Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6395.437ON44244222990.0
YDR370C5.437ON44244017230.0
Smik_4.6365.437ON44644216890.0
Suva_2.5425.437ON44244216250.0
NDAI0B056905.437ON4233898771e-114
KAFR0E038205.437ON3963768381e-108
NCAS0F034005.437ON4153888331e-107
TDEL0B021805.437ON4183857262e-91
Kpol_1016.45.437ON4133757132e-89
CAGL0A02860g5.437ON4023406262e-76
ZYRO0F10098g5.437ON3733896144e-75
TPHA0J026005.437ON4413845994e-72
SAKL0G02596g5.437ON4003735931e-71
KLTH0F15994g5.437ON3903715721e-68
KNAG0C048905.437ON4054035494e-65
Kwal_55.214155.437ON3893515423e-64
TBLA0A028005.437ON4533814862e-55
AER404C5.437ON3863654324e-48
KLLA0E02245g5.437ON4033653311e-33
Kwal_55.21591na 1ON4692041053e-04
KAFR0J001603.570ON380109910.010
KLLA0E12893g3.570ON384233880.026
NDAI0I032603.570ON377123830.12
TPHA0G036503.570ON377120810.18
TBLA0E001803.570ON378219810.22
SAKL0F00726g3.570ON383190800.28
AFR263C3.570ON376175780.39
AFR262CsingletonON775168770.72
Kpol_380.83.570ON379147760.75
YGL246C (RAI1)3.570ON38769760.88
CAGL0C01925g3.570ON40089750.97
Kwal_47.192763.570ON38645751.2
Smik_7.153.570ON38769741.2
AFR307C3.489ON65084751.2
TDEL0D063803.570ON378188731.7
TBLA0A029505.322ON96670741.9
Skud_13.378.824ON113287713.5
Suva_7.153.570ON38969695.3
NCAS0E002403.570ON380135686.6
KNAG0D035704.148ON38959688.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.639
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   890   0.0  
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   668   0.0  
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   655   0.0  
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   630   0.0  
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   342   e-114
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   327   e-108
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   325   e-107
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   284   2e-91
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   279   2e-89
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   245   2e-76
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   241   4e-75
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   235   4e-72
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   233   1e-71
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   224   1e-68
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   216   4e-65
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   213   3e-64
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   191   2e-55
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   171   4e-48
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   132   1e-33
Kwal_55.21591 s55 complement(904533..905942) [1410 bp, 469 aa] {...    45   3e-04
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    40   0.010
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    39   0.026
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     37   0.12 
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    36   0.18 
TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}...    36   0.22 
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    35   0.28 
AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON} S...    35   0.39 
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    34   0.72 
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    34   0.75 
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    34   0.88 
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    33   0.97 
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    33   1.2  
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    33   1.2  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...    33   1.2  
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    33   1.7  
TBLA0A02950 Chr1 complement(709449..712349) [2901 bp, 966 aa] {O...    33   1.9  
Skud_13.37 Chr13 complement(58380..61778) [3399 bp, 1132 aa] {ON...    32   3.5  
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    31   5.3  
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    31   6.6  
KNAG0D03570 Chr4 (653277..654446) [1170 bp, 389 aa] {ON}               31   8.3  

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/442 (97%), Positives = 429/442 (97%)

Query: 1   MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKXXXXXXXXXXXXXVKPPSPQKDDYWNRC 60
           MSTEDDPIARLTKNLESTNLNIVPDLVKGHQK             VKPPSPQKDDYWNRC
Sbjct: 1   MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKRSSEGRSISITSSVKPPSPQKDDYWNRC 60

Query: 61  SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE 120
           SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE
Sbjct: 61  SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE 120

Query: 121 LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI 180
           LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI
Sbjct: 121 LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI 180

Query: 181 GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240
           GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS
Sbjct: 181 GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240

Query: 241 DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV 300
           DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV
Sbjct: 241 DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV 300

Query: 301 SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD 360
           SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD 360

Query: 361 SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID 420
           SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID
Sbjct: 361 SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID 420

Query: 421 ANGTIAITKLNTVPKNVELFVT 442
           ANGTIAITKLNTVPKNVELFVT
Sbjct: 421 ANGTIAITKLNTVPKNVELFVT 442

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/440 (71%), Positives = 366/440 (83%)

Query: 1   MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKXXXXXXXXXXXXXVKPPSPQKDDYWNRC 60
           MSTE D +  L K+LE  NL  VP+L +GHQ               + PS Q+D+Y  R 
Sbjct: 1   MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEKTTSDSSSSRKPSQQRDNYRKRR 60

Query: 61  SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE 120
            +  C+PYTSF+HT +H+   KPP DIF +SKEVALFTN +AYT  RKDLIP+L++ I E
Sbjct: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120

Query: 121 LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI 180
           LYESSLLEA++RKVPYLGHDLFANID+FVPMTISELDS+SPC SY+ENW L N GK+FKI
Sbjct: 121 LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180

Query: 181 GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240
           GKKFT+V+ RHHIVDLTMH F+RRN++ SLIVTYMGAGL+SF RN K D QMSKEGIYS+
Sbjct: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240

Query: 241 DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV 300
           DPNMKKICYSGFEFE+WVTE+ K  DL G K PIFS+VESKLSE+IGLL+RCE+DAFNPV
Sbjct: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300

Query: 301 SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD 360
           S TNTELKCF PLSMHNSNHR+KLLKTW+QTGLLPNSDI+IGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 361 SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID 420
            L KKFNHPGLP +KKELN+NA++AVEWC++CI++IC+LVEANIS Y+ST+PESFE+ ID
Sbjct: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420

Query: 421 ANGTIAITKLNTVPKNVELF 440
            N  I ITKL T P+NVELF
Sbjct: 421 TNNAIVITKLKTTPRNVELF 440

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/442 (71%), Positives = 361/442 (81%)

Query: 1   MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKXXXXXXXXXXXXXVKPPSPQKDDYWNRC 60
           M TE D + RLTK L+  NL+  PD+V+ HQK                   Q +++ N  
Sbjct: 1   MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH 60

Query: 61  SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE 120
            +F  V YTSF H+ +H    KPP DIF +SKEVALFTN QAYTT RKD++P+L+  I E
Sbjct: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120

Query: 121 LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI 180
           L E SLL+AR RK+PYLGHDLFANI QFVPMTISELDSI PCISY+ENW+L+NHG++FKI
Sbjct: 121 LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI 180

Query: 181 GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240
           G+KFT+V+ RHHIVD+TMH FDRRNK++SL+ TYMGAGLISFSRN KND +MSKEGIYSS
Sbjct: 181 GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS 240

Query: 241 DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV 300
           DPNMKKICYSGFEFE+WVTE IKA DLNG K P+FSVVESKLSE+IGLL+RCE+DAFNPV
Sbjct: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300

