Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6405.441ON51151125500.0
YDR371W (CTS2)5.441ON51151121890.0
Suva_2.5435.441ON51151121460.0
Smik_4.6375.441ON51148221020.0
NCAS0F034205.441ON52551111701e-155
ZYRO0F10186g5.441ON51949811571e-153
TDEL0D026005.441ON52350911131e-147
Kpol_1062.255.441ON53346511081e-146
TBLA0A027905.441ON54752310821e-142
NDAI0B057105.441ON56347410801e-141
TPHA0E017205.441ON53745510171e-132
CAGL0A02904g5.441ON50149410031e-130
SAKL0G02684g5.441ON53945310021e-130
KAFR0E038105.441ON4904519411e-121
KNAG0C048705.441ON4584319031e-116
KLTH0F15906g5.441ON5154458781e-112
Kwal_55.214025.441ON5164458671e-110
KLLA0E02333g5.441ON4804878571e-109
Ecym_45125.441ON5274508331e-105
ACL166W5.441ON4904508131e-102
TPHA0P017102.18ON356101713.9
TBLA0F036508.180ON38281704.5
Smik_8.452.500ON39590704.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.640
         (511 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   986   0.0  
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   847   0.0  
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   831   0.0  
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   814   0.0  
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   455   e-155
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   450   e-153
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   433   e-147
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   431   e-146
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   421   e-142
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   420   e-141
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   396   e-132
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   390   e-130
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   390   e-130
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   367   e-121
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   352   e-116
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   342   e-112
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   338   e-110
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   334   e-109
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   325   e-105
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   317   e-102
TPHA0P01710 Chr16 complement(357242..358312) [1071 bp, 356 aa] {...    32   3.9  
TBLA0F03650 Chr6 complement(897483..898631) [1149 bp, 382 aa] {O...    32   4.5  
Smik_8.45 Chr8 (78091..79278) [1188 bp, 395 aa] {ON} YHL004W (REAL)    32   4.9  

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/511 (94%), Positives = 481/511 (94%)

Query: 1   MLGYSEQQRSKXXXXXXXXXXXXXXXXXXEMCLYNKIFKSQRSDDIRDNFRNGGDQVPSM 60
           MLGYSEQQRSK                  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSM
Sbjct: 1   MLGYSEQQRSKTSIISHLLILLIIITIIIEMCLYNKIFKSQRSDDIRDNFRNGGDQVPSM 60

Query: 61  VQNQKPHDXXXXXXXXXXXXNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIEST 120
           VQNQKPHD            NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIEST
Sbjct: 61  VQNQKPHDGGKGYVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIEST 120

Query: 121 DSWSDLEMNLYKPLAIKSSQLVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSI 180
           DSWSDLEMNLYKPLAIKSSQLVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSI
Sbjct: 121 DSWSDLEMNLYKPLAIKSSQLVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSI 180

Query: 181 GGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVK 240
           GGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVK
Sbjct: 181 GGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVK 240

Query: 241 MLRLKLNNLESQIFGESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGS 300
           MLRLKLNNLESQIFGESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGS
Sbjct: 241 MLRLKLNNLESQIFGESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGS 300

Query: 301 WSETTGYHSNLFSETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQ 360
           WSETTGYHSNLFSETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQ
Sbjct: 301 WSETTGYHSNLFSETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQ 360

Query: 361 NTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIF 420
           NTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIF
Sbjct: 361 NTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIF 420

Query: 421 ISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMF 480
           ISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMF
Sbjct: 421 ISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMF 480

Query: 481 QDMRVIKFYLNKYGDDGFLSPYLKHLESSKQ 511
           QDMRVIKFYLNKYGDDGFLSPYLKHLESSKQ
Sbjct: 481 QDMRVIKFYLNKYGDDGFLSPYLKHLESSKQ 511

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/511 (79%), Positives = 445/511 (87%)

Query: 1   MLGYSEQQRSKXXXXXXXXXXXXXXXXXXEMCLYNKIFKSQRSDDIRDNFRNGGDQVPSM 60
           M+G+S Q RSK                  EMCLYNKIFK+QRSDDIRDNF NGG +VPS 
Sbjct: 1   MVGHSAQHRSKSSLVSHLLILLIFITIIIEMCLYNKIFKNQRSDDIRDNFNNGGHRVPSN 60

Query: 61  VQNQKPHDXXXXXXXXXXXXNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIEST 120
           VQN   H             NWSPY PRFHFPHDINL QVSH+YYAFF+INS+TGGIE+T
Sbjct: 61  VQNHGTHIRDEAFISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENT 120

Query: 121 DSWSDLEMNLYKPLAIKSSQLVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSI 180
           DSWSDLEMNLYK LAIK+S+L++ + N+SVQNILPLGC+GELFYLKN CS+KKFKVIMSI
Sbjct: 121 DSWSDLEMNLYKSLAIKNSELIKESSNNSVQNILPLGCIGELFYLKNTCSDKKFKVIMSI 180

Query: 181 GGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVK 240
           GGWSDSENFK I+ DDKLLQNFVDSSVETMF+LGFDGID+DWEFP NN+ EP+GYLKLV+
Sbjct: 181 GGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVR 240

Query: 241 MLRLKLNNLESQIFGESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGS 300
           MLRLKLN+LESQIFG+  EDHFQ+SIAAPAFKDKLF+LPI+EIDQY+DYWNMMTYDYYGS
Sbjct: 241 MLRLKLNSLESQIFGKRTEDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGS 300

Query: 301 WSETTGYHSNLFSETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQ 360
           WSETTGYHSNLFSETEL+GNFAMHYMID F V+S KLVLGMAAYGRSFHIKD+KF+PF Q
Sbjct: 301 WSETTGYHSNLFSETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQ 360

