Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6385.435ON84381542660.0
Suva_2.5415.435ON86987621620.0
YDR369C (XRS2)5.435ON85486121140.0
Smik_4.6355.435ON86386220220.0
NCAS0F033905.435ON8618637351e-83
TDEL0E019005.435ON7628097045e-80
ZYRO0F10054g5.435ON6606946756e-77
KAFR0E038305.435ON8458546691e-74
Kpol_1016.55.435ON8128295623e-60
CAGL0A02838g5.435ON8288215422e-57
SAKL0G02552g5.435ON8348644926e-51
NDAI0B056805.435ON8564274377e-44
KNAG0C049005.435ON7693953503e-33
TBLA0A028205.435ON9254173335e-31
AER402C5.435ON8698823157e-29
TPHA0J025905.435ON7757183051e-27
Ecym_47615.435ON7987362898e-26
KLTH0F16038g5.435ON7924262692e-23
Kwal_55.214225.435ON7821382371e-19
KLLA0E02201g5.435ON8354002272e-18
TPHA0J009707.256ON87568800.70
Suva_2.1184.108ON116638753.0
Skud_2.1044.108ON121438734.5
YBL007C (SLA1)4.108ON124438734.8
Ecym_82395.261ON1652217735.6
TPHA0E024406.196ON42262726.2
Smik_2.1134.108ON123038726.2
NDAI0E004408.808ON41679716.8
Skud_12.11na 1ON41295717.4
ACR293Cna 2ON386126708.6
TPHA0K014304.145ON33399709.6
NCAS0G023902.141ON43896709.7
Skud_16.306.281ON96349709.7
NDAI0C052608.501ON55786709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.638
         (843 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...  1647   0.0  
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   837   0.0  
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   818   0.0  
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   783   0.0  
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   287   1e-83
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   275   5e-80
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   264   6e-77
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   262   1e-74
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   221   3e-60
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   213   2e-57
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   194   6e-51
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   172   7e-44
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   139   3e-33
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   132   5e-31
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...   125   7e-29
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   122   1e-27
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   115   8e-26
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   108   2e-23
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...    96   1e-19
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    92   2e-18
TPHA0J00970 Chr10 (228616..231243) [2628 bp, 875 aa] {ON} Anc_7....    35   0.70 
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    33   3.0  
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    33   4.5  
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    33   4.8  
Ecym_8239 Chr8 (487796..492754) [4959 bp, 1652 aa] {ON} similar ...    33   5.6  
TPHA0E02440 Chr5 complement(518295..519563) [1269 bp, 422 aa] {O...    32   6.2  
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    32   6.2  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    32   6.8  
Skud_12.11 Chr12 complement(12871..14109) [1239 bp, 412 aa] {ON}...    32   7.4  
ACR293C Chr3 complement(896246..897406) [1161 bp, 386 aa] {ON} N...    32   8.6  
TPHA0K01430 Chr11 complement(300282..301283) [1002 bp, 333 aa] {...    32   9.6  
NCAS0G02390 Chr7 (422883..424199) [1317 bp, 438 aa] {ON} Anc_2.1...    32   9.7  
Skud_16.30 Chr16 complement(50752..53643) [2892 bp, 963 aa] {ON}...    32   9.7  
NDAI0C05260 Chr3 complement(1219267..1220940) [1674 bp, 557 aa] ...    32   9.8  

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score = 1647 bits (4266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 815/815 (100%), Positives = 815/815 (100%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
           LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180
           WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180

Query: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS 240
           RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS
Sbjct: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS 240

Query: 241 NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI 300
           NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI
Sbjct: 241 NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI 300

Query: 301 TSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTLHTPEIEVGPAILKKRRLNRR 360
           TSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTLHTPEIEVGPAILKKRRLNRR
Sbjct: 301 TSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTLHTPEIEVGPAILKKRRLNRR 360

Query: 361 RVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRN 420
           RVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRN
Sbjct: 361 RVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRN 420

Query: 421 IQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLSPLTVTRPGLQSNPLIS 480
           IQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLSPLTVTRPGLQSNPLIS
Sbjct: 421 IQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLSPLTVTRPGLQSNPLIS 480

Query: 481 RTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVDRKSPVKELL 540
           RTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVDRKSPVKELL
Sbjct: 481 RTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVDRKSPVKELL 540

Query: 541 QKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLR 600
           QKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLR
Sbjct: 541 QKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLR 600

Query: 601 KPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIR 660
           KPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIR
Sbjct: 601 KPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIR 660

Query: 661 SAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSSAVIQQG 720
           SAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSSAVIQQG
Sbjct: 661 SAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSSAVIQQG 720

Query: 721 PRTQNTFINEDISDEGNQQSFSFSRHSDIAQPAKNKLFVTEDDDKNNMVNDSENGCELIT 780
           PRTQNTFINEDISDEGNQQSFSFSRHSDIAQPAKNKLFVTEDDDKNNMVNDSENGCELIT
Sbjct: 721 PRTQNTFINEDISDEGNQQSFSFSRHSDIAQPAKNKLFVTEDDDKNNMVNDSENGCELIT 780

Query: 781 LKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCEAF 815
           LKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCEAF
Sbjct: 781 LKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCEAF 815

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/876 (54%), Positives = 614/876 (70%), Gaps = 42/876 (4%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MWVIRYQN +EDG I+ ISCCLQASKSYSIGRSSKN L+IKNDKSISRQH+TFKWEIN  
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
           LN K + LSL+NQGKLTSINKKF+KVGE   I   +VSN T IELGT+P  I+  W+ EI
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180
           WNIPS+L +F+T LSQFGI+T++SIDD   +++ISDFPS++D+GMRELYALV+ IPLKK 
Sbjct: 121 WNIPSNLAQFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPLKKS 180

Query: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS 240
           +LLVD+C +LL +SV NLKFDE W +++N P F VF++D SVL SKFM+L+ +I LTT  
Sbjct: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG 240

Query: 241 NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI 300
           NE  L   LR LNV+L +FD +  LY+HVD LKPS KYLILT TNK ENGQ  CT+  LI
Sbjct: 241 NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI 300