Query: 301 SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD 360
           S  NTELKCF PLSMHNSNHR+KLLKTWIQTGL PNSDI+IGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 361 SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID 420
           SL  KFNH GLP +K+ELN+NAKVAVEWCNHCIKSICEL+ ANIS Y+   PESFE+SID
Sbjct: 361 SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID 420

Query: 421 ANGTIAITKLNTVPKNVELFVT 442
           +N TIAITKL  +PK+VELF T
Sbjct: 421 SNNTIAITKLKNIPKHVELFGT 442

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/442 (67%), Positives = 359/442 (81%)

Query: 1   MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKXXXXXXXXXXXXXVKPPSPQKDDYWNRC 60
           MS E D + +L K+LE  NL  VP+ V  H+K              +P S QK+DY    
Sbjct: 1   MSPEQDGVVKLAKDLEGINLRDVPNPVNEHRKKSSKRKIIPISSLKRPSSQQKNDYLEEI 60

Query: 61  SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE 120
           S F  VPY+SF+HTSI +   KPP DIF +SKEVALFT+ Q Y  ARKD+IP+L++ I+ 
Sbjct: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120

Query: 121 LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI 180
           LYES LLEAR+ K  YLG DLFANID+ VPMTISELD+I+PCISY+E+W+L+N GK FKI
Sbjct: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180

Query: 181 GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240
           GKKFT+V+ RHHIVDLTMH FDRRNK+KS+I TYMG G IS SRNPK D + SKEGIYS 
Sbjct: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240

Query: 241 DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV 300
           DPN+KKIC+SGFEFE+ +TE+ K +  +  K P+FS+VE KLSEDIGLLMRCE+DAFNPV
Sbjct: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300

Query: 301 SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD 360
           S+TNTELKCFGPLSM NS+HRKKLLKTWIQTGLLPNSDI++GLRDS+SGQLLDIQWYSRD
Sbjct: 301 SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD 360

Query: 361 SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID 420
           +L++KFNHPGLP +KKE+N+NAKVAVEWC HCIKSIC+LVEANIS YN  +PE FE++ID
Sbjct: 361 TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420

Query: 421 ANGTIAITKLNTVPKNVELFVT 442
           ANGTI ITKL+T+P+NVE+F T
Sbjct: 421 ANGTIIITKLSTIPRNVEIFKT 442

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  342 bits (877), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 178/389 (45%), Positives = 255/389 (65%), Gaps = 21/389 (5%)

Query: 66  VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELY--E 123
           +P+  F H SI     K P   F+ SK+VAL+ N Q Y++   +LIP L   I +L    
Sbjct: 39  IPFKQFKHCSISTYP-KTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPS 97

Query: 124 SSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKK 183
            SL EAR  K+PYLG DL+   + F+PM   ELDSI PC  Y+E+W+L N   ++++G K
Sbjct: 98  CSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNK-HDYQLGNK 156

Query: 184 FTIVSARHHIVDLTMHRFDRRNKRKSLI-VTYMGA--GLISFSR--NPKNDFQMSKEGIY 238
           FTIVSARHHIV++TM  F++R     ++ VTY G   G++ FSR  N K+D      GIY
Sbjct: 157 FTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDD-----GGIY 211

Query: 239 SSDPNMKKICYSGFEFEHWVT-------EDIKATDLNGPKHPIFSVVESKLSEDIGLLMR 291
           S D  ++KI YSGF  E  +T        D     L G    +F+++E+KL++DI LL+R
Sbjct: 212 SKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLR 271

Query: 292 CEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQL 351
           CE+D++NPV++  TE+KCF  L M+N NHR+KLLK W+QTG++PNSDI+IG+RD   G+L
Sbjct: 272 CEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGEL 331

Query: 352 LDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTR 411
            DI+W+SR +LY++ N+  LP +K +LN+NA++AV+W  HCIKSIC+LV+ +I       
Sbjct: 332 NDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNT 391

Query: 412 PESFEVSIDANGTIAITKLNTVPKNVELF 440
            +SF++ I+A+  I I KL +VP NV ++
Sbjct: 392 SQSFQIRINASRAIQIKKLKSVPNNVTMY 420

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  327 bits (838), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 249/376 (66%), Gaps = 18/376 (4%)

Query: 67  PYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAY--TTARKDLIPSLRDGITELYES 124
           P+  F H SI      P  + FQ S+EVA + + + Y      +D++P L   I+++ + 
Sbjct: 31  PFKRFQHRSIAYFPNHP-ANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQG 89

Query: 125 -SLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKK 183
            S ++AR+ KV Y+G DL+   + F  M+  ELDS  PC +Y++ W+  +H K +   KK
Sbjct: 90  VSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTENKK 148

Query: 184 FTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPN 243
           +TIVSARHHIV+L M  FD  +K   +  TY+G GL++FS++  +   M+ EGI++ + N
Sbjct: 149 YTIVSARHHIVNLIMSIFDT-SKETIVNSTYLGNGLLTFSQDTSDPMTMN-EGIFTKNKN 206

Query: 244 MKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRT 303
           +KKICYSGF  E  +T+          K P+FS+ E++L ++I LL+RCE+DA+N +++ 
Sbjct: 207 LKKICYSGFALEDLLTK--------SQKEPLFSITENQLDDNITLLLRCEMDAYNQLTQN 258

Query: 304 NTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLY 363
            TELKC+ PL M +  HRKKLLKTWIQTG+LP+SD++ G+R  ++G+LLDI+WYSRD LY
Sbjct: 259 YTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLY 318

Query: 364 KKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANG 423
           ++FN+  LP +KK LNFNA +AVEW +HCIK+ICEL+  N+       P++F++ +D   
Sbjct: 319 RRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQ---GDAPQAFQIKVDTFR 375

Query: 424 TIAITKLNTVPKNVEL 439
            I+I  L+ +P+N ++
Sbjct: 376 NISIRNLSKIPQNAQI 391

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  325 bits (833), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 169/388 (43%), Positives = 246/388 (63%), Gaps = 18/388 (4%)

Query: 66  VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESS 125
           VP+  F H+SI  L        ++ S +VAL+ N++ Y  ++ D+IP L++ I +L + S
Sbjct: 26  VPFGEFSHSSI-SLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPKKS 84

Query: 126 LLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFT 185
             EAR  K  YLG DL+   + FVPM+  +LDS+ PC+S++++W+     K +K G+KF 
Sbjct: 85  ASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YKPGRKFN 143

Query: 186 IVSARHHIVDLTMHRFDRR-----NKRKS----LIVTYMG--AGLISFSRNPKNDFQMSK 234
           IVS RHHIV++TM  F  +     N +K     L V Y G   G + F+++  N      
Sbjct: 144 IVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMN 203

