVSEPKSSAQIFAYLPEALNTPFKD 874

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 43/68 (63%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V QIVP+ +   +Y+++VAEVYFPT  I  L  LI + SS  Y +     +++A ++D
Sbjct: 879  ISVLQIVPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNTSSSFYTDGMGTAKSMAAMVD 938

Query: 1128 SRIPLGGL 1135
            + IPL GL
Sbjct: 939  ASIPLTGL 946

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 55/90 (61%)

Query: 912  YSNDYAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAG 971
            +SN   W+ + ++    +  ++T     + TGSLP  I     V+ P +++LIT+GF   
Sbjct: 585  HSNPNWWVASDLMTASEEASTTTRASATTATGSLPQAIAAPTEVTAPDDYSLITIGFKKA 644

Query: 972  LNYEFLVQNPLSSAQIFNFLPLVLGYPFSN 1001
            LNYEF+V  P SSAQ+F++LP+ L  PF+N
Sbjct: 645  LNYEFVVNTPESSAQLFSYLPIALNTPFNN 674

 Score = 65.5 bits (158), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 43/68 (63%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V QIVP+V SS  Y I VAEVYFP + I+ LQ++I D SS ++       +TL  LID
Sbjct: 679  ISVYQIVPLVESSLNYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLID 738

Query: 1128 SRIPLGGL 1135
              IPL GL
Sbjct: 739  PSIPLVGL 746

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 6/84 (7%)

Query: 1066 SSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGL 1125
            S+I V Q+VP+ +SS +Y + VAEVYFPT  I+ L +L+ D SS +Y      L+TLA +
Sbjct: 735  SNISVLQLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLADM 794

Query: 1126 IDSRIPLGGL------TVYGAEDG 1143
            ID  IP+ GL      TV G+ DG
Sbjct: 795  IDPSIPITGLVKNATQTVDGSSDG 818

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 3/87 (3%)

Query: 918  WLPTTIIVEPS--QTGSST-APFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNY 974
            W+PT ++ E +  +T S+T +  +PS T  +P +I     V+    +TLIT+GF   L+Y
Sbjct: 646  WIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGFKKPLHY 705

Query: 975  EFLVQNPLSSAQIFNFLPLVLGYPFSN 1001
            EF+V  P SSAQI +FLP +L  P+ N
Sbjct: 706  EFVVTQPKSSAQIISFLPNLLNQPYGN 732

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
           Anc_4.150 YGR014W
          Length = 826

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 918 WLPTTIIVEPSQTGSSTAPFNP-SITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEF 976
           W+PT II E  +T +S +     S T   P  I     +  P+ +TLIT+GF   LNY+F
Sbjct: 488 WVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEALNYDF 547

Query: 977 LVQNPLSSAQIFNFLPLVLGYPF 999
           ++ NP+SSAQIF FLP  L  PF
Sbjct: 548 VLDNPVSSAQIFAFLPEALDLPF 570

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 41/70 (58%)

Query: 1066 SSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGL 1125
            SS+ + ++VP   S+  Y + VAEVYFP+++I  L  LI D+ SP+Y         L  L
Sbjct: 576  SSVSILKLVPYSLSNYNYTVLVAEVYFPSDSIDELSSLIKDSDSPLYTLNTGSRLALVNL 635

Query: 1126 IDSRIPLGGL 1135
            ID  IPL GL
Sbjct: 636  IDQNIPLTGL 645

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 69.7 bits (169), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V  +VP  ++   Y+I +A VYFPT+ I +L++LI D SS  Y   Q   R LA L+D
Sbjct: 1583 ISVNNLVPYNDTKSDYLITIATVYFPTDEIKHLRELIHDKSSSFYTASQDVARQLANLVD 1642

Query: 1128 SRIPLGGLTVYGAED 1142
              IPL GL ++G  D
Sbjct: 1643 PSIPLTGLNLFGNSD 1657

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 7/84 (8%)

Query: 918  WLPTTIIVEPSQ--TGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975
            W+PT++ V  +   T +ST P     T ++P  I        P NH+LIT+GF   LNYE
Sbjct: 1498 WIPTSLAVASTMNSTDTSTLP-----TQAIPQAIGSVEQPPAPENHSLITIGFKKELNYE 1552

Query: 976  FLVQNPLSSAQIFNFLPLVLGYPF 999
            F+V +P+S AQI N+LP  L   F
Sbjct: 1553 FVVSHPMSGAQIINYLPNTLVNAF 1576

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
           similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 52/99 (52%), Gaps = 23/99 (23%)

Query: 918 WLPTTIIVE-----------------PSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPAN 960
           WLPT I+ E                 P+ + +STA        +LP  I  A       N
Sbjct: 776 WLPTAILTESDADSEPTVTVTDTETKPTTSMASTA------IQTLPKFISSANGKIPEGN 829