Query: 301 TSVIEDALPAITNTKSVPCEIQ-NKKFERVSEVQSTSSKTLHTPEIEVGPAILKKRRLNR 359
           TS+I+D LP++ NTK+VP E+Q N   E+V E  +  SKT+HTPE E  PA+LKKRRLNR
Sbjct: 301 TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAVLKKRRLNR 360

Query: 360 RRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVR 419
           RRVQPLDSL+FFAGGLS+  SS+H+ FADA++    L  KT +SSP I  +D   S +V+
Sbjct: 361 RRVQPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ 420

Query: 420 NIQKVDENNEKENGQKSTGAIVISSPEL--YAEHISEDSEDKPPRLSPLTVTRPGLQ--- 474
           N Q++  +  KENG   TGA+V+ SPE+     H  E+  ++  + SP TVTRP  Q   
Sbjct: 421 NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESLQPSP-TVTRPDSQNIS 479

Query: 475 SNPLISRTTPAHYMEDKRIAENYENGKSSTRD----------------------IIQTLE 512
           + P+   TTP  +ME ++I E+Y+    ST++                       +QTL+
Sbjct: 480 AYPVT--TTPEKHMEGRKIVESYKISDDSTQNENQTQNENQTQNENQTQNEMKIKLQTLK 537

Query: 513 ENHEPPEQSQEKNSYSQVDRKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQ 572
           +N +    SQ+  S+ Q    SP++EL  K +SNTP SFVEAIQ+TKNREV+R KSTIV+
Sbjct: 538 DNRKFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVE 597

Query: 573 LEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNF 632
           LEDDELSEE INQL NLAIVEP+ +LLR P+ +G+N  R+ A+++E G +RQEW +RKNF
Sbjct: 598 LEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNF 657

Query: 633 KTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKENED 692
           KTF KVWP  K   EG+KG+ QNSDFIRSAAFLITRNYVPL+KYSK ++A+  + + N+D
Sbjct: 658 KTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDD 717

Query: 693 MLGLIEMENLVSNTGVSGNTSSAVIQQGPRTQNTFINEDISDEGNQQSFSFSRHSDIA-- 750
           +L L EMENL S+T +  NT ++VIQ+    Q++ + E+ SD+  ++SFSFSR SD A  
Sbjct: 718 VLALTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRRSDTAST 777

Query: 751 -QPAKNKLFVTEDDDKNN---MVNDSENGCELITLKKIGLRPSNFDEPSKGNRRSRSTAA 806
            QP KNKLFV EDDD ++   +VNDSE+G EL+T+ K  L+P   +E SK NR     + 
Sbjct: 778 YQPVKNKLFVAEDDDNDDENDIVNDSEDGFELVTITKSNLQPDAAEESSKRNR-----SG 832

Query: 807 GLHESCEAFXXXXXXXXXXXXXXXXXXPKFKFKRKK 842
           G   S                      PKFKFKRKK
Sbjct: 833 GNAASRPLGSYRNDNVNDSDDDDDDEGPKFKFKRKK 868

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/861 (52%), Positives = 581/861 (67%), Gaps = 27/861 (3%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MWV+RYQNT+EDG IS ISCCLQA K+YSIGRSSKN LIIKNDKSISRQHITFKWEIN  
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
            +LK S L L+N+GKLTS+NKKF+KVGE F I A +V   T IELGT+P  IE  W++E+
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180
           WNIP HLT+FRT LS++GISTE SI+D P NLMISD+P S+DN +RELYALV+ IP+KK 
Sbjct: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180

Query: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS 240
           R L+++C TLLP S  NLKFDEMW D++++PE+NVF+FD ++L SKFM+LN I VLTT  
Sbjct: 181 RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK 240

Query: 241 NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI 300
           +E RLS+ LR  N+ L  FDN+ SLY++VD L+ S +YLILT+T+K ENG+I CTI  ++
Sbjct: 241 SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML 300

Query: 301 TSVIEDALPAITNTKSVPCE-IQNKKFERVSEVQSTSSKTLHTPEIEVGPAILKKRRLNR 359
           TS+I+  L A+ N K      + N KF+++SE  ST  KT   PE+E  P + KKR+LNR
Sbjct: 301 TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR 360

Query: 360 RRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVR 419
           RRV PLDSL FFAGGLS+K+ SE++   DA++L+ G   KTVISSPNI   DE  +  ++
Sbjct: 361 RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ 420

Query: 420 NIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKP------PRLSPLTVTRPGL 473
           N  K  E+  K++G  S GAI++SSP L   + SEDS DK       P+ S   V   G 
Sbjct: 421 NALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGS 480

Query: 474 Q---SNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQV 530
           Q   SN     T   + M+D  + +N+       ++I Q  +   +    S+E +S  Q 
Sbjct: 481 QTISSNSADYETAAVNSMDDAEVTKNFRVNHH--QNIEQPSKNIRKLSNYSREISSPLQE 538

Query: 531 DRKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLA 590
           + KSPVKEL  K KS TP +FVEAIQETKNREV+R KSTIV+L+D+ELSEE INQLKNLA
Sbjct: 539 NCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLA 598

Query: 591 IVEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNK 650
           IVEP+ +LLRK      N      +K E+ +M  EWH+RKNFKTF+KV PK K   E  K
Sbjct: 599 IVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGK 658

Query: 651 GDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSG 710
            +TQ+SDFIR+AAFLITRNYVPL+KYSK +  T+   +ENEDM  L EME   SNT +S 
Sbjct: 659 NNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSD 718

Query: 711 NTSSAVIQQGPRTQNTFINEDISDEGNQQSFSFSRHSDIA---QPAKNKLFVT------E 761
           N +S  IQ+  +  N F NED S+EG + SFSFSR S  A   QP KNK+F+T      +
Sbjct: 719 NINSNTIQKRSQALNRFTNEDSSNEGEEDSFSFSRCSGTAASVQPLKNKIFITDEDDLGD 778

Query: 762 DDDKNNMVNDSENGCELITLKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCEAFXXXXXX 821
            DDK++ +N  EN   L  +K++ LRP+  +E SK +R SRS  +    S  A       
Sbjct: 779 IDDKSDRLNHRENNRNLFVVKEMNLRPNLSEECSKQSRHSRSATSRSRGSFGA------S 832