Query: 235 EGIYSSDPNMKKICYSGFEFEHWVTE-----DIKATDLNGPKHPIFSVVESKLSEDIGLL 289
           EGIYS +  +K+ICYSGF  E  +TE     + +   L G +  +F+VVE+KL +DI +L
Sbjct: 204 EGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVENKLDDDICIL 263

Query: 290 MRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSG 349
           +RCE+DAFN   +  TELKCF PL M N +HR+KLLK W+QTG+LP+SDI+IG+RDS  G
Sbjct: 264 LRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFG 323

Query: 350 QLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNS 409
           +L D++WYSRD L  K N+  LP SK + NFNA+VA +W  HCI+SIC+LV+ N+     
Sbjct: 324 ELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAI 383

Query: 410 TRPESFEVSIDANGTIAITKLNTVPKNV 437
           + P+ F++ ID+   I I  L+ VPK++
Sbjct: 384 SNPQGFQIRIDSRRNIRIKCLSKVPKDI 411

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  284 bits (726), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 156/385 (40%), Positives = 236/385 (61%), Gaps = 24/385 (6%)

Query: 62  RFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYT--TARKDLIPSLRDGIT 119
           R  C+P++ F H+ + D       D F+  +EVA + N   +   +++K L P L     
Sbjct: 46  RTVCIPFSKFEHSDL-DYFPDDTADFFEGCEEVATYQNGYLFMKDSSKKPLYPCL----- 99

Query: 120 ELYESSLLEAR--RRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKN 177
           +++ + + E R  + K+PY+G DL+   +++ P+  SELDS   C  Y++ W+     K+
Sbjct: 100 QMFAALIAENRGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKS 159

Query: 178 FKIGKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGI 237
           F  GK  TI+S RHH+VDL M  F   +   S+I T +G G + FS +   +    + G+
Sbjct: 160 FNSGK-VTIISPRHHVVDLVMALF--HDDEVSIICTNIGKGKLIFSGDRSKE---ERNGL 213

Query: 238 YSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAF 297
            S +   +KICYSGF  E  +T     T  +    P +S+VE K++E + LL+RCE+DA+
Sbjct: 214 NSKNSMTRKICYSGFALEDKLT-----TSHDERMGPFYSIVEGKINERLSLLLRCEMDAY 268

Query: 298 NPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWY 357
           NP+    TELKCF  L++ ++ HR+KLLKTW+Q GL+P+SD++IG RD+  GQL D+ WY
Sbjct: 269 NPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWY 328

Query: 358 SRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEAN-ISHYNSTRP--ES 414
           SR SLYKKFN+P +  + K LNFNA +AVEWC HCI+SIC+LV  N +S  +   P  ES
Sbjct: 329 SRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYES 388

Query: 415 FEVSIDANGTIAITKLNTVPKNVEL 439
           F+V +D +  I + KL  VP++V++
Sbjct: 389 FKVIVDKSHNIIVKKLTKVPRHVQI 413

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  279 bits (713), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 230/375 (61%), Gaps = 12/375 (3%)

Query: 66  VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESS 125
           +P+  FVH++     +K   D+F +SK VA F   Q +       +P L+  I  +   S
Sbjct: 41  IPFHRFVHSNARSFPQKT-KDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKS 99

Query: 126 LLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFT 185
           +L +++ K+PYLG DL+A+ D++ P+    LDS  PC  ++ +W+  + G+++     +T
Sbjct: 100 VLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYT 159

Query: 186 IVSARHHIVDLTMHRF-DRRNKRKSLIVTYMGAGLISFSRN-PKNDFQMSKEGIYSSDPN 243
           I+S RHHI ++ M  F D +N    L+ TY+  G+I  S++   +    +  G+ SS+P 
Sbjct: 160 ILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPM 219

Query: 244 MKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRT 303
            +KICYSGF FE  V EDI          PIFSVVESKL+E I LL+R E+D +N V+  
Sbjct: 220 TRKICYSGFAFEDLVLEDIAEN-----ARPIFSVVESKLTESINLLLRNELDGYNNVTNM 274

Query: 304 NTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLY 363
            TELKCF PL    S   K++LKTW+QTGL+P SDIVIG+RD+ SG L D+ WY+R  L 
Sbjct: 275 FTELKCFAPLKCMFS--AKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLC 332

Query: 364 KKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANG 423
           + FN+P LPP+    NFNA +AVEW    ++SI  LV ++I+  +S  P SF++ ID + 
Sbjct: 333 RTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIA--DSNHPCSFKLKIDNHK 390

Query: 424 TIAITKLNTVPKNVE 438
           TI+I KL+ +P+ V+
Sbjct: 391 TISIQKLSRIPQTVQ 405

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  245 bits (626), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 202/340 (59%), Gaps = 7/340 (2%)

Query: 88  FQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESSLLEARRRKVPYLGHDLFANIDQ 147
           +  +K + +F +++ Y   R DL P L+D I  + +S+  E  +   P+LG  L+ N D+
Sbjct: 63  YDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDK 122

Query: 148 FVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTIVSARHHIVDLTMHRFDRRNKR 207
           + PMT  ELD+   C +Y++ ++ ++HG+ +   + F IV+ARHH++DL +  F R+   
Sbjct: 123 YSPMTAKELDTTEACSTYLDQYE-NSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFTN 181

Query: 208 KSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDL 267
            +L+  Y    L+  S++P  D    K G+ + +P +KKIC+SGF  E  +TE     + 
Sbjct: 182 VNLLCAYTPGNLLEISQDPA-DNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEER 240

Query: 268 NGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKT 327
           N    P F +VE++++ +  LLMRCEIDA+NP++   TELKC+   +  N NHR+KLLK+
Sbjct: 241 N----PTFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKS 295

Query: 328 WIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVE 387
           WIQTG++P +DIVIG+RD+ SG L D++ Y+R+ LY K     LP    ELN++  ++V 
Sbjct: 296 WIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVV 355

Query: 388 WCNHCIKSICELVEANISHYNSTRPESFEVSIDANGTIAI 427
           W    I ++   + + +  +    P+ F + +D N  I I
Sbjct: 356 WYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  241 bits (614), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 223/389 (57%), Gaps = 29/389 (7%)

Query: 58  NRCSRFKC----VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPS 113
           ++CSR +     VP+  F H+S      +P  ++F   KE + +   Q        L  S
Sbjct: 4   SKCSRNRAQLPSVPFNQFQHSSAFRFPSEP-RNLFTKYKEASYYYGGQ--------LHDS 54

Query: 114 LRDGITELYESSLLEARR---RKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWK 170
           + D I      + L   R    K  +LG DL+   + F+P++   LDS   C  ++  W+
Sbjct: 55  ISDSIGLKSPGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWE 114