Query: 361 NTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIF 420
           NTVLIN+ FKGVGKP KEIDKADGKEGIWPYK+LPK GTIEQYDPKYVSAYCFDEKNSIF
Sbjct: 361 NTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIF 420

Query: 421 ISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMF 480
           ISYDNTKS KTKAEYV HN LGGGFWWESCGEA+ N+SRSLINAFNEG+ FNVSSKPS+F
Sbjct: 421 ISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSIF 480

Query: 481 QDMRVIKFYLNKYGDDGFLSPYLKHLESSKQ 511
           QD+RV K+YLNKYGD GFLSPYLKHL+S KQ
Sbjct: 481 QDVRVKKYYLNKYGDGGFLSPYLKHLDSRKQ 511

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/511 (78%), Positives = 445/511 (87%), Gaps = 1/511 (0%)

Query: 1   MLGYSEQQRSKXXXXXXXXXXXXXXXXXXEMCLYNKIFKSQRSDDIRDNFRNGGDQVPSM 60
           M+ +S+  RS                   EMCLYNK+FK+QRS+DIRDNF+NG  QVP+M
Sbjct: 1   MVEHSQHHRSNTSIISHLLILLIAITIIIEMCLYNKLFKNQRSEDIRDNFQNGRHQVPNM 60

Query: 61  VQNQKPHDXXXXXXXXXXXXNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIEST 120
           VQNQKP              NWSPY PRFHFPHDINL QVSHVYYAFFRI+ KTG I ST
Sbjct: 61  VQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGST 120

Query: 121 DSWSDLEMNLYKPLAIKSSQLVENNLNDS-VQNILPLGCVGELFYLKNACSEKKFKVIMS 179
           DSWSDLEM+LYKPLAIK+SQLV++NL+D+ +Q+ILPLGC+GELFYLKNACS +KFK IMS
Sbjct: 121 DSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMS 180

Query: 180 IGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLV 239
           IGGWSDSENFKTIV ++KLLQNFVDSSVETMFKLGFDGIDIDWEFPENNK+EPQGYLKLV
Sbjct: 181 IGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLV 240

Query: 240 KMLRLKLNNLESQIFGESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYG 299
           +MLRLKLN+LESQIFG S +DHF++SIAAPAFKDKL+FLPI+EIDQYID+WNMMTYDYYG
Sbjct: 241 RMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYG 300

Query: 300 SWSETTGYHSNLFSETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFT 359
           SWSETTGYHSNLFSETELSGNFA+HYMI EF V+  KLVLGMAAYGRSFHIKD KF+PFT
Sbjct: 301 SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT 360

Query: 360 QNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSI 419
           +NTVLINQ FKGVGKPGKEIDKADGKEGIWPYK+LPKKGT EQYDPKYVSAYCFDEKNSI
Sbjct: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420

Query: 420 FISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSM 479
           FI YDNT+S KTKA+YVMH +LGGGFWWESCGE + +KSRSLINAFNE + FNVSSKPSM
Sbjct: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480

Query: 480 FQDMRVIKFYLNKYGDDGFLSPYLKHLESSK 510
           FQD RV+K+YL+KYGD GFL+PYLKHLES K
Sbjct: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESLK 511

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/482 (79%), Positives = 432/482 (89%)

Query: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDXXXXXXXXXXXXNWSPYTPRF 89
           EMCLY KIFK+QRS+ IRD+F NGG +VP+M Q Q P+             NWSPY PRF
Sbjct: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYKPRF 89

Query: 90  HFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENNLNDS 149
           HFPHDINL QVSHVYYAFFRIN +TGGIESTD+WSDLEMNLYKPLAIKSS+L++ N ++ 
Sbjct: 90  HFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSSND 149

Query: 150 VQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSVET 209
           +Q ILPLGC+GELFYLK++CS KKFKVIMSIGGWSDSENFK I+ ++ LLQ FVDSSVET
Sbjct: 150 IQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDSSVET 209

Query: 210 MFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIEDHFQISIAAP 269
           MFKLGFDGID+DWEFPENNK EPQGYLKLV+MLR KLN+LESQIFGE +EDHFQ+SIAAP
Sbjct: 210 MFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGVEDHFQLSIAAP 269

Query: 270 AFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETELSGNFAMHYMIDE 329
           AFKDKL++LPI EIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETELSGNFA+HYMID+
Sbjct: 270 AFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETELSGNFAIHYMIDK 329

Query: 330 FSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIW 389
           F ++S KLVLGMAAYGRSFHIK S FQPFTQNT+LINQ FKGVGK  KE++KADGKEGIW
Sbjct: 330 FGINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIW 389

Query: 390 PYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWES 449
           PYK+LPKKGTIE+YDPKYVSAYCFDEKNSIFISYDNTKS KTKAEYV+HNKLGGGFWWES
Sbjct: 390 PYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWES 449

Query: 450 CGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLKHLESS 509
           CGE + N+SRSLI+AFNEG+R NVS+KPSMF++ RV+ FYLNKYG++GFL+PYLKH++S 
Sbjct: 450 CGETYANESRSLIHAFNEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLTPYLKHMDSF 509

Query: 510 KQ 511
           KQ
Sbjct: 510 KQ 511

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  455 bits (1170), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 243/511 (47%), Positives = 326/511 (63%), Gaps = 50/511 (9%)

Query: 30  EMCLYNKIFKSQRSDD-IRDNFRNG---GDQVPSMVQNQKPHDXXXXXXXXXXXXNWSPY 85
           +MCL+   FK + + D I+ +FRNG     Q    + NQ   +            +WSPY
Sbjct: 27  QMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKGYLSGLYYSSWSPY 86

Query: 86  TPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENN 145
            PRFHFPHDI+L +VSH+YYAFF ++ KTG +  +D WSDL+M+LYKPL++K   L   N
Sbjct: 87  KPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL---N 143

Query: 146 LNDSVQNI-------LPLGCVGELFYLKNAC---SEKKFKVIMSIGGWSDSENFKTIVGD 195
           L D+ + +       LPLGC+GELFYLK++         K+I+SIGGWS+ + F  +V D
Sbjct: 144 LADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLVRD 203

Query: 196 DKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFG 255
            +  +NF+DS+VETMF+ GFDGID+DWEFP+++ +EP  YL+++  LR K+++LE +IFG
Sbjct: 204 TRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFG 263

Query: 256 ESIEDH--FQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFS 313
           E+ +DH  FQ+S+A PAF  KL  LPI ++DQY+DYWNMMTYDYYGSWSE TGYH NLF+
Sbjct: 264 ET-KDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFN 322

Query: 314 -----------------ETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKF 355
                               L+ N A+ +MI   +V SSK+VLGMAAYGR F H+K  + 
Sbjct: 323 GDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQ- 381

Query: 356 QPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDE 415
                   LINQ FKGVGK G        + G+W Y  LP KGT+E YDP Y +A+C+D+
Sbjct: 382 ----GVDTLINQKFKGVGKGG-----LGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDK 432

Query: 416 KNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIR--FNV 473
           K+  FI YDN  S K KA+YV   +LGGGFWWESCG+ H NK RSL+  F+  +      
Sbjct: 433 KSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKF 492

Query: 474 SSKPSMFQDMRVIKFYLNKYGDDGFLSPYLK 504
           S +  +F+    I +YLN+YG DGFLS  L+
Sbjct: 493 SDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  450 bits (1157), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 228/498 (45%), Positives = 312/498 (62%), Gaps = 35/498 (7%)

Query: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDXXXXXXXXXXXXNWSPYTPRF 89
           EMC Y KIFKS    D+ D+    GD      ++                 +WSPY PR 
Sbjct: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84

Query: 90  HFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQL-VENNLND 148
           HFPHDI+  +VSH+YYAFF I+  TG ++S+D WSD +M+LYKPLA+K +QL ++N+   
Sbjct: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144

Query: 149 SVQNILPLGCVGELFYLKNAC-----SEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFV 203
           +   +LP GCVGELFYL++         + FKV+M++GGWS+ + +  +V D + ++NF+
Sbjct: 145 ASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFI 204

Query: 204 DSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIF-GESIEDHF 262
           +S VETMFK GFDGID+DWEFP+N+  EP+ YL+L + +RLK + LE  IF GE     F
Sbjct: 205 NSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAGEPNHPKF 264

Query: 263 QISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFS--------- 313
           Q+S+A PAFKDKL  LPI E+D+YID WNMMTYDY+G WS  TGYH NL+          
Sbjct: 265 QLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQY 324

Query: 314 -------ETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKFQPFTQNTVLI 365
                  +  L  N A+  MI+ F VDS K+ LGMAAYGR F H+K S     + +   I
Sbjct: 325 KHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS-----SNDKRFI 379

Query: 366 NQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDN 425
           ++ F GVG        ++G+ G+W Y  LP KG+ E+YDP+YVS +CFD K   F+ YDN
Sbjct: 380 DKSFHGVGG------ASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDN 433

Query: 426 TKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRV 485
            +S K KA+YV    L GGFWWESCG+ H +  RSL+NAF   I+    ++ S++     
Sbjct: 434 VESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEA 493

Query: 486 IKFYLNKYGDDGFLSPYL 503
           +++YL K+G D FLSP++
Sbjct: 494 LRYYLEKFGQDEFLSPFI 511

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  433 bits (1113), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 225/509 (44%), Positives = 317/509 (62%), Gaps = 41/509 (8%)

Query: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDXXXXXXXXXXXXNWSPYTPRF 89
           EMC Y KIF       + D  ++   Q   +V N    +            NWSPY+PR 
Sbjct: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQA-QLVTNPGTVEPGQYLSGLYYS-NWSPYSPRM 80

Query: 90  HFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQL---VENNL 146
           HFPHDI+L +VSH+YYAFF ++  TG ++  D WSD+ M+LYKP+AIK ++L   V+N+L
Sbjct: 81  HFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKNDL 140

Query: 147 NDSVQNILPLGCVGELFYLKNAC-----SEKKFKVIMSIGGWSDSENFKTIVGDDKLLQN 201
            +  + ILP GC+GELFY++NA      + + FKVIM +GGWS+ E F  +V + K +  
Sbjct: 141 -ERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDK 199

Query: 202 FVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESI-ED 260
           F+DS +ETMFK GFDGID+DWEFPE++  EPQ YL+L K L+ ++N LE  IFG ++   
Sbjct: 200 FIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHP 259

Query: 261 HFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNL-------FS 313
            FQ+S+A PAF +KL  LPI+E+D+YID WNMMTYDY+G WSE TGYH NL       F 
Sbjct: 260 KFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFD 319

Query: 314 ETE------------LSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQN 361
           ET             L  + A+ +M++   V+S K+ LGMAAYGR F    +     + +
Sbjct: 320 ETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGF----TNVVAQSTD 375

Query: 362 TVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFI 421
              I++ F GVG        +DG+ G+W Y  LP +GT E +DP YVS +C+   +  F+
Sbjct: 376 KRFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFV 429