Query: 822 XXXXXXXXXXXXPKFKFKRKK 842
                       PKF FKR+K
Sbjct: 833 NNGDGDDDDDDGPKFTFKRRK 853

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/862 (53%), Positives = 578/862 (67%), Gaps = 20/862 (2%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MWV+RYQN +EDG IS ISCCLQASKSYSIGRSSKN LIIK+DKSISRQHIT KW+ N G
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
            +   + L LINQGKLTSIN KF+KVGE FII A  VSN T IELG +P  IEV W +++
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180
           WNIPSHL +FRT LSQFGISTE+SI++ P N+MISD+PSSDDN +REL AL   IPLKK 
Sbjct: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180

Query: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS 240
           +LLV +C TLL AS+ +L FDE W D++ SPE++VF+ +  +L SKFMKL+ I +LTT S
Sbjct: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS 240

Query: 241 NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI 300
           NE  L + LR  N+KL +F ++ SLY+HVD LKPS KYLILTS NK ENGQI CT   L+
Sbjct: 241 NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL 300

Query: 301 TSVIEDALPAITNTKSVPCEIQNKKFE-RVSEVQSTSSKTLHTPEIEVGPAILKKRRLNR 359
           TS+I+D L ++ NTKSV  E  N +   R  E  S++SK  HT E E  P ILKKRRLNR
Sbjct: 301 TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVILKKRRLNR 360

Query: 360 RRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVR 419
           RRV PLDSL+FFAGGL+ K+SSE +D  D ++   GL  K+VISSP IGR +E  SL  +
Sbjct: 361 RRVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ 420

Query: 420 NIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLSPLTVTRPGLQ--SNP 477
           + QKV  + EKENG  STGAI++SSPE  A   S+   D  P+ S   +TR   Q  S  
Sbjct: 421 DTQKVAGDIEKENGHNSTGAIIVSSPESDAVRTSKRFLDISPQQSSTNMTRRDSQKKSAD 480

Query: 478 LISRTTPA-HYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVDRKSPV 536
            ++  T A   ME+ +  + Y      T  + QT E +HE    SQ+ +   + D +SPV
Sbjct: 481 FVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPV 540

Query: 537 KELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNE 596
           KE+  + KS+ P SFV+AIQ+TK REV+R KSTIV+LEDDELSEE INQL+ LAIVE N 
Sbjct: 541 KEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANN 600

Query: 597 DLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNS 656
           DLLRK      N+V +  +K  +G++RQEW  RKNFKTF+K WPKFK Q EG+K DTQ S
Sbjct: 601 DLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKS 660

Query: 657 DFIRSAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSSAV 716
           DFIR AAFLITRNYVPL+KYSK NK T+ + +E++DM  L EME + SN  +S  T+S  
Sbjct: 661 DFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISDTTNSTT 720

Query: 717 IQQGPRTQNTFINEDISDEGNQQSFSFSRHSDIA---QPAKNKLFVTED---DDKNNMVN 770
           I + P+TQ  FI+ED SD G + SFSFSR SD A   QP   KLF+T+D   D+K++ V 
Sbjct: 721 IHKRPQTQRIFISEDSSDNGEEDSFSFSRGSDAAPNAQPGTIKLFITDDNGNDNKSDRVY 780

Query: 771 DSENGCELITLKKIGLRPSNFDEPSKGNRR-------SRSTAAG---LHESCEAFXXXXX 820
           D  +  +L+T     L+ +  ++  K N R       SR ++      H +         
Sbjct: 781 DKGSSFKLVTESGTDLQQNMSEQSFKTNGRGMGAISKSRGSSRASDIYHNNNNNNNNNNN 840

Query: 821 XXXXXXXXXXXXXPKFKFKRKK 842
                        PKFKFKR+K
Sbjct: 841 NAADDDDDDDDDGPKFKFKRRK 862

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  287 bits (735), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 271/863 (31%), Positives = 408/863 (47%), Gaps = 139/863 (16%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MWV+RYQ  +EDG    IS C+Q S  Y+IGRS+KN L IKNDKSISRQH++ KWE    
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWE---- 56

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
                + + +INQGKLT I +++L VG+          N  +I+LGT P  + + + S  
Sbjct: 57  ---DRNDIHIINQGKLTYIGEQYLDVGQSLTFGN---VNSLSIKLGTKPVMVHLEFYSSN 110

Query: 121 WNIPSHLTEFRTTLSQFGISTESSI---DDGPINLMISDFPSSDDNGMRELYALVNAIPL 177
           W IP+ LT+F  TL  FG++  + I       I+L++ +   S   G+  L+  +  IP+
Sbjct: 111 WLIPNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGS---GLIPLWGFMKDIPV 167

Query: 178 KKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLT 237
           KK +     C+ L   S  +  FD  W   L      +F      L  +       ++L 
Sbjct: 168 KKPQFFSTACEIL---SSNDNDFDNSWHR-LQETSNTLFCSHYISLKDRSRLFENYVILI 223

Query: 238 TTSNERRLSA-----TLRGLNVKLLN-FDNMKSLYEHVDGLKPSIKY---LILTSTNKTE 288
              NE    A     T   L   ++N F ++ +  ++++ LKP+      L+   + K+ 
Sbjct: 224 LFDNETNKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSP 283

Query: 289 NGQI----QCTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSK------ 338
           N Q+       +  +IT++ +D +  +  T     ++ N+    + E+   S +      
Sbjct: 284 NDQLPDLEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKTNIQP 343

Query: 339 ------TLHTPEIEV------GPA-----ILKKRRLNRRRVQPLDSLSFFAGGLSSKSSS 381
                 ++H  +  V      G A     I+KKRRLNR+RV+PLDSL+FFAGG S K   
Sbjct: 344 SHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPK--- 400

Query: 382 EHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRNIQKVDENNEKENGQKSTGAIV 441
                               I SP +    + +        K   NN       ++  ++
Sbjct: 401 --------------------IGSPAVQETAQATKDESAESDKFRTNNGLTQPSGNSQPLI 440

Query: 442 ISSPELYAEHISEDSEDKPPRLSPLTVTRPGLQSNPLISRTTPAHYMEDKRIAENYENGK 501
            S P +  E +  D  +K  +  P T   P +QS      T P  + E  +   N E G 
Sbjct: 441 HSEPIVLKEVLEAD-HNKNIQEGPTTAV-PVIQS----KSTQPLEHTEQNK---NSEIGS 491