Query: 171 LSNHGKNFKIGKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDF 230
             NH  ++     F ++S RH++V+LTM  F  +  + S++ T++G G I  S+  +ND 
Sbjct: 115 NDNH-TSYSQRSPFVVISPRHYLVELTMQLF--QQSKYSILCTHLGDGKIVLSQ-VEND- 169

Query: 231 QMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLM 290
           + S +    +    KKI +SG+  E  +T   +  D      P F+++E++L  +I L++
Sbjct: 170 KKSHQHTSRNTTMTKKILHSGYALEDLLTRGPRVED-----DPFFAIIEAELDANISLVL 224

Query: 291 RCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQ 350
           RCE+D++N ++ T TELKC+ PL+MHN+ HR+KLLKTWIQ  + P  D++IG+R++H G 
Sbjct: 225 RCELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGL 284

Query: 351 LLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNST 410
           L D+Q+++   LY+K N   LP S K  N+NA +AV+WC HCI+SIC+LV  N+   + +
Sbjct: 285 LQDLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENV---DRS 341

Query: 411 RPESFEVSIDANGTIAITKLNTVPKNVEL 439
            P+ F+++ID +  I + KL  VP +VEL
Sbjct: 342 SPQCFKLTIDESHKIQLEKLKHVPAHVEL 370

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  235 bits (599), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/384 (35%), Positives = 216/384 (56%), Gaps = 20/384 (5%)

Query: 66  VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQ--AYTTARKDLI-----PSLRDGI 118
           +P+  F +++ H    +P  +IFQ++K VAL+ + +    T    +LI     P L   I
Sbjct: 63  IPFKHFSYSNAHIGKSQP--NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI 120

Query: 119 TELYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNF 178
           + L E SLL++++ K+PY+G++L+  I++F PM  + LDS  PC  Y+   K+S   K +
Sbjct: 121 SNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY 180

Query: 179 KIGKKFTIVSARHHIVDLTMHRFDRRNKR---KSLIVTYMGAGLISFSRNPKNDFQMSKE 235
                +T ++ RHH+ +L M  ++ R      KS + T +   LI  S +   +   S +
Sbjct: 181 --NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQ 238

Query: 236 GIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEID 295
                +   KK+  SGF FE  V E+ +         P F + E++L+     ++R E+D
Sbjct: 239 NHKLQNSFSKKVINSGFTFEELVIENFQEC-----HKPYFYISENRLTPKSTFIIRSEMD 293

Query: 296 AFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQ 355
           ++N  + T TELKCF  L +  + HRKKLLKTW QTGL PN DIVIG+RD+ SG L D+ 
Sbjct: 294 SYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLL 353

Query: 356 WYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESF 415
           WYSR+++Y+K   P LP  K   +F   + ++W NHCI +I      + S   ++ P ++
Sbjct: 354 WYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSD-TASNPMTY 412

Query: 416 EVSIDANGTIAITKLNTVPKNVEL 439
           +V ID + +I I KL+ VPKNVE+
Sbjct: 413 KVIIDKHKSIIIKKLSIVPKNVEI 436

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  233 bits (593), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 135/373 (36%), Positives = 216/373 (57%), Gaps = 19/373 (5%)

Query: 70  SFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQA---YTTARKDLIPSLRDGITELYESSL 126
            FVH+++       P   FQ+S+E+  FT   +   Y    K  +  L+D I E   +  
Sbjct: 29  GFVHSNVSHFP-SVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87

Query: 127 LEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTI 186
             A + K  YLG+DL    + ++P++  EL+++   ++++ NW+  N GK +    KFTI
Sbjct: 88  KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKN-GKKYGSENKFTI 146

Query: 187 VSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLI--SFSRNPKNDFQMSKEGIYSSDPNM 244
           VS RHH++DL M  F    +  +LIVT++   LI  S    PK D      GI S D  +
Sbjct: 147 VSNRHHLIDLIMCPFSL--EEANLIVTHLDGLLIISSDKSKPKVD-----SGIRSKDTRV 199

Query: 245 KKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRTN 304
           +K+CY+GFE E+ VT+     D  G     +S+VE+KL+E + LL++ E+D++NP +   
Sbjct: 200 RKLCYTGFELENLVTKG--KVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNY 257

Query: 305 TELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYK 364
            ELKC     + NSNHR+KLL+ WIQTGL+P +D+++G RD +  QL  ++ Y+RD +YK
Sbjct: 258 VELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYK 317

Query: 365 KFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANGT 424
           KF+   L  ++K  NFN+ VAV+W +H I  I ELV+ N++       +SF++++  +  
Sbjct: 318 KFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLT---DEPLQSFKLTLTRDLQ 374

Query: 425 IAITKLNTVPKNV 437
           +++TKL   P  +
Sbjct: 375 LSLTKLANTPAGL 387

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  224 bits (572), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/371 (33%), Positives = 204/371 (54%), Gaps = 18/371 (4%)

Query: 65  CVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNY---QAYTTARKDLIPSLRDGITEL 121
           CV    F   SI     +P    F + KE+   T++     +   RK   P L+  +   
Sbjct: 18  CVSCRGFERASISHFPAEPL-HFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLF 76

Query: 122 YESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIG 181
              ++ +   +   Y+GHDL  + D F P+T ++L+ +S    ++  W+  +HGK +  G
Sbjct: 77  ---TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWE-GDHGKPYSSG 132

Query: 182 KKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSD 241
             FTIV +RH+++DL M  F   +      V Y+   L  F   P   FQ   +GIYSS+
Sbjct: 133 SDFTIVCSRHNLIDLIMAPFSDEDVH--FNVKYINGYLHIF---PDKQFQKKDDGIYSSE 187

Query: 242 PNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVS 301
            N+++ICY+GFE E  VTE    T    PK   +S+V+ K+S++I LL + E+D FNP  
Sbjct: 188 SNIRRICYTGFELEDLVTE----TQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAK 243

Query: 302 RTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDS 361
           R+ TE+KC   L + ++ HR+KLL+ W+QT L+P++D++IGLRD +  QL   + Y+R  
Sbjct: 244 RSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQE 303

Query: 362 LYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDA 421
           LY+KFN+  L   KK+ N+NA ++V+W  H +K +C+ +   +     T   SF++++  
Sbjct: 304 LYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEK-TPTEAVSFKLTLTK 362

Query: 422 NGTIAITKLNT 432
              + + K+ T
Sbjct: 363 QLELRLRKIET 373

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  216 bits (549), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 141/403 (34%), Positives = 207/403 (51%), Gaps = 26/403 (6%)

Query: 52  QKDDYWNRCSRF-----KCVPYTSFVHTSIHDLSR--KPPGDIFQDSKEVALFTNYQAY- 103
           + DD  N   R      K V +  F H   HD  +    P  IFQ SKEVA +T  + Y 
Sbjct: 9   ETDDLLNSFHRLSINDQKRVRFKEFHH---HDPGKYVSKPAHIFQKSKEVACYTGGKLYI 65