Query: 422 SYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQ 481
            YD+ +S + KA+YV    L GGFWWESCG+ H N+SRSL+NAF   I+F       M++
Sbjct: 430 GYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYR 489

Query: 482 DMRVIKFYLNKYGDDGFLSPYLKHLESSK 510
              V+++Y+NK+G+D FLSP++ +L + +
Sbjct: 490 QTPVLRYYVNKFGNDAFLSPFILNLLAGQ 518

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  431 bits (1108), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 213/465 (45%), Positives = 305/465 (65%), Gaps = 49/465 (10%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           NWSPYTPR H PHD++  +++HVYYAFF ++SKTG + ++D+WSD EM+ YKPLA+K  +
Sbjct: 72  NWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKK 131

Query: 141 L-VENNLNDSVQNILPLGCVGELFYLK-----NACSEKKFKVIMSIGGWSDSENFKTIVG 194
           L +++  N   +N LP+GC+GELFYL+     ++ + +KFK+IMS+GGWS+ E F  ++ 
Sbjct: 132 LQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRMIR 191

Query: 195 DDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIF 254
           D K L  FV+S +E MF  GFDGI++DWEFP+++K+EP+ YL+LVK L+ K N LE +IF
Sbjct: 192 DSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKIF 251

Query: 255 G------ESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYH 308
                   S    F +SIAAPAFK+KL  L + E+D Y+D WNMMTYDY+G WSE TGYH
Sbjct: 252 NNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGYH 311

Query: 309 SNLFSETE---------------------------LSGNFAMHYMIDEFSVDSSKLVLGM 341
           SNL+S  E                           L+G++A++Y+I ++ ++  K+ LGM
Sbjct: 312 SNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKKINLGM 371

Query: 342 AAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIE 401
           AAYGR F    +K    +Q+T  IN+ ++GVG        ++G+ G+W Y  LP K ++E
Sbjct: 372 AAYGRGF----TKVNASSQDTRFINKPYRGVG------GASEGEPGMWLYNQLPIKNSLE 421

Query: 402 QYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSL 461
           ++DP YVSA+C+D+K+  F+ YDN  S K KA+YV  + L GGFWWESCG+ H N  +SL
Sbjct: 422 EFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSL 481

Query: 462 INAFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLKHL 506
           +NAF + I        +MF ++ V+K+YL   GD GFLS ++  L
Sbjct: 482 LNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKL 526

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  421 bits (1082), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 219/523 (41%), Positives = 321/523 (61%), Gaps = 52/523 (9%)

Query: 30  EMCLYNKIFKSQRSDDIRDNFRNGG-----DQVPSMVQNQKPHDXXXXXXXXXXX----X 80
           EMC Y+K+F  ++   + +  +        + V + +++ K  +                
Sbjct: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           NWSPY+PR HFPHDI+  ++SHVYY+FF +N   G +E  D WSD+EM+LYKPL+IK  +
Sbjct: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144

Query: 141 LV-------ENNLNDSVQNILPLGCVGELFYLKNAC--------SEKKFKVIMSIGGWSD 185
           L        E     +++  LP GC+GE FYL+N+         + K FK+IM+IGGWS+
Sbjct: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204

Query: 186 SENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLK 245
            ++F  +    + + NFV S++E MF+ GFDGID+DWEFP+NN  EP  YLK+++ LR  
Sbjct: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264

Query: 246 LNNLESQIFGES---IED--HFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGS 300
           +N LE +I+  S   +E+  HFQ+S+A+PAF++KL  LPI E+++ +DYWNMMTYDY G 
Sbjct: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324

Query: 301 WSETTGYHSNLFS-------ETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF----- 348
           WSE TGYHSNL+        E  L+ + A+ YMI+   V+ +KLVLG+A YGR +     
Sbjct: 325 WSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNV 384

Query: 349 -HI----KDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQY 403
            HI    K++K +  T + V I+  +KGVG       +++G+ G+W Y  LP KG+IEQ+
Sbjct: 385 NHIQGFGKNNKERELTGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQF 438

Query: 404 DPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLIN 463
           DPK+VSAYC+D K +  ++YDN +S   K +YV    L GGF WESCG+ H N  RSLI 
Sbjct: 439 DPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLIT 498

Query: 464 AFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLKHL 506
           AF   +      + S+FQD +  +FYL ++G++G+LS  +  L
Sbjct: 499 AFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  420 bits (1080), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 219/474 (46%), Positives = 300/474 (63%), Gaps = 59/474 (12%)

Query: 82  WSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQL 141
           WSPY PR+HFPHDI+L +++HVYY+FF +N  TG +  +D WSDL+M+LYKPL++K + L
Sbjct: 102 WSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTL 161

Query: 142 VENN----------LNDSVQNI---LPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSEN 188
            +N+          LN++++ +   LPLGCVGELFYLK     + FK+IMSIGGWS+ E+
Sbjct: 162 HQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKF---QNFKLIMSIGGWSNREH 218

Query: 189 FKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNN 248
           F ++V DD  L  F++SSVE MFK GFDGID+DWEFPE++  EP  YL++V+ LR +++ 
Sbjct: 219 FPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDK 278

Query: 249 LESQIFGES-IEDH----------FQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDY 297
           LE  IF +S I  H          F++S+A PAF +KL  LPI E+++YIDYWNMMTYDY
Sbjct: 279 LEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDY 338

Query: 298 YGSWSETTGYHSNLF------------------SETELSGNFAMHYMIDEFSVDSSKLVL 339
           YG WSE TGYH NL+                  S   L+ N A++YM+   +V S KLVL
Sbjct: 339 YGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVL 398