Query: 502 SSTRDIIQTLEENH-EPPEQSQEKNSYSQVDRKSPVKELLQKRKSNT---PLSFVEAIQE 557
            +     + L  N  E P   Q  ++ + V      K L    KSN+   P SFV+AIQE
Sbjct: 492 VAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNL----KSNSLEEPKSFVQAIQE 547

Query: 558 TKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQKN 617
           TKNREV R KST+V+++ DEL+E  INQL +L IVEPN+ L+RK         RT   ++
Sbjct: 548 TKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKK--ASRCECRTPTGED 605

Query: 618 ESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQN--SDFIRSAAFLITRNYVPLRK 675
                R EW  RKNFK F+K++PK+       K DT++  +D IR+ AFLITRNYVP++K
Sbjct: 606 SDKTAR-EWSRRKNFKKFVKIYPKYM------KKDTESDTTDLIRNNAFLITRNYVPMKK 658

Query: 676 YS--------KNNKATECNGKENEDML---GLIEMENLVSNTGVSGNTSSAVIQ---QGP 721
           ++         +    E +  E E++    G + +  +V++   S   S   +Q   Q  
Sbjct: 659 FTGQYNNVPNDDEDMYEHHDYERENIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSA 718

Query: 722 RTQNTFINEDIS-DEGNQQSFSFSRHSDIAQ--PAKNKLFVTEDDDKN--NMVNDSENGC 776
           R ++T    D S DEG  QSFSF R    A+   A N LFV ++DD +  N+ N  EN  
Sbjct: 719 RIKDT--QPDFSDDEG--QSFSFRRSMANAKKTTANNGLFVVDEDDLDSINIPNHQEN-- 772

Query: 777 ELITLKKIGLRPSNFDEPSKGNR 799
               +  + +R    DEP K N+
Sbjct: 773 ----VDSVAVR---LDEPYKENK 788

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  275 bits (704), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 240/809 (29%), Positives = 381/809 (47%), Gaps = 149/809 (18%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MW+++Y   +EDG I  +S CL   +++SIGRSSKN L IKNDKSISR HI+  W+    
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGE------KFIIYAPEVSNLTTIELGTSPFHIEV 114
           L      + LINQG+LT+   K+LKVGE      K  I  P +     IELGT P  +EV
Sbjct: 61  L------IRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPII-----IELGTKPIKVEV 109

Query: 115 AWVSEIWNIPSHLTEFRTTLSQFGISTES-SIDDGPINLMISDFPSSDDNGMRELYALVN 173
            W   ++++PS L++F  TL   GI  ++ ++D+    ++++D         + L+ L+N
Sbjct: 110 VWQDVVFDLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTD---KIKFAYKCLFGLIN 166

Query: 174 AIPLKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEF-----NVFNFDASVLSSKFM 228
              ++  + LV+V   L   S     F+E W  ++ +  +     N+   +  +   KF 
Sbjct: 167 GAVIRNSQFLVEVTNIL---SKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFY 223

Query: 229 KLNRIIVLTTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTS--TNK 286
            +   ++      E    A  RG N +L+  +N + L + +     +   ++L +  T K
Sbjct: 224 LIASDVITMAYVQE----ALERG-NGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTK 278

Query: 287 TENGQIQC-----TINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTL- 340
               +I+       +N +  + ++  L  +   ++ P ++       +++ + +SS++L 
Sbjct: 279 IPGDKIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLS 338

Query: 341 ---HTPEIEVGPA---ILKKRRLNRRRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSP 394
              HTPE  V PA    +K+RR NR  V+PLDSL FFAGG          D++  E   P
Sbjct: 339 NKEHTPEHTVTPAEKPPVKRRRYNR--VKPLDSLMFFAGG----------DYSTEE---P 383

Query: 395 GLGLKTVISSPNIGRMDETSSLAVRNIQKVDENNEKENGQKSTGAIVISSPELYAEHISE 454
              + T   +P      +TS     N+ + D + E     K    IV+ +          
Sbjct: 384 EQEISTQPVNPAASDTAKTSITTQINVPENDASQESSAFDKFQPNIVLKN---------- 433

Query: 455 DSEDKPPRLSPLTVTRPGLQSNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEEN 514
                     PLT+  PG            AH   +   A  +       +DI Q +E N
Sbjct: 434 -------SAKPLTIDSPG-----------DAHNTHEINTANQH------VKDIAQQIEMN 469

Query: 515 HEPPEQSQEKNSYSQVD---RKSPVKELLQKRKS--NTP-------LSFVEAIQETKNRE 562
           H   EQ  E+ + + V+   R +  K+ LQ  KS  N P          V+ I++ K+RE
Sbjct: 470 HPESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLIKDAKSRE 529

Query: 563 VERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQKNESGIM 622
           V+R KST+VQ++ DEL+E+ INQL +LAIV+PN+ L+R+ +I    + R           
Sbjct: 530 VKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHP------ 583

Query: 623 RQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLITRNYVPLRKYSKNNKA 682
              W  RKNFK F+KV  K+K Q  G      +SDFIR++ +L+TR YVP + Y+K +  
Sbjct: 584 --PWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKES-- 639

Query: 683 TECNGKENEDMLGLIEMENLVSNTGVSGNTSSAVIQQGPRTQNTF-INEDISDEGNQQSF 741
                KE +D     E                       +T   F + + I D  + + F
Sbjct: 640 ----SKEMQDFPEASE-----------------------QTSRQFSVPQVIDDPEDAEPF 672

Query: 742 SFSRHSDIAQPAKNKLFVT-EDDDKNNMV 769
           +F+RH+    PA N LFV  EDD +N++V
Sbjct: 673 TFTRHTS-GTPANNGLFVVDEDDSQNDVV 700

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  264 bits (675), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 213/694 (30%), Positives = 340/694 (48%), Gaps = 122/694 (17%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MW++RYQ  +EDG++ H+SCCL+  ++Y+IGRSSKN L IKNDKSISRQH++  W     
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICW----- 55