Query: 104 ---TTARKDLIPSLRDGITELYES-SLLEARRRKVPYLGHDLFANIDQFV-PMTISELDS 158
               T    ++P L++ I  L +S +  ++   K  YLG  L+A  + +V  M+   LDS
Sbjct: 66  NDGNTTNLTILPLLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDS 125

Query: 159 ISPCISYVENWKLSNHG-KNFKIGKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGA 217
             PC+ Y+  W   + G K F    +  IV  RHH+V+LTM  F   +  K L+ T +  
Sbjct: 126 AKPCLDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYK-LVCTVLRG 184

Query: 218 GLISFSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPI-FS 276
             I  S+      +   EGI  SD   + +CYSGF          K   LN    P  F 
Sbjct: 185 KFIVLSQFDDGSQRNRNEGITLSDRRTRMLCYSGFVI-------CKIWSLNRGIIPSQFF 237

Query: 277 VVESKLSEDIGLLMRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPN 336
              + +         CE+DA+N +    TELKC+GPL+M +S H+ KLL+TW+QT + P+
Sbjct: 238 YYGTPIRRGHLATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPD 297

Query: 337 SDIVIGLRDSHSGQLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSI 396
           +D+VIG R+++ G L DI   SR+SLY+KFN+   P +    N+NA+VAVEW  + +K+I
Sbjct: 298 TDVVIGCRNAYDGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAI 357

Query: 397 CELVEANISHYNSTRPESFEVSIDANGTIAITKLNTVPKNVEL 439
             L+E N++  +   P++F V++     I I KL  VPK  E+
Sbjct: 358 IRLIEGNLNQKSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEI 400

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  213 bits (542), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 200/351 (56%), Gaps = 17/351 (4%)

Query: 87  IFQDSKEVALFTNY---QAYTTARKDLIPSLRDGITELYESSLLEARRRKVPYLGHDLFA 143
            F + +EVA  T+      +    K  +P L   + E  ES  L  + +   Y+GHDL  
Sbjct: 39  FFDEVQEVATITHLLDTDEFLLDDKLGMPELVQDLCEFTESGKLANKGK---YIGHDLLD 95

Query: 144 NIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTIVSARHHIVDLTMHRFDR 203
           + D++VP+T  +L+ ++   +++E WK   HG++F     FTIV +RH+++DL M  F  
Sbjct: 96  HFDEYVPITPKQLEDMAGVQAFLERWK-QLHGRSFCDNADFTIVCSRHNLIDLIMMPFSD 154

Query: 204 RNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIK 263
            +     +      G ++ S  P   +Q + +GI+S D  +KKICY+GFE E+ +T    
Sbjct: 155 EDVH---LKIQFSNGYLNLS--PDAQYQKTDQGIHSGDTKIKKICYTGFELENLIT---- 205

Query: 264 ATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKK 323
           AT     +   +S+VE KL + I LL++ E+D FN  +R+ TE+KC   L + ++ HR+K
Sbjct: 206 ATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRK 265

Query: 324 LLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAK 383
           LL+ W+QT L+P++++++G+RD +  QL   + Y+R  LY+KFN+  L   +K  N+NA 
Sbjct: 266 LLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNAT 325

Query: 384 VAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANGTIAITKLNTVP 434
           ++V+W  H I+ +C++++  I    S    +F +++  N TI + K+   P
Sbjct: 326 ISVQWFRHVIQQLCQMIKPFIEK-GSKEEVNFRLTLRKNLTIKLRKMPETP 375

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  191 bits (486), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 126/381 (33%), Positives = 204/381 (53%), Gaps = 31/381 (8%)

Query: 85  GDIFQDSKEVALF------TNYQAYTTARKDLIPSLRDGITELYESSLLEARRRKVPYLG 138
            D+++ SKEVA +       N    T      +P L+D I ++   SLL++++ K  Y+G
Sbjct: 57  SDLYRTSKEVATYHLGNLNINTDP-TIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIG 115

Query: 139 HDLFANIDQFVPMTISELDSISPCISYVENW--KLSNHGKNFKIGKKFTIVSARHHIVDL 196
            DLF + +++  M    L     C  Y++ +  K +N  K + + K+F I+++RHHI DL
Sbjct: 116 ADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDL 175

Query: 197 TMHRFDR-RNKRKSLIVTYMGAGLISFSRNPKN---DFQMSKEGIYSSDPNMKKICYSGF 252
            +  F +  +   S+++TY+G   I  S++  +   D++ +K+  Y+S   M+KI  SGF
Sbjct: 176 VLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQ-FYNS---MRKIVNSGF 231

Query: 253 EFEHWVTEDIKATDL------NGPKHP-----IFSVVESKLSEDIGLLMRCEIDAFNPVS 301
            FE  V +D  ++ L         K P      FSVVE+ +S  + +L+R E+D +NP++
Sbjct: 232 AFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLT 291

Query: 302 RTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDS 361
            + TELKCF  L+M +  HR+KLLKTW+Q G LPNSD+++G RD+ +G L DI W+SRD 
Sbjct: 292 NSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDD 351

Query: 362 LYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANIS---HYNSTRPESFEVS 418
           L  K +    P  +   N     A  W  H + +I  L    +       S+ P  F + 
Sbjct: 352 LVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLI 411

Query: 419 IDANGTIAITKLNTVPKNVEL 439
           ++ N TI +  L  VP +V +
Sbjct: 412 VEKNRTITLLPLKKVPASVPI 432

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  171 bits (432), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 181/365 (49%), Gaps = 31/365 (8%)

Query: 71  FVHTSIHDLSRKPPGDIFQDSKEVA-LFTNYQAYTTARKDLIPSLRDGITELYESSLLEA 129
           F H  I    ++    IF +S+EV   F     Y    K  +P L D I E        +
Sbjct: 30  FPHGPITRRGKERSIRIFSESREVGTAFRQGLVYDLDDKKNLPLLNDEICEYISH---RS 86

Query: 130 RRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTIVSA 189
           + + + Y+G DL    + F P+T  EL  +   + ++  W+  N   N+    KFTIVS 
Sbjct: 87  KSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNE-VNYASRSKFTIVSP 145

Query: 190 RHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNMKKICY 249
           RHHI+D+ M  F   N+R  L+ T    GL   +  P         GI S     +KICY
Sbjct: 146 RHHILDILMIPFG--NERCRLVFT-AHRGLFVITLAPSQ----RPTGINSPSSATRKICY 198

Query: 250 SGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRTNTELKC 309
           +GFE E  +T    AT     +   +S +E+KL  DI +L++CE+DA+NP  +  TE+K 
Sbjct: 199 TGFELERLLT----ATS-GTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKS 253