Query: 340 GMAAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGT 399
           G+AAYGR F    +K +    + + IN+ F GVG        + G+ G+W Y  LP K +
Sbjct: 399 GLAAYGRGF----TKVKVNKNDELFINKKFDGVGGA------SAGEPGMWLYNQLPIKNS 448

Query: 400 IEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSR 459
            E +DP YVSA+C+D K   F+ YDN  + K KA+YV    L GGFWWESCG+ H +  R
Sbjct: 449 KEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPER 508

Query: 460 SLINAFNEGIRFNVSSKPS----MFQDMRVIKFYLNKYGDDGFLSPYLKHLESS 509
           SL+NAF   +      K      +++    IK+YLN +G+DGFLSP+   + S+
Sbjct: 509 SLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQIMSA 562

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  396 bits (1017), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 204/455 (44%), Positives = 289/455 (63%), Gaps = 45/455 (9%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           NWSPY+PR  FPHDI+  +VSHVYY+F  ++   G I+S+D+WSD ++++YKPL +   Q
Sbjct: 86  NWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYKPLYLSLGQ 145

Query: 141 LVENNLNDSV-----QNILPLGCVGELFYLKN------ACSEKKFKVIMSIGGWSDSENF 189
            V+N+  DSV     + +LP+GC+GE FYL+N            FKV MS+GGWS+ E F
Sbjct: 146 -VDNDF-DSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGWSNREAF 203

Query: 190 KTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNL 249
             +V D + +  F++S ++TMF  GFDGID+DWEFPE++  EP  YL ++K L++K+  L
Sbjct: 204 PKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLKMKMLEL 263

Query: 250 ESQIFGESIE-----DHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSET 304
           E+ I+ ++I       HF++SIAAPAF +KL  LP+ ++D+++D WNMMTYDY G WS+ 
Sbjct: 264 EATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYSGEWSDV 323

Query: 305 TGYHSNLFSETELSGNF----------------AMHYMIDEFSVDSSKLVLGMAAYGRSF 348
           TGYHSNLFS  ++SG+                 A+ YM D   + S K++LGMAAYGR F
Sbjct: 324 TGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMAAYGRGF 383

Query: 349 HIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYV 408
               S       N  L  + F GV   G   D+     G+W Y  LP KG+ E++D + V
Sbjct: 384 ----SGVSKSKTNGKLTGKKFNGVS--GSSPDEP----GVWLYNKLPIKGSKEEFDKESV 433

Query: 409 SAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEG 468
           SAYC+D K+ IF++YDN++S   K++YV  N LGGGF WE+CGE   N   SLIN+F   
Sbjct: 434 SAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFD 493

Query: 469 IRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYL 503
           +  N+  + SMF + +V+++YL KYG  GFLS Y+
Sbjct: 494 MN-NIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYI 527

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  390 bits (1003), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 202/494 (40%), Positives = 291/494 (58%), Gaps = 36/494 (7%)

Query: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDXXXXXXXXXXXXNWSPYTPRF 89
           +M L+ KIF+  +     D++R     V S                     NWSPY PR 
Sbjct: 23  QMSLHYKIFQKLKRRSQSDDYRMPESDVLS----------NTSYIAGLYYSNWSPYEPRL 72

Query: 90  HFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENNLNDS 149
           HFPHDI+  +VSH+YYAF  I+ +TG + S+D WSD ++NL K       +    +   +
Sbjct: 73  HFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAKQCREYMFKRFTGDELKA 132

Query: 150 VQNI-LPLGCVGELFYLK---NACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDS 205
           V NI  P GC+GEL YL+   +   ++  K+IMS+GGWS+ E+F  +V D+   +NF++S
Sbjct: 133 VTNIRAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGWSNRESFPIMVRDELKFKNFINS 192

Query: 206 SVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIEDHFQIS 265
            +ETM   GFDGID+DWEFPE++  EP  YL++ + L+L+L  LE+ I G+     FQ+S
Sbjct: 193 CIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEANILGDHSNKTFQLS 252

Query: 266 IAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSE----------- 314
           +A PAFKDKL  LPI ++D+YID WN+MTYDYYG WSE TG H+NL++E           
Sbjct: 253 MATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTGLHANLYNEKGKLLHLHRHD 312

Query: 315 --TELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHFKGV 372
               LSG+ A++YM++   +D  K++LGMAAYGR F   D K    T         F GV
Sbjct: 313 EDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMK---STNPHNPYGLKFSGV 369

Query: 373 GKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTK 432
           G        ++G+ G+W Y  LP  G+ E+YD ++V AYC+D++    + YDN  S   K
Sbjct: 370 G------GASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCYDDRTHTLVGYDNPTSVIEK 423

Query: 433 AEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRVIKFYLNK 492
           A Y+M N LGG FWWESCG+ H N  RSL+N +   IR   ++K +++   ++  +YL  
Sbjct: 424 ANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRNVKNNKETIYSTTKLHDYYLEN 483

Query: 493 YGDDGFLSPYLKHL 506
           Y  +GFL+ ++K +
Sbjct: 484 YDTNGFLTGFIKDI 497

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  390 bits (1002), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 192/453 (42%), Positives = 288/453 (63%), Gaps = 40/453 (8%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIK-SS 139
           NWSPY PR HFPHD+N  ++++V+Y+FF ++ K+G ++S+D WSD +M+LYK    +  +
Sbjct: 97  NWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKA 156

Query: 140 QLVENNLNDSVQN----ILPLGCVGELFYLKNAC---------SEKKFKVIMSIGGWSDS 186
            L+ ++ + + Q+    +LP+GC+GELFYLK +            + FKV MS+GGWS+ 
Sbjct: 157 ALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNR 216