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
            + K   L LINQGK+T++++K+LK+GE  I +   +  +  +ELGT P  +++ W+  I
Sbjct: 56  -DGKDRQLKLINQGKMTAVSEKYLKMGES-ISFGKSMGTV-LVELGTKPLKMQLQWMDSI 112

Query: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180
           W +P       + L + GI   SS +    NL++ D      N  R LY LV  IPL  L
Sbjct: 113 WMVPQGSRSDHSALEELGIEVLSS-ELSRANLIVID---EQQNYSRWLYGLVKRIPLMNL 168

Query: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLN--SPEFNVFNFDASVLSSKFMKLNRIIVLTT 238
             L  V + +   S    +FD +W  ++N  S  +  +   A VL +        +   T
Sbjct: 169 EFLNVVSQKV---SGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQN--------LEFLT 217

Query: 239 TSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQ----- 293
              +   S  +     K     +++ L E V   K  +  +++  ++ T   ++      
Sbjct: 218 VGKDEDTSLAIEAAGGKYSAVLSVEELREAVK-RKGDLSNVVILKSHLTPAEELAPLGKT 276

Query: 294 CTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTLHTPEIEVG--PAI 351
            T+  ++ ++++D + ++ N   V  E+  +                  PE EV     +
Sbjct: 277 FTVQDVVEAILKDEVNSLKN--GVIGEVAKR------------------PEAEVPMEKPV 316

Query: 352 LKKRRLNRRRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMD 411
            KKRRLNR RV+PLD LSFFAGG S K S                      S+  +   +
Sbjct: 317 TKKRRLNRPRVKPLDILSFFAGGDSMKESQGE-------------------STMKLNSQE 357

Query: 412 ETSSLAVRNIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLSPLTVTRP 471
           E S    ++ +K++  + KE  ++S   +    P+ + E+  E+               P
Sbjct: 358 EES----KDPRKLE--DPKEESKESKEVLQPEVPKEFNEYSKEE---------------P 396

Query: 472 GLQSNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVD 531
           G +S           Y E K      EN KS    +  TL+    PP  + EK + ++  
Sbjct: 397 GQKS-----------YEESKAD----ENEKSLEETVEPTLQVTEPPPTSAAEKPNNARPH 441

Query: 532 RKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAI 591
           RK P     +K +S +    ++ IQ+TKN EV+R  STI+Q+ D+EL+E+ INQL NL +
Sbjct: 442 RK-PTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVL 500

Query: 592 VEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKG 651
           V+ N++L+R+         R R+   +S      W+ RKNFK F+KVWPK+  Q+  ++ 
Sbjct: 501 VDRNDNLMRR---------RDRSPTVDS--HNPNWNNRKNFKNFVKVWPKYGGQDSTSRE 549

Query: 652 DTQNSDFIRSAAFLITRNYVPLRKYSKNNKATEC 685
            +  SD IR+ AFL+TR YVP R Y+  + + + 
Sbjct: 550 GS--SDTIRNRAFLLTRQYVPTRTYTSGDSSKQA 581

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  262 bits (669), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 249/854 (29%), Positives = 396/854 (46%), Gaps = 164/854 (19%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MW++RY+N +EDG +  +SCCLQ  K YSIGRSSKN L IKNDKSISRQHIT +W+ N  
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNN- 59

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
                + LS++NQGKLT+I++ ++K  E    +  E  +   ++LGT P  + ++W    
Sbjct: 60  -EGTGTVLSVVNQGKLTAIDENYMKSDES-KAFDDETYSTVVVKLGTKPVVVRISWTPIF 117

Query: 121 WNIPSHLTEFRTTLSQFGISTE---SSIDDGPINLMISDFPSSDDNGMRELYALVNA-IP 176
           W++     +F  +++  GI T+   S++ D  I+L+I+D  S   N  R ++AL+     
Sbjct: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRD--ISLVINDEKS---NWSRIMFALLKQNCT 172

Query: 177 LKKLRLLVDVCKTLLPASVRNLKFDEMWKDVL----NSPEFNVFNFDASVLSSKFMKLNR 232
           L K  LL +VC  LL     N  FDE+W  +     N   +  F  + + +   F  +  
Sbjct: 173 LVKPVLLSEVCNVLLADCQTN--FDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQF 230

Query: 233 IIVLTTTSNE-RRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQ 291
             V + + ++   L AT+  L     +FD    L  ++  +  ++   I          +
Sbjct: 231 YTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDE 290

Query: 292 IQCTINGLITSVIEDALPAIT--NTKSVPCEI-----------------QNKKFERVSEV 332
           IQ    G+    I++ + AI   N K++P  I                  N+  +R S V
Sbjct: 291 IQ----GIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHV 346

Query: 333 QSTSSKTLHT---------------------PEIEVGPAILKKRRLNRRRVQPLDSLSFF 371
              ++ TL+T                     P   +GP+  K+RRL RR V+PLDSLSFF
Sbjct: 347 HPDNTSTLNTNTHATISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFF 406

Query: 372 AGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDET-----SSLAVRNIQKVDE 426
           AGG ++ S++        + +SP      V S+ +    DE      S L V N ++ ++
Sbjct: 407 AGGSTNPSTT-------LKTVSP-----VVPSNASNTTSDEKPNKVESKLGVNNARRDEQ 454

Query: 427 NNEKEN----------GQKSTGAIVISSPELYAEHISE--DSEDKPPRLSPLTVTRPGLQ 474
            N++ +           Q +T   + +   L  E+  E   +     R  PL    P + 
Sbjct: 455 TNDQVDVVQTALQSLSSQPTTNRSIQNKGILRTENNDEMLTNASIKRRNMPLKPLSPDVD 514

Query: 475 SNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQE--KNSYSQVDR 532
           +N LI            +  ++  N    T    +++E+N        E  +N  S+   
Sbjct: 515 TNLLI------------QPIDSNSNVSQETNVPKESMEDNDNSSNTLSEVNRNILSRKSE 562

Query: 533 KSPVK-ELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAI 591
             P K ++   ++S +P +F+EA+Q TK REV+R ++ IV +   ELSEE IN+L NL I
Sbjct: 563 SGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTI 622

Query: 592 VEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKG 651
           VE N +L+R+           RA KN+S  +   W  R+NFK F KVWP+ +        
Sbjct: 623 VESNPNLIRE----------RRADKNDS--VNDMWKGRRNFKKFNKVWPQHR-------- 662