Query: 310 FGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKF--- 366
               ++ N  H  KLLK W QT LLP++DI++G RD  +  L  +  YS D + +K    
Sbjct: 254 SVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIR 313

Query: 367 ----NHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDAN 422
               +HP         NFN +VA +W ++ I+ ICE + +++    S+ P+SF V ID N
Sbjct: 314 DRTRSHPSY------FNFNPEVAKDWTHYAIREICERL-SSLVDATSSSPQSFLVEIDKN 366

Query: 423 GTIAI 427
             + I
Sbjct: 367 LQMKI 371

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  132 bits (331), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 184/365 (50%), Gaps = 25/365 (6%)

Query: 71  FVHTSIHDLSRKPPGDIFQDSKEV---ALFTNYQAYTTARKDLIPSLRDGITELYESSLL 127
           F H S++ +  K P  +  D KEV   +   N            P LR  +    + S  
Sbjct: 47  FPHVSVNYVVDKTPK-LLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKDSKW 105

Query: 128 EARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTIV 187
           E +  K  ++G DL    D +VP+  + L+S+   +   E ++      N    +K T V
Sbjct: 106 ENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSL---VILKEAYQRYEKTLN---PEKTTFV 159

Query: 188 SARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNM-KK 246
           S RHHI+D+ M  F   ++  SL++T      I  S +   D      GI+ +  +  KK
Sbjct: 160 SLRHHIIDIIMCPF--LDEPLSLLMTVQPDKNILISVDKSKD---KPNGIHETRNSFNKK 214

Query: 247 ICYSGFEFEHWVTEDIKATDLNGPKHPIF-SVVESKLSEDIGLLMRCEIDAFNPVSRTNT 305
           ICY+GF  E  + E    T+ +  +H ++ S+V   L+++I LL++ E+D+ N ++ T T
Sbjct: 215 ICYTGFALEDLLIES--PTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYT 272

Query: 306 ELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKK 365
           E+K      + N+ HR+KLL+ WIQT LLP SD++IG R+S+S +L  ++ Y    +Y K
Sbjct: 273 EIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHK 332

Query: 366 FNHPGLPPS-KKELNFNAKVAVEWCNHCIKSICELVEANISHYNS-TRPESFEVSIDANG 423
            N+  +     K   FN  VA +W  H    I ++++ N+   +  +   +F+V ID N 
Sbjct: 333 INNSSIVGKPGKFYKFNPNVANDWFQH----IFQVLKQNLLLLSQESTSTTFKVQIDTNL 388

Query: 424 TIAIT 428
           T++I+
Sbjct: 389 TLSIS 393

>Kwal_55.21591 s55 complement(904533..905942) [1410 bp, 469 aa] {ON}
           [contig 128] FULL
          Length = 469

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 87/204 (42%), Gaps = 41/204 (20%)

Query: 180 IGKKFTIVSARHHIVDLTMHRFDRR--NKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGI 237
           + K   +++ R  +VDL +  F  +  N  K   V Y+ +G +    +   D   S    
Sbjct: 104 LPKNIDVLTNRGDLVDLAVSFFPGKDNNFEKMNHVVYLKSGRLFLWHDRARDDTFS---- 159

Query: 238 YSSDPNMKKICYSGFEFEHWVT----EDIKA----TDLNGPKHPIFSVVESKLSEDIGLL 289
              +   +K  YSG +FEH  T    +D+K       L+    P  S+V+  LSED+ +L
Sbjct: 160 ---NSRSRKNWYSGHKFEHMCTHTWPDDVKTWGPLPPLDEAAPPTLSLVQLPLSEDMNVL 216

Query: 290 MRCEIDAFNPVSRTNT---ELKCFGP---------LSMHNSNHRK------------KLL 325
           M  E D   P  +  +   ELKCF P         +S H  ++ K            +  
Sbjct: 217 MMAEYDVRLPKRQGLSGFAELKCFQPRMNNSKCDQISWHKLSNSKILKLLITNTTYMRFF 276

Query: 326 KTWIQTGLLPNSDIVIGLRDSHSG 349
           KT +Q+ L    +++ G+R++ + 
Sbjct: 277 KTLLQSRLSGCENLIYGIRNNKTS 300

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 10/109 (9%)

Query: 306 ELKCFGPLSMHN--SNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLY 363
           ELKC   LS +    N  KKL KTW+Q  L+    I  G RD  S  L  I+ Y  + + 
Sbjct: 234 ELKCTRSLSSYQDIENFEKKLFKTWLQCFLIGIPRITYGFRD-RSYNLTSIEEYLTEDVP 292

Query: 364 KKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRP 412
           K F + G+     +       A++W    I  + + +    +  N  RP
Sbjct: 293 KLFTNRGVKAQCMD-------AIQWYGEIIGWLYDTLAHLETDANEIRP 334

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 98/233 (42%), Gaps = 35/233 (15%)

Query: 140 DLFANIDQFVPMTISELDSIS--PCISYVENWKLSNHGKNFKIGKKFTIVSARHHIVDLT 197
           DL + I +F      E DS +    +S +E ++     K      K  I++ R  I  L 
Sbjct: 58  DLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYERRKSKKT-----KVDIITFRGIIRKLI 112

Query: 198 MHRFD--RRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFE 255
              FD  + N     IV++ G   I   +   ++  ++K    + +    +  YSG++FE
Sbjct: 113 SSAFDSSQFNPVNFRIVSFDGQLFIKEVKTDASETSINK----NRESLQARAYYSGYKFE 168

Query: 256 HWVTEDI------KATDLNGPKHPI------FSVVESKLSEDIGLLMRCEIDA---FNPV 300
              T  +      + T    PK  I       S+V + + +   +L+  E+D    F   
Sbjct: 169 ALATLSLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGIGK-CKILIGAEVDCIFDFKED 227

Query: 301 SRTN----TELKCFGPLSMHNSNHR--KKLLKTWIQTGLLPNSDIVIGLRDSH 347
           S  N     ELKC   ++  +  H+  +KL KTW+Q  L+  + I+ G RD +
Sbjct: 228 SDDNLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDN 280

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 51/123 (41%), Gaps = 26/123 (21%)

Query: 248 CYSGFEFEHWVT--------------EDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCE 293
           CY+G++FE   T              +  K    NG ++   +VV++ +     L++  E
Sbjct: 153 CYTGYKFESLATLSQPLPLVSRTTLEKRPKKISSNGDEY--IAVVKTGVGSS-KLVLGAE 209

Query: 294 IDAFNPVSRTN-------TELKCFGPLSMHNSNHR--KKLLKTWIQTGLLPNSDIVIGLR 344
           ID        N        ELKC   +      HR  +KL KTW+Q  L+    I+ G R
Sbjct: 210 IDCIFDFKEENKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFR 269

Query: 345 DSH 347
           D +
Sbjct: 270 DEN 272

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 22/120 (18%)