Query: 187 ENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKL 246
           + F  IV D      F+ + VETMF+ GFDG+DIDWEFP+N+ +EP+ YL +++ LR  L
Sbjct: 217 DAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIRRLREAL 276

Query: 247 NNLESQIF-GESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETT 305
           ++LE  IF  E   +HF +++A PAFK+KL  LP+ ++D Y+D+WN+M YDY+G WSE T
Sbjct: 277 DDLERDIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELT 336

Query: 306 GYHSNLFSE--------------TELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIK 351
           GYHSNL+SE               +L+ + A+ Y++  F ++S K+VLGMAAYGR F   
Sbjct: 337 GYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGF--- 393

Query: 352 DSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAY 411
            ++ +    +   I + + GVG        ++G+ G+W Y  LP  GT+E +DP+ VSAY
Sbjct: 394 -TRVKTTANSGSYIGKPYNGVG------GASEGEPGMWLYNQLPLPGTLENFDPRSVSAY 446

Query: 412 CFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRF 471
            FD K+  F+ YDN  S + KA+YV ++ L GGFWWESCG+ H ++ +SL+NAF   +  
Sbjct: 447 SFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGS 506

Query: 472 NVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLK 504
               +PS++    VI++YL  Y   GFLS   K
Sbjct: 507 LAKQQPSIYTSAHVIRYYLKNY-PQGFLSRVFK 538

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  367 bits (941), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 189/451 (41%), Positives = 275/451 (60%), Gaps = 49/451 (10%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           NWS Y PR HFPH+IN   +SHVYYAFF ++ K G + S D W+D +    +P+ +K+++
Sbjct: 66  NWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ----RPI-LKNNK 120

Query: 141 LVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQ 200
           LV+ N             VGELF LK    + + K IM IGGWS+ E +     D   ++
Sbjct: 121 LVKGN-------------VGELFDLK---MKNRVKCIMCIGGWSNREAWHIFSTDPSKIE 164

Query: 201 NFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGES--I 258
           +F + +V+ MF+ GFDGID+DWE+PE++ IEPQ YL++++ ++  +N LES+IF ++   
Sbjct: 165 SFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSAT 224

Query: 259 EDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF------ 312
             +F++S+A PAFKDKL   P+ E+D  IDYWNMMTYDYYG WSE TGYHSNL+      
Sbjct: 225 TSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGS 284

Query: 313 -----------SETE-LSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQ 360
                      SE E L+G++A+ YMI++  +   K++LGMAAYGR F   D       +
Sbjct: 285 TTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRPNE 343

Query: 361 NTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIF 420
           +   I + F GVG        ++G+ G+W Y  LP  GT+EQ+DP+YVS YCF+     F
Sbjct: 344 SPRYIGRTFDGVG------GASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTF 397

Query: 421 ISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGI-RFNVSSKPSM 479
           + YD   S + K +Y+    +GGGFWWESCG+ H N  RSL+NA+ + + R N+    S+
Sbjct: 398 VGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESI 457

Query: 480 FQDMRVIKFYLNKYGDDGFLSPYLKHLESSK 510
           ++++  +  Y   +   GFLS YLK  E ++
Sbjct: 458 YKNLHCVSHYKQSFHGKGFLSKYLKEYEKNE 488

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  352 bits (903), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 179/431 (41%), Positives = 265/431 (61%), Gaps = 38/431 (8%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           +WSPY PR HFP +I+  +++H+YY+FF +++ +  ++  DSWSD+EM + K   +K   
Sbjct: 59  DWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLK--- 115

Query: 141 LVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQ 200
                           GC+G L  L++   +  FK IM++GGWS+ + F   +     ++
Sbjct: 116 ----------------GCIGALNSLRD--EKPGFKNIMAVGGWSNKDAFPLALRKKHGVE 157

Query: 201 NFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIED 260
               S VETMF+ GFDGID+DWE+P+++  EP+ YL+L++ +R  +N LE  I+G+  + 
Sbjct: 158 KLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDK-KR 216

Query: 261 HFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNL------FSE 314
            F +S+A PAF DKL   PI E+DQYIDYWNMMTYDYYG WS  TG+HSNL      FSE
Sbjct: 217 RFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKFSE 276

Query: 315 TELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKFQPFTQNTVLINQHFKGVG 373
             L  + A+ YM ++  ++S K+VLGMA YGR F ++K+   +   + + LIN+ FKGVG
Sbjct: 277 HSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDPK---KTSGLINRKFKGVG 333

Query: 374 KPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKA 433
                  +++G+ G+W Y  LP +GT E +D +Y SAYCFD K    + YDN  S + KA
Sbjct: 334 ------GESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKA 387

Query: 434 EYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRVIKFYLNKY 493
           +YV  + L GGFWWESCG    N  +SL++ FNE I     ++ +++QD ++ + YL  +
Sbjct: 388 QYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQIF 447

Query: 494 GDDGFLSPYLK 504
              GFL+   K
Sbjct: 448 AKSGFLAATFK 458

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  342 bits (878), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/445 (41%), Positives = 271/445 (60%), Gaps = 38/445 (8%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           NWSPY  R HFPHDI+  +++HVYYAF  +NS+TG  + +D WSD++M+LYK +     +
Sbjct: 79  NWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQMISSFKK 138

Query: 141 L-VENNLNDSVQNILPLGCVGELFYLK---------NACSEKKFKVIMSIGGWSDSENFK 190
           L +        ++ LPLGC+GELF+LK          +     FK IMS+GGWS+ E F 
Sbjct: 139 LDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFT 198

Query: 191 TIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLE 250
           ++V     L+ F+DS V  MF+ GFDGIDIDWEFP+N+  EP+ YL+++K LR +L+ LE
Sbjct: 199 SLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLE 258