Query: 652 DTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKENE-DMLGLIEMENLVSNTGVSG 710
                D +R+ AFLI RNYV L+ Y         +GK N+ D     E       +  + 
Sbjct: 663 --DGYDSLRNNAFLIIRNYVELKPY---------DGKRNDNDSSDFHE-----GRSHFND 706

Query: 711 NTSSAVIQQGPRTQNTFINED-------------ISDEGNQQSFSFSRHSDIAQP---AK 754
                VI++G    N  ++ED             ++D GN + F+   +SD A P     
Sbjct: 707 ENDYEVIRRG----NPAVSEDDILLNEMRTKAIGLTDNGNDEDFTRIANSDQAVPTVHGV 762

Query: 755 NKLFVTEDDDKNNM 768
           ++LFV +DD ++ +
Sbjct: 763 SRLFVADDDSEDEL 776

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  221 bits (562), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 227/829 (27%), Positives = 386/829 (46%), Gaps = 105/829 (12%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MWV+RYQ +++DG +  ISCC++  ++Y +GRSSKN L ++NDKSISRQ I+ +W+ +  
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
                  + + N GK+T + +++L  GE     +   ++L T+++GT+P  + ++W  + 
Sbjct: 61  C------IMVKNLGKVTMVEERYLSDGETLSFQSK--NDLVTMKIGTTPIVVNLSWEVKR 112

Query: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180
            N      +    L  +G    +  +   ++++I +  ++  +   + Y++++   L   
Sbjct: 113 CNYMKTDMDMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILINS 172

Query: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASV--LSSKFMKLNRIIVLTT 238
           + L D+   L    +   KFD  W   LNS E N+ N   +V  L+     ++  ++   
Sbjct: 173 KTLRDI---LTNNIIMTKKFDSYWVK-LNSHESNIQNHTINVTKLAKSLKGMHMFLLDPE 228

Query: 239 TSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTING 298
           + N       L  +      F N+  L  +++      ++L+L+S  K EN   Q  +  
Sbjct: 229 SYNCEYFEKFLEEIGCIPRKFLNINDLETYLETQFKGGEFLLLSSA-KLEN---QSRLER 284

Query: 299 LITSVIEDALPAITNTKSVPCEIQNKKFERVSE----------VQSTSSKTLHTPEIEVG 348
            I+  +E  L  +        +  N+  E              V+ T+     +  +E+ 
Sbjct: 285 FISIPLESFLDKLLFLDLDFGQSINRSKEESKNVIEPVLKEVGVEQTTEAVPISKNVEIY 344

Query: 349 PAILKKRRLNRRRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIG 408
               KKRRLNR RV+PLDSL+FFAGG++S  +S+     +          K VI S   G
Sbjct: 345 EPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPVEEANNITRKKDKEVIKSQGKG 404

Query: 409 RMDETSSLAVRNIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLSPLTV 468
            +         NI+   E +E  NG+  + A     P+   +H  E         SP  +
Sbjct: 405 EI---------NIET--EMDESGNGELLSTASEFKKPKSDVQHKLEKRMQVAIDRSPEKI 453

Query: 469 TRPGLQSNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYS 528
            +P L+ N  IS            I +   N   ST D    L E     E + +   Y 
Sbjct: 454 KKPKLEEN--IS------------IQQLLSNKVKSTSDTSSVLIETQIAKESNTKAIEYG 499

Query: 529 QVDRK--SPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQL 586
           +V +K  +  K    +R     +  V AIQ+ K RE  R K++IV+++++EL+EE IN+ 
Sbjct: 500 KVRQKTLTDYKHTSDERIERPSVDLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKF 559

Query: 587 KNLAIVEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKM-Q 645
            +L +V+ N  L  K + L  N      Q N       +W  +KNFK F+K+ PK+K  Q
Sbjct: 560 SDLTVVDINTRLF-KDKSLDINKPANSNQNN------MDWSGKKNFKKFVKMVPKYKRSQ 612

Query: 646 NEGNKGDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSN 705
             G   D+  S FIR++A LITRN+VP+++YSK +  +  N           EM +    
Sbjct: 613 GNGQHADSC-STFIRNSAMLITRNFVPMKQYSKLDNNSNSN-----------EMTDF--- 657

Query: 706 TGVSGNTSSAVIQQGPRTQN--TFINEDISDEGNQQSFSFSRHSDIAQPAKNKLFVTED- 762
                  S+  + + P  +N   + ++D  DE    SF+F+R+S   Q     LFV ++ 
Sbjct: 658 -------SNIEVNKKPVEKNREAYSSDDSVDEP---SFTFTRNSSSKQ-----LFVMDES 702

Query: 763 --DDKNNMVNDSENGCELITLKKIGLRPSNFDEPS---KGNRRSRSTAA 806
             +D  NM+ND   G + ++   I    SNF+ P+   +GN+ S S++ 
Sbjct: 703 INEDSLNMINDK--GLQEMSQNSIA--NSNFEVPNYKDRGNKSSDSSSG 747

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  213 bits (542), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 232/821 (28%), Positives = 371/821 (45%), Gaps = 138/821 (16%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MWV+RY    E G +  +SCC++ +  Y+IGRSSKN+L+IKNDKSISRQH++ KW  +  
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
                  + L N GKLT  ++K+L   E  I Y+ + + +  + LG +P  I ++ + E+
Sbjct: 61  C------IELTNTGKLTKSSEKYLGSNE-LITYSADETQIEML-LGVAPVKIILSRIDEL 112

Query: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPIN----LMISDFPSSDDNGMRELYALVNAIP 176
           ++IP+ L++FR TL   GI  + S+D+  +N    + + DF      G REL+A  N I 
Sbjct: 113 FDIPNSLSQFRETLETLGI--QISVDNANVNSTSLITVGDF------GYRELFAACNDIN 164

Query: 177 LKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVL 236
           +    LL ++C  L+     +  FD  W+ + +S   N+   D   L S+F  +      
Sbjct: 165 IYSSGLLTEICNKLVND---HDNFDAEWRSMQSSYHRNL---DLEGLLSQFGGIRGKFFF 218