Query: 249 YSGFEFEHWVT-----EDIKATDLNG-PKHPI------FSVVESKLSEDIGLLMRCEIDA 296
           Y+G++FE   T       +  T LN  PK  +       SVV++ +  +  +L+  E+DA
Sbjct: 156 YTGYKFEALCTLPEPLPYVSRTKLNKRPKKIVSHGDEFVSVVKTGVG-NCKILLGAEVDA 214

Query: 297 ---FNPVSRTN----TELKCFGPLSMHNSNHR--KKLLKTWIQTGLLPNSDIVIGLRDSH 347
              F    + N     ELKC   ++  N   +   KL KTWIQ  L+  + I  G RD  
Sbjct: 215 IFDFKEKGKDNLQHYIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFRDEQ 274

>TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 93/219 (42%), Gaps = 49/219 (22%)

Query: 170 KLSNHGKNFKIGKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGA--GLISFSRNPK 227
           K  +  KNFK        S +  +  L  +  ++  K K+ I+T+ G    LIS + + +
Sbjct: 65  KFKDFQKNFK-----DRCSLKGLLASLQQYEMNKNTKIKADIITFRGIIRKLISAAFDSE 119

Query: 228 N-----------DFQMSKEGIYSSDPNM----KKICYSGFEFEH---------WVTEDI- 262
                       D Q+  + I   +P +    K   YSG++FE          +V+ ++ 
Sbjct: 120 QFNHVDLRVLVFDGQIFIKEIPQDEPELVGKAKLNAYSGYKFETLATIPQPLPFVSRELL 179

Query: 263 ----KATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDA---FNPVSRTN-----TELKCF 310
               K     G ++   SVV++ +S +  L++  E+D    F   S+TN      ELKC 
Sbjct: 180 EKRPKKIVTTGDEY--VSVVKTGIS-NCRLVLGAEVDCIFDFKESSKTNNIYHYAELKCT 236

Query: 311 GPL--SMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSH 347
             +  +       KK+ +TW+Q  L+    I+ G RD +
Sbjct: 237 QQICTAQQARGFDKKIFRTWLQCFLVGIPRIIYGFRDDN 275

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 81/190 (42%), Gaps = 35/190 (18%)

Query: 183 KFTIVSARHHIVDLTMHRFD--RRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240
           K  I++ R  I  L    FD  R N+    IV++ G   I     P   F   K    ++
Sbjct: 99  KADIITFRGIIRKLISSAFDNPRYNRVNLRIVSFDGQLFIKEVGEP---FVPPK----TT 151

Query: 241 DPNMKKICYSGFEFEHWVT-----EDIKATDL---------NGPKHPIFSVVESKLSEDI 286
           D    +  YSG++FE  VT      ++  T L         NG ++   SVV + + +  
Sbjct: 152 DSIEHRSYYSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVNNGEQY--ISVVRTGVGKS- 208

Query: 287 GLLMRCEIDA---FNPVSRTN----TELKCFGPLS--MHNSNHRKKLLKTWIQTGLLPNS 337
            L++  E+D    F   S  N    TELKC   ++         +K+ KTW+Q  L+  +
Sbjct: 209 KLILGAEVDCVFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVN 268

Query: 338 DIVIGLRDSH 347
            ++ G RD +
Sbjct: 269 RVIYGFRDDN 278

>AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 376

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 71/175 (40%), Gaps = 36/175 (20%)

Query: 249 YSGFEFEHWVTEDI--------------KATDLNGPKHPIFSVVESKLSEDIGLLMRCEI 294
           YSG++FE     D               K    NGP++   +VV + + E   L++  E+
Sbjct: 160 YSGYKFERMALLDRPVAETPREVLESRGKQVVRNGPQYK--TVVRTGVGEH-KLVLGAEV 216

Query: 295 DA-FNPVSRTNTELKCFGPLSMHN--------SNHRKKLLKTWIQTGLLPNSDIVIGLRD 345
           D  F+    T   LK +  L +          +N  +KL   W+Q  L+  + ++IG RD
Sbjct: 217 DGIFDFREPTGDNLKHYVELKVAKKVQTLKDATNFEQKLFSVWLQCFLVGINRVIIGFRD 276

Query: 346 SHSGQLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKV-AVEWCNHCIKSICEL 399
                L  ++ +S   +       GL         NA V A++W     K +CEL
Sbjct: 277 EKF-VLKSVEEFSTSEIPLLLKSTGLR--------NACVDAIKWYGALTKWLCEL 322

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 69/168 (41%), Gaps = 28/168 (16%)

Query: 249 YSGFEFEHWVTEDIKATDL--------------NGPKHPIFSVVESKLSEDIGLLMRCEI 294
           YSG++FE     D    +               NGP++   +V+ + + E   L++  EI
Sbjct: 568 YSGYKFERMALLDRPVAETPREVLESRGKQVVRNGPQYR--TVMRTGVGEH-KLVLGAEI 624

Query: 295 DAFNPVSR-TNTELKCFGPLSM--HNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQL 351
           D        T   LK +  L +   N N  +KL  +W+Q  L+  + ++IG RD     L
Sbjct: 625 DGIIDFREPTGDNLKHYVELKVCQKNRNFSEKLFSSWLQCFLVGINRVIIGFRDEKF-VL 683

Query: 352 LDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICEL 399
             ++ +S   +      P L    +  N     A+EW     K +CEL
Sbjct: 684 KSVEEFSTSEI------PHLLKGTEYSNVCVD-AIEWYGALTKWLCEL 724

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 66/147 (44%), Gaps = 25/147 (17%)

Query: 248 CYSGFEFEHWVTED------IKATDLNGPKHPI------FSVVESKLSEDIGLLMRCEID 295
            YSG++FE+ VT         + T    PK  +       SVV + +  +  L++  E+D
Sbjct: 156 VYSGYKFENLVTVSKPIPYTSRTTIEKRPKKIVSNGDEYISVVRTGVG-NCKLMLGAEVD 214

Query: 296 A-FNPVSRTNTELKCFGPLSMHN-----SNHRK---KLLKTWIQTGLLPNSDIVIGLRDS 346
           A F+        LK +  L   N     S+ RK   K+ KTWIQ  L+    I+ G RD+
Sbjct: 215 AIFDFKEEDKDNLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPRIIYGFRDN 274

Query: 347 HSGQLLDIQWYSRDS--LYKKFNHPGL 371
           +   L  ++ +S D   L  K N P L
Sbjct: 275 NF-ILKSVEEFSTDEVPLLLKSNSPQL 300

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 288 LLMRCEIDA---FNPVSRTN----TELKCFGPLSMHNSNHR--KKLLKTWIQTGLLPNSD 338
           L++  E+D    F    R N     ELKC   ++  +  H+  +KL +TW+Q  L+    
Sbjct: 216 LILGAEVDCIFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPR 275