Query: 961 HTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPF 999
           +TLITVGF   LNY F+V NP+SSAQIF+FLP VL YP+
Sbjct: 830 YTLITVGFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPY 868

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 52/84 (61%), Gaps = 7/84 (8%)

Query: 1059 YLPSI-------ETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPI 1111
            +LP++         +++ V +++P+ + S+ Y++ VA V+FPTE +  L +L+ D +S +
Sbjct: 859  FLPNVLNYPYGFRCANVSVWRLLPLKSGSRDYLVTVAAVFFPTEHLDELARLVADNTSSL 918

Query: 1112 YNNPQTPLRTLAGLIDSRIPLGGL 1135
            Y++     +T+A LID  IPL G+
Sbjct: 919  YSSYDETGKTMASLIDPMIPLTGI 942

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V+Q+VP+ + + +Y+  VAEVYFPT  IS L KLI + SS +Y + + P + LA LID
Sbjct: 882  ITVQQLVPLQSKAVSYLATVAEVYFPTSEISALSKLISNTSSNLYTDVEGPAKYLAYLID 941

Query: 1128 SRIPLGGL 1135
            + IPL GL
Sbjct: 942  ASIPLTGL 949

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 10/118 (8%)

Query: 885  TALQTQTITGSDSVIPVSFTHPTTPYTYSNDYAWLPTTIIVE-PSQTGSSTAPFNPSITG 943
            T LQ  T  G+D+   V         T S++  W+PT +I + P    ++++  + + T 
Sbjct: 818  TVLQPSTTNGTDNYSSV---------TSSDNNWWIPTELITQAPEAASTASSTASGTQTM 868

Query: 944  SLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPFSN 1001
            +LP  I  A  +     ++LITVGF   LNYEF+V  P SSAQIF +LP  L  PF N
Sbjct: 869  TLPHAIAAATQIPASEGYSLITVGFKRALNYEFVVSEPKSSAQIFGYLPEALNTPFKN 926

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 43/68 (63%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLID 1127
            I V QIVP+ + S +Y+++VAEVYFPT  +  L  LI + SS  Y +     +++A ++D
Sbjct: 931  ISVLQIVPLQDDSLSYLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAAMVD 990

Query: 1128 SRIPLGGL 1135
              IPL GL
Sbjct: 991  PSIPLTGL 998

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR014W
           (MSB2)
          Length = 1105

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 10/92 (10%)

Query: 918 WLPTTIIVE----------PSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVG 967
           WLPT II            P  T S   P       +LP +I     V+   ++TLIT+G
Sbjct: 757 WLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLITIG 816

Query: 968 FTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPF 999
           F   LNY F+  NP ++AQIF++LP +L YPF
Sbjct: 817 FKKQLNYPFIAMNPFANAQIFDYLPGILNYPF 848

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 53/88 (60%), Gaps = 7/88 (7%)

Query: 1059 YLPSI-------ETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPI 1111
            YLP I       E + I V Q+VP+  +SK Y+  +A+VYFP+E +  L KL++D +S +
Sbjct: 839  YLPGILNYPFNFEYADISVIQLVPLKANSKDYIATIAQVYFPSEKVDELAKLVVDTNSEL 898

Query: 1112 YNNPQTPLRTLAGLIDSRIPLGGLTVYG 1139
            Y++    ++  A LID ++PL GL   G
Sbjct: 899  YSSYDANMKVFASLIDPQLPLTGLAGKG 926

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
           complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 59.3 bits (142), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 47/82 (57%)

Query: 918 WLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFL 977
           W+PT++I E   T S+      S T S+P  I  +   + P   +L+T+GF   LNY+F+
Sbjct: 643 WVPTSLITESDVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQFV 702

Query: 978 VQNPLSSAQIFNFLPLVLGYPF 999
           + + ++ AQIF FLP  L  PF
Sbjct: 703 LSSSVTVAQIFAFLPGGLIAPF 724

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%)

Query: 1064 ETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLA 1123
            + +++ V ++ P+   +  Y + VAEVYFPT  I  L   + D+ S +Y N       L 
Sbjct: 727  QLANVTVYRLSPLNYGNFNYTLTVAEVYFPTSKIDELAAFVADSESALYVNASGTEEELV 786

Query: 1124 GLIDSRIPLGGL 1135
             LID RIP+ GL
Sbjct: 787  SLIDPRIPITGL 798

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
           similar to uniprot|P32334 Saccharomyces cerevisiae
           YGR014w MSB2 multicopy suppressor of a CDC24 bud
           emergence defect
          Length = 936

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (59%), Gaps = 4/87 (4%)