Query: 251 SQIFG-ESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHS 309
           SQIFG +  + HF ++ A  A ++ L +LP+ E D+Y+DYWN+M YD+ G+WS  T Y S
Sbjct: 259 SQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQS 318

Query: 310 NLFSETEL---------SGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQ 360
           NL++  +          S + A+ ++ D+  + S K+VLGM AYGR F   +   +   +
Sbjct: 319 NLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSHKSI-E 377

Query: 361 NTVLINQHFKGVGKPGKEID-KADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCF----DE 415
           N          +GKP +++   ++G+EGI  YK LP KG +E +D   VSAYC     ++
Sbjct: 378 NV---------IGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNK 428

Query: 416 KNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSS 475
           K +  I YDN  S   KA YV  N LGGGFWWESCGE +  K +SL+ AF + I+    +
Sbjct: 429 KQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFTKEIKCLNKT 486

Query: 476 KPSMFQDMRVIKFYLNKYGDDGFLS 500
           +P+++    V++ YL K    GFL+
Sbjct: 487 EPTIYSLPEVVQHYL-KLHPGGFLA 510

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  338 bits (867), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/445 (41%), Positives = 271/445 (60%), Gaps = 35/445 (7%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           NWSPY  R HFPHDI+  +++ V+Y+F  +N +TG  + +D WSD++M+LYK +     +
Sbjct: 79  NWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQMFSAFEK 138

Query: 141 L-VENNLNDSVQNILPLGCVGELFYLK---------NACSEKKFKVIMSIGGWSDSENFK 190
           + ++     S +N LPLGC+GELFYLK              K FK IMS+GGWS+ E F+
Sbjct: 139 VDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWSNREAFE 198

Query: 191 TIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLE 250
           ++V     ++ F++S V+ MFK GFDGIDIDWEFP+N+  EP+ YL +++ LR KL++LE
Sbjct: 199 SLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDDLE 258

Query: 251 SQIFG-ESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHS 309
           S IFG E    HF ++ A  A    L +LP+ EID+Y+D WN+M YD+ G+WS  T Y S
Sbjct: 259 SDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAYQS 318

Query: 310 NLFSETEL----------SGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFT 359
           NL+S + L          S + A+  ++++  + + K+VLGM AYGR F  K       +
Sbjct: 319 NLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGF--KGVSVPHHS 376

Query: 360 QNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCF----DE 415
           ++ V I Q F+ V         ++G+ GI  Y  LP KG  E +D   VSAY      ++
Sbjct: 377 EHNV-IGQSFQQVS------GLSEGESGISLYNQLPLKGGQEWFDQDAVSAYSVKLASNK 429

Query: 416 KNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSS 475
           + +  + YDN +S K KA+YV+ N LGGGFWWESCGE + + SRSL  AF + I++   +
Sbjct: 430 EMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQEIKYLNKT 489

Query: 476 KPSMFQDMRVIKFYLNKYGDDGFLS 500
            P+++   +V ++Y  KY  DGFL+
Sbjct: 490 VPTIYALPQVGEYYHKKY-PDGFLA 513

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  334 bits (857), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/487 (38%), Positives = 279/487 (57%), Gaps = 61/487 (12%)

Query: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQ--NQKPHDXXXXXXXXXXXXNWSPYTP 87
           EMC+   +F     D I+    + G + P+ +    + P +            NWSPY  
Sbjct: 26  EMCIVPWLF----LDKIKKG-GSAGRRPPTEIDPDTRVPSEGPDGFSVATYYSNWSPYNA 80

Query: 88  RFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENNLN 147
           R H P DI   Q++HVYYAFF +++K+G ++S+DSWSD E+    PL++           
Sbjct: 81  RNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK-------- 128

Query: 148 DSVQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSV 207
                    GC+ EL  +K   S+ +FK I+ +GGWS+ E +K I   +K ++ F++++V
Sbjct: 129 ---------GCIKELQKIKLE-SKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAV 178

Query: 208 ETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIED----HFQ 263
           + MF+ GFDGID+DWEFPE +  EP  YL++++ +R  ++ LE QIFG   E+    HFQ
Sbjct: 179 DCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQ 238

Query: 264 ISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF----------- 312
           +S+A PAF +KL  LPISE+ +Y+D WNMM YD++G WS+ TGYHSNL+           
Sbjct: 239 LSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHSHRRSLS 298

Query: 313 ---SETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHF 369
              S + LS + A+  M D  ++ S ++ LGMAAYGR F   +      T +   + + +
Sbjct: 299 NRISNSSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVE------TNDDNYLGKKY 352

Query: 370 KGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSA 429
            GVG        ++G+ GIW Y  LP  G+ EQ+D   VSAYCFD K+  F+ YDN +S 
Sbjct: 353 HGVG------GGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSM 406

Query: 430 KTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRVIKFY 489
             K +Y+    L GGFWWESCG++  +  +SL+NAF++ I  +     S+F+  +V +F+
Sbjct: 407 DIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLS-EGFVSLFKSDKVKQFH 464

Query: 490 LNKYGDD 496
           L KY  D
Sbjct: 465 LQKYPKD 471

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  325 bits (833), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/450 (40%), Positives = 271/450 (60%), Gaps = 54/450 (12%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           +WSPY PR HFPHDI+  +V++V YAFF ++ KTG ++ TDSWSDLEM  + P   +   
Sbjct: 71  SWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVT 130

Query: 141 LVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQ 200
                           G +GEL YLK       F++ M++GGWS+ E F  IV  ++ L+
Sbjct: 131 ----------------GMIGELNYLK-LQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLK 173