Query: 339 IVIGLRDSH 347
           I+ G +D H
Sbjct: 276 IIYGFKDDH 284

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 12/89 (13%)

Query: 268 NGPKHPIFSVVESKLSEDIGLLMRCEIDA---FNPVSRTN----TELKCFGPLSMHNSNH 320
           NG ++   +VV + + E   +++  EID    F    + N    TELKC   +S  N   
Sbjct: 204 NGDEY--ITVVRTGVGE-CKVVLGAEIDCIFDFKEEGKDNLKHYTELKCSSQISTTNDVR 260

Query: 321 R--KKLLKTWIQTGLLPNSDIVIGLRDSH 347
           R  KK+ + W+Q  L+    ++ G RD  
Sbjct: 261 RFEKKMFRAWLQCFLVGVPRVIYGFRDDQ 289

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 305 TELKCFGPLS--MHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSH 347
            ELKC   +S      +  +KL KTW+Q  L+  + I+ G RD H
Sbjct: 234 AELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINRIIYGFRDEH 278

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 9/69 (13%)

Query: 288 LLMRCEIDA---FNPVSRTN----TELKCFGPLSMHNSNHR--KKLLKTWIQTGLLPNSD 338
           L++  E+D    F    R N     ELKC   +   +  H+  +KL +TW+Q  L+    
Sbjct: 216 LILGAEVDCIFDFKENGRDNLKHYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPR 275

Query: 339 IVIGLRDSH 347
           I+ G +D H
Sbjct: 276 IIYGFKDDH 284

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 209 SLIVTYMGAGLIS-FSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDL 267
           SL ++Y   GL+  F+ +   D+          D   KK CY  F+  H   E++  T+L
Sbjct: 167 SLDISYTNVGLVEYFTDSAGKDYMF-----VLCDIQNKKTCYKLFQLNHS-AENLPITEL 220

Query: 268 NGPKHPIFSVVESKLSEDIGLLMR 291
           N      F++ ESK+    G L R
Sbjct: 221 NSVILEDFALAESKMVYQFGKLYR 244

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 74/188 (39%), Gaps = 32/188 (17%)

Query: 183 KFTIVSARHHIVDLTMHRFD--RRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240
           K  I++ R  I  L    FD  + NK    +V + G   I    +   + +M+ E     
Sbjct: 98  KADIITFRGVIRRLISAAFDSPKFNKVDLRVVAFDGQIFIRDVASKDEELRMTTES---- 153

Query: 241 DPNMKKICYSGFEFEHWVTEDI------KATDLNGPKHPI------FSVVESKLSEDIGL 288
               +   Y+G++FE   T         + T    PK  +       +VV + +     L
Sbjct: 154 ----RNAWYTGYKFETVATLSQPLPYVDRETVEKRPKKLVNTGDEYITVVRTGVGNS-KL 208

Query: 289 LMRCEIDA---FNPVSRTN----TELKCFGPLSMHNSNHR--KKLLKTWIQTGLLPNSDI 339
           ++  E+D    F    + N     ELKC   +S      +  KK+ KTW+Q  L+    I
Sbjct: 209 ILGAEVDCIFDFKEEGKDNLKHYAELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIPRI 268

Query: 340 VIGLRDSH 347
           + G RD +
Sbjct: 269 IYGFRDDN 276

>TBLA0A02950 Chr1 complement(709449..712349) [2901 bp, 966 aa] {ON}
           Anc_5.322 YHR056C
          Length = 966

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 186 IVSARHHIVDLTMHRFDRRNKRKSLIVTY-MGAGLISFSRNPKNDFQMSKEGIYSSDPNM 244
           I S+ HHIVD  ++R         L++ Y +   LI F    K+  Q+ +E ++    N+
Sbjct: 685 ISSSIHHIVDALIYRNSMLFWSYYLLLHYELNDNLIKFQEVYKDLLQLIQETLFYVFSNL 744

Query: 245 KKICYSGFEF 254
             + ++G+EF
Sbjct: 745 ASLKFAGYEF 754

>Skud_13.37 Chr13 complement(58380..61778) [3399 bp, 1132 aa] {ON}
           YML104C (REAL)
          Length = 1132

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 193 IVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNMK-KICYSG 251
           +V L+ + F+ +NK     +  M +  +   RN  N+ +  + G   SD  ++  + Y+G
Sbjct: 271 VVSLSQNYFEEKNKVHK--IRRMLSKELQEHRNAINNLENKEAG--GSDEKLELNVNYTG 326

Query: 252 FEFEHWVTEDIKATDLNGPKHPIFSVV 278
            +FEH++ +     D+N  K+  FS+ 
Sbjct: 327 KQFEHYLNQLDSLVDMNTIKYVAFSLA 353

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 9/69 (13%)

Query: 288 LLMRCEIDA---FNPVSRTN----TELKCFGPLSMHNSNHR--KKLLKTWIQTGLLPNSD 338
           L++  E+D    F    + N     ELKC   +   +  H+  +KL +TW+Q  L+    
Sbjct: 216 LILGAEVDCVFDFKENGKDNLKHYAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPR 275

Query: 339 IVIGLRDSH 347
           I+ G +D H
Sbjct: 276 IIYGFKDDH 284

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 57/135 (42%), Gaps = 23/135 (17%)

Query: 249 YSGFEFEHWVTE------------DIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDA 296
           YSG++FE   T             D ++  +        +VV++ +     L++  EID 
Sbjct: 162 YSGYKFETLATLSQPVPYVSRATLDKRSKKICNNGDEYVTVVKTGVGS-AKLVLGAEIDC 220

Query: 297 ---FNPVSRTN----TELKCFGPLSMHNSNHR--KKLLKTWIQTGLLPNSDIVIGLRDSH 347
              F    + N     ELKC   +      H+  +K+ +TW+Q  L+    I+ G RD +
Sbjct: 221 VFDFKEDGKDNLKHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDEN 280

Query: 348 SGQLLDIQWYSRDSL 362
              L  I+ YS D +
Sbjct: 281 Y-VLKTIEEYSTDEI 294

>KNAG0D03570 Chr4 (653277..654446) [1170 bp, 389 aa] {ON} 
          Length = 389

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 91  SKEVALFTNYQAYTTARKDLI---PSLRDGITELYESSLLEARRRKVPYLGHDLFANID 146
           S   AL+T Y+ Y T    ++   PS++DGI EL   + +   R      G D+FA ++
Sbjct: 16  SLATALYTAYKLYRTYGDPVLRELPSVKDGIEELIGKTQIVKLRSLSAETGCDIFAKLE 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,491,116
Number of extensions: 2205210
Number of successful extensions: 5133
Number of sequences better than 10.0: 47
Number of HSP's gapped: 5228
Number of HSP's successfully gapped: 47
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)