Query: 917 AWLPTTIIVEPSQTGSSTAPF---NPSITGSLPSLI-EPAVAVSEPANHTLITVGFTAGL 972
           AW+PT++I+ P++T S + P    + +   SLP +I   A + S P  +++IT+GF   L
Sbjct: 590 AWIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKPL 649

Query: 973 NYEFLVQNPLSSAQIFNFLPLVLGYPF 999
           NY F+V    SSAQI  +LP +L   F
Sbjct: 650 NYPFVVSESKSSAQIMYYLPKLLNANF 676

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 1066 SSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNP-QTPLRTLAG 1124
            S I   Q++P+      Y+  VA ++FPT  I  L  ++ + SS +Y+   +T  ++L+ 
Sbjct: 681  SDIKTVQLMPLEIQDSGYLSTVALLFFPTSEIQSLSNMVKNTSSSLYSTQYETITQSLSA 740

Query: 1125 LIDSRIPLGGLT 1136
            LID RIP+ GLT
Sbjct: 741  LIDPRIPVTGLT 752

>Smik_12.85 Chr12 complement(170982..171734) [753 bp, 250 aa] {ON}
            YLR022C (REAL)
          Length = 250

 Score = 35.0 bits (79), Expect = 0.94,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 1068 IVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPI-YNNPQTPLRTLAGLI 1126
            +V KQI+P+V +     +A+ E Y  +E I  + +LI  A+SP    NP     T  GLI
Sbjct: 161  LVSKQIIPIVRAKMKVKVAICEPYNQSELIEKVSRLI--ATSPTDLANPDLNPWTCVGLI 218

Query: 1127 D 1127
            D
Sbjct: 219  D 219

>Ecym_5325 Chr5 complement(662187..663197) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AER026C
          Length = 336

 Score = 33.9 bits (76), Expect = 3.3,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 570 FSSKQFLSTSDGVTPVISVHIMSSGPTNSLQQNSMETQKSHPTSTGSSLNSDAYSNTITV 629
            S+  ++STS    PVI + + S  P N LQQ+ M  Q+  PTS     +  + S  +  
Sbjct: 167 LSASNYISTSGVFNPVIRIDLNSKDPGNILQQDFM--QRQIPTSDHDRFDLISCSLVLNF 224

Query: 630 ISIRF 634
           +S  +
Sbjct: 225 VSTHY 229

>YOR035C Chr15 complement(397735..400104) [2370 bp, 789 aa] {ON}
           SHE4Protein containing a UCS (UNC-45/CRO1/SHE4) domain,
           binds to myosin motor domains to regulate myosin
           function; involved in endocytosis, polarization of the
           actin cytoskeleton, and asymmetric mRNA localization
          Length = 789

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 57/116 (49%), Gaps = 11/116 (9%)

Query: 215 LFSATPITTTDGSNHEATGNHLISTKLSTASIEEYTIDESDFSDYYGSSVNDYFAQELIV 274
           L + T + +++ S+ E    H++STK+  ++IE   +DE+       S++      ELI 
Sbjct: 591 LLALTNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDEN--VPLQRSTL------ELIS 642

Query: 275 DLSSTPFTTKASSVTSQNPDVEYSKLATDLRVSSTSFAETASSKTVSSSYTHLSST 330
           ++ S P T  A     +NP    S    ++ V     ++  S + V++ + ++++T
Sbjct: 643 NMMSHPLTIAAKFFNLENPQ---SLRNFNILVKLLQLSDVESQRAVAAIFANIATT 695

>Ecym_5310 Chr5 (630371..631063) [693 bp, 230 aa] {ON} similar to
            Ashbya gossypii AER014W
          Length = 230

 Score = 33.1 bits (74), Expect = 4.4,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 1309 DLNQLNGGEDLEI--------DVIVRECVYDKDQDTTEAYLNDGESVSSILDVDENGNIR 1360
            D+ QL+G ED ++          I++  V+ +D D      + G++  ++LD +E G   
Sbjct: 87   DVVQLHGSEDWQLFRAELPANMAIIKRFVFPRDCDRILEMCSKGQNCFALLDTEEGGTGE 146

Query: 1361 LHDSYSDDGESNRYHLQDEV 1380
            L D + + GE +R H  DEV
Sbjct: 147  LLD-WKEIGEWSRKH--DEV 163

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.121    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,671,391
Number of extensions: 6068201
Number of successful extensions: 48166
Number of sequences better than 10.0: 968
Number of HSP's gapped: 38977
Number of HSP's successfully gapped: 3210
Length of query: 1504
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1381
Effective length of database: 39,377,481
Effective search space: 54380301261
Effective search space used: 54380301261
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 72 (32.3 bits)