Query: 201 NFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIED 260
           NFV+S+++ MF+ GFDGID+DWEFP+++  EP  YL++   LR K++ LE +I+G +  D
Sbjct: 174 NFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTD 233

Query: 261 H--FQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETE-- 316
           +  F++S+A PAF   L  LPI E+++++  WNMMTYD++GSWS+ TGYHSNL+   +  
Sbjct: 234 YPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNN 293

Query: 317 ------------------LSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPF 358
                             L+ + A+  M++ F V + K+ LGM AYGR F    +K    
Sbjct: 294 DELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTK---- 349

Query: 359 TQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNS 418
             +  L+N+ + GVG        ++G+ GIW Y  LP   T E++D ++VSAYCFD+   
Sbjct: 350 -DDDDLLNKKYSGVGG------GSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLK 402

Query: 419 IFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPS 478
            F+ YDN +S + K++YV    L GGF+WESCG+ H +  R+L+ AF++    +    P+
Sbjct: 403 TFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQ--ELSEMRIPT 460

Query: 479 MFQDMRVIKFYLNKYGDDGFL-SPYLKHLE 507
           +F+D R I +YL K+   GFL S + +HL+
Sbjct: 461 IFKDPRAIAYYL-KHRQKGFLYSLFSQHLQ 489

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  317 bits (813), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/450 (39%), Positives = 259/450 (57%), Gaps = 58/450 (12%)

Query: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140
           +WSPY PR H+P +I+  +V+HVYYAFF ++ KTG I S D WSD +M    P+ +    
Sbjct: 71  SWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM----PMNLTG-- 124

Query: 141 LVENNLNDSVQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQ 200
            +   LN         G +GEL YLK       FK++M++GGWS+ E F  IV D++   
Sbjct: 125 -MPRGLN---------GAIGELNYLKTRPG-TDFKLMMAVGGWSNREPFHKIVRDEEKFN 173

Query: 201 NFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGE--SI 258
           NF+DS+++ MF+ GFDGID+DWEFP+++  EPQ YL++   LR K++ LE  I+G   + 
Sbjct: 174 NFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTT 233

Query: 259 EDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSET--- 315
           E  F +S+AAPAF   L   P+ E+++Y+  WNMMTYDY+G+WSE TGYHSNL++ T   
Sbjct: 234 EPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSP 293

Query: 316 -------------------ELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKF 355
                              EL+ + A+  M ++F V   K+ LGMAAYGR F +++    
Sbjct: 294 YKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGE 353

Query: 356 QPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDE 415
           Q       LI Q +            ++G+ G+W Y  LP     E++D  +VSAY +D 
Sbjct: 354 Q-------LIGQKYS------GVGGGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDP 400

Query: 416 KNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSS 475
                + YDN  S K K EYV   KL G F WESCG+   +K R+L+ AF E ++   + 
Sbjct: 401 NTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMK--GAR 458

Query: 476 KPSMFQDMRVIKFYLNKYGDDGFLSPYLKH 505
           K + ++D ++I++YL +   +GFL P  +H
Sbjct: 459 KATAYKDSKLIQYYL-RTRPEGFLVPMYRH 487

>TPHA0P01710 Chr16 complement(357242..358312) [1071 bp, 356 aa] {ON}
           Anc_2.18 YNL223W
          Length = 356

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 49/101 (48%), Gaps = 7/101 (6%)

Query: 221 DWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIED----HFQISIAAPAFKDKLF 276
           D E P N K   Q ++ L+  ++L +N +  + +G+ I+D     +   I+    K  LF
Sbjct: 194 DSEPPANTK---QQHILLLFGIKLGINTINIEKYGQDIKDITNNKYTCGISGGQPKSSLF 250

Query: 277 FLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETEL 317
           F   +     I Y++    + + + ++ + YHS  F+E E+
Sbjct: 251 FFGYNNTHDRILYFDPHKPNNFTTDNDYSTYHSTEFNELEM 291

>TBLA0F03650 Chr6 complement(897483..898631) [1149 bp, 382 aa] {ON}
           Anc_8.180 YDR065W
          Length = 382

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 394 LPKKGTI-EQYDPKYVSAYCFD--EKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWW--E 448
           LPK G +  +Y  K +     D   K  I +S    K  KT   Y++H K+G  F W   
Sbjct: 144 LPKHGLVNSEYKLKLLLPMALDYTSKFKINLSKKKYKKIKTPPTYLVHKKIGSNFIWFVR 203

Query: 449 SCGEAHTNKSRSLINAFNEGI 469
           S    H+N+S+ L +   + I
Sbjct: 204 SIINKHSNQSKKLSSIIQQEI 224

>Smik_8.45 Chr8 (78091..79278) [1188 bp, 395 aa] {ON} YHL004W (REAL)
          Length = 395

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 6/90 (6%)

Query: 161 ELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDI 220
            LF L+N+C  K+F+   S    + S N + I+   KLL + + + ++++ ++  D I  
Sbjct: 12  RLFSLRNSCLSKRFQSSSSGAADNSSNNDEVILLQQKLLYDEIRAELKSLSQIPEDEI-- 69

Query: 221 DWEFPENNKIEPQGYLKLV-KMLRLKLNNL 249
               PE  K   +G L    ++L  +LN+L
Sbjct: 70  ---LPELKKSLGEGKLSAKEQLLETELNSL 96

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,413,769
Number of extensions: 2564800
Number of successful extensions: 6504
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6549
Number of HSP's successfully gapped: 30
Length of query: 511
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 397
Effective length of database: 40,409,475
Effective search space: 16042561575
Effective search space used: 16042561575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)