Query: 237 TTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTI 296
                +  + + L+   +KL       S+  H D +  +   L L S+ + +   I  + 
Sbjct: 219 LLYKIDWFIISYLKPFLLKL-------SVEIH-DSIHKNDDLLRLISSKQADEIPIVIS- 269

Query: 297 NGLITSVIEDALPAITNTKSVPCEIQNKKFERVS-EVQSTSSKTLHTPEIEVGPAIL--- 352
           N  I  + ED L    ++  +   I++    R +   QS   K ++  E E   AI+   
Sbjct: 270 NEKIKYLPEDTLQ--IHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQK 327

Query: 353 -----------------KKRRLNRRRVQPLDSLSFFAGGLS-------SKSSSEHQDFAD 388
                            KK+R+ R +V+PL+SLSFFAGG+S         + S+     D
Sbjct: 328 RSLANTSQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNGHLD 387

Query: 389 AEKLSPGLGLKTVISSPNIGRMDETSSLAVRNIQKVDENNEKENGQKSTGAIVISSPELY 448
           +E +SP     T      I     T S         D+N+E    Q+S    +    +L 
Sbjct: 388 SE-ISPDSASTT--REQKIPGQSHTISTTRMEHALTDDNSEPTIVQRSIAEGISHRDQLI 444

Query: 449 A-EHISEDSEDKPPR----LSPLTVTRPGLQSNPLISRTTPAHYMEDKRIAENYENGKSS 503
             + + ED    P R    +   T+       N  +     +    +   +  YE   + 
Sbjct: 445 GNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNK 504

Query: 504 TR------DIIQTLEEN---HEPPEQSQEKNSYSQVDRKSPVKELLQKRKSNTPLSFVEA 554
           T         I + E+N     P  +SQ  NS    D K      LQKR     +  V+ 
Sbjct: 505 TELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPK----RTLQKRD----IDIVKL 556

Query: 555 IQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRA 614
           +Q TK  EV+R  STIV++ED EL+EE IN+L +L +VEP  DL           +RT++
Sbjct: 557 VQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADL-----------IRTKS 605

Query: 615 QKNESGIMRQEWHERKNFKTFIKVWPKFKMQN---EGNKGDTQNSDFIRSAAFLITRNYV 671
             + +   +Q+W  RKNFK F+K+ PK+K +    E      + S  I +  FL T+N V
Sbjct: 606 DISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQTKN-V 664

Query: 672 PLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSSAVIQQGPRTQNTFINED 731
           P+  Y+ ++        +  D +  I       NT    N S++ + Q        I  +
Sbjct: 665 PVDYYNSHH--------DQNDFVDEI-------NTAPQANKSNSFVHQ--------ILPE 701

Query: 732 ISDEGNQQSFSFSRHS---------DIAQPAKNKLFVTEDD 763
           I DE N+ SFSF+R +         +    +  +LFV +DD
Sbjct: 702 IGDE-NENSFSFTRTAIGNGNNNSANEINNSNQQLFVVDDD 741

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  194 bits (492), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 244/864 (28%), Positives = 380/864 (43%), Gaps = 189/864 (21%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MW++RY+   EDG+   ISCCL+    Y IGRS+K+ L IKNDKSISR+HI  K  +N  
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLK--VN-- 56

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
              K + L+L+N GKLT++N + L V +    +         +ELG  P    + W  ++
Sbjct: 57  ---KENELNLLNTGKLTTLNAEVLMVDQSLNFHP---KGQLRLELGIKPIIATIEWQDQV 110

Query: 121 WNIPSHL---TEF-RTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIP 176
           W +   L   + F R   + +GIS  +++     NL I     + D     L++LV  I 
Sbjct: 111 WKVSHDLLYNSMFKRQEFNSYGISVTTTMSTR-TNLQI--IKQNQDTYSNCLFSLVKGID 167

Query: 177 LKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVF-NFDASVLSSKFMKLNRIIV 235
           + +   L D    L         +D +WK++L   +  VF NF   V  S F  ++ I+ 
Sbjct: 168 IVRESFLSDFQSHLYMTPT---DYDGIWKNLLQ--KHMVFPNFTTCV--SIFQNISIIVA 220

Query: 236 LTTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLIL---TSTNKT--ENG 290
             +  N  + +  + G   +LL  +NM+   + +     S   +IL   T  N T  +N 
Sbjct: 221 SKSIYNLFKYTIEVAG--GELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNS 278

Query: 291 QIQCT----------------------INGLITSVIE-------DALPAITNTKS----- 316
            I  +                      +N L+ +V++       + +P   + +S     
Sbjct: 279 NIDMSEDARKLEELKAAAESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLE 338

Query: 317 ---VPCEIQNKKF-----ERVSEV-----QSTSSKTLHTPEIEVGPAILKKRRLNRRRVQ 363
              +P +I   +F     ++VSE      Q  +S   +  EI      +K++R NR +V+
Sbjct: 339 EPKLPLKID--EFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVR 396

Query: 364 PLDSLSFFAGG-LSSKSSS--EHQDFADAEKLSPG-------LGLKTVISSPNI------ 407
           PLDSL FFAGG + +K+    ++Q+F    +++ G       +    VI   N+      
Sbjct: 397 PLDSLDFFAGGNIQAKNEGIQKNQEFG-MTRVTEGNSEGFHDVDKDDVIDEQNVEPPRKK 455

Query: 408 ---GRMDETSSLAVRNIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLS 464
                +    +L +R   + +++N KE G+K TG    +      +  SED + K P   
Sbjct: 456 PRRKPVKSLENLMIREKTQAEQHN-KEIGKKPTGNECANK-----KPGSEDKKQKEPEAV 509

Query: 465 P--------LTVTRPGL--QSNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEEN 514
           P        +   RPG   QSN   S   P H                            
Sbjct: 510 PPYAMNEISIIPERPGQLEQSNNTASANRPRHI--------------------------- 542

Query: 515 HEPPEQSQEKNSYSQVDRKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLE 574
              P Q  +  + S   R  P   L  +   N   + VEAIQ+TK+REV R K+T++Q++
Sbjct: 543 ---PVQV-DNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQDTKSREVSRLKNTLIQID 598

Query: 575 DDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKT 634
            +EL+E  IN L NLAIVE  +DL+RK      NS R     +++ +    W  RKNFK 
Sbjct: 599 KNELTENAINSLSNLAIVE-KKDLIRK------NSERGHCISSDTCL----WEGRKNFKK 647

Query: 635 FIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLITRNYVPLRKYSKNNKAT-----ECNGKE 689
           FIKV P+ + Q E    D +N   ++++AFLITR YVPL+K+  N K         N   
Sbjct: 648 FIKVQPR-RSQRETFDSDGKN--IVKNSAFLITREYVPLKKFDPNEKEQIDDTFFLNHSA 704

Query: 690 NEDMLG-----LIEMENLVSN-TGVSGN---TSSAVIQQGPRTQNTFINEDISDEGNQQS 740
           NE  +      + E  N   +  G   N   T S      PR ++T  N DI  +   +S
Sbjct: 705 NEGPIPAQPRRIDETSNFTDDEEGPVFNFKRTKSKDPSISPRKEHTLTNGDIEMKETSRS 764

Query: 741 FSFSRHSDIAQPAKNKLFVTEDDD 764
                        +N+LFVT++DD
Sbjct: 765 -------------ENRLFVTDEDD 775

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  172 bits (437), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 141/427 (33%), Positives = 203/427 (47%), Gaps = 88/427 (20%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MW++RYQ  +EDG I  +S CL+ S +YSIGRSSKN L IKNDKSISRQHIT KWE +G 
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSG- 59

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
                  L L+NQGKLTS+ +++L + E  I    +   L  + LGT+P  +++ W    
Sbjct: 60  ------QLHLVNQGKLTSVKERYLAIDESLIFNVVDTKEL-DVHLGTNPVIVQIRWQPMN 112

Query: 121 WNIPSHLTEFRTTLSQFGISTESSI--DDGPINLMISDFPSSDDNGMRELYALVNAIPLK 178
             IP+   +FR  L+++GI   S I  +D  I  ++     + ++    L AL   IP+ 
Sbjct: 113 LYIPNMYEQFRGLLTKYGIEVTSDILQEDSHITAVV----MTPNDYYVPLLALALGIPVF 168

Query: 179 KLRLLVDVCKTLLPASVRNLKFDEMWKDV--LNS-------PEFNVFN------------ 217
           K + L +V   L P    N+ FD    DV  +NS       P F++ N            
Sbjct: 169 KSQYLTEVSNMLRPD---NITFD---TDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFI 222

Query: 218 -----------FDASVLSSKFMKL---------------NRIIVLTTTSNERRLSATLRG 251
                       D S +  K ++L               N +  + +TS +  +  T   
Sbjct: 223 ITLNKSSVSEHADKSFILRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDED 282

Query: 252 LNVKL-LNFD--NMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLITSVIEDAL 308
              ++ +NF+  N+K +++      P      L  +N TE G            V+    
Sbjct: 283 NGKRMIMNFECRNVKDIFDSFVKNDPK-----LLKSNLTETG------------VVSPKA 325

Query: 309 PAITNTKSVPCEIQNKKFERVSEVQSTSSKTL-HTPEIEVGPAILKKRRLNRRRVQPLDS 367
           P I   + +  EIQ    E     +STSSK L HTP   V   I+KKRRL R+RV+PL+S
Sbjct: 326 PEIFENEKLMVEIQEPPIEAAITEESTSSKNLKHTPPEPVTTHIVKKRRLARKRVKPLES 385

Query: 368 LSFFAGG 374
           L FF GG
Sbjct: 386 LDFFVGG 392

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 168/561 (29%), Positives = 262/561 (46%), Gaps = 97/561 (17%)

Query: 233 IIVLTTTSNERRLSATLRGLNVKLLNFD--NMKSLYEHVDGLKPSIKYLILTSTNKTENG 290
           I+++T   N +R+          ++NF+  N+K +++      P      L  +N TE G
Sbjct: 275 IVIVTDEDNGKRM----------IMNFECRNVKDIFDSFVKNDPK-----LLKSNLTETG 319

Query: 291 QIQCTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTL-HTPEIEVGP 349
                       V+    P I   + +  EIQ    E     +STSSK L HTP   V  
Sbjct: 320 ------------VVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLKHTPPEPVTT 367

Query: 350 AILKKRRLNRRRVQPLDSLS-FFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIG 408
            I+KKRRL R+RV+PL+SL  F  G  +             E + P +     I +  I 
Sbjct: 368 HIVKKRRLARKRVKPLESLDFFVGGSTTGTPFETSSTTLQQEIIEPKVPDVAPILNEQIQ 427

Query: 409 RMDETSSL--AVRNIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLSPL 466
           +     S+    ++I  +  ++ KE     T A+  ++ + + +  ++  +D P +   +
Sbjct: 428 QSQVNKSINEPAKDIYSIGGSDRKE-----TAALTYATIDKHMQEPTQQIDDIPSQHIDI 482

Query: 467 TVTRPGLQSNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNS 526
           +   P   SN                  E  +   SS +  + T + N E  E+     +
Sbjct: 483 S---PHGNSN------------------EQEKRSNSSEKSPMITQQVNDEKDEKISNAKA 521

Query: 527 YSQVDRKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQL 586
                 K   +E  ++    TP S VE IQ+ KNREV R +S+I  ++ +EL+E+ IN+ 
Sbjct: 522 L-----KIGKREDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEF 576

Query: 587 KNLAIVEPNEDLLRKPQ-----ILGTNS-VRTRAQKNESGIMRQEWHERKNFKTFIKVWP 640
            NLAIVE N  L+R+ +        TNS VR  +  N   ++      R+NFK F+KV+P
Sbjct: 577 SNLAIVESNASLIRRTENNDNTNKSTNSVVRHDSPDNIMNVLEG----RRNFKRFVKVYP 632

Query: 641 KFKMQNEGN----KGDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATEC-NGKENEDML- 694
           K+ +QN+ +    +GD   SDFIR+ AFLITRNYVPL++YSK + +    NG  +E+ML 
Sbjct: 633 KY-IQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGKNGFNDEEMLE 691

Query: 695 -GLIEMENLVSNTGVS--------GNTSSAVIQ-------QGPRTQNTFINEDISDEGNQ 738
              +E +N  +  G+S        G   SA  Q           + N   +ED +++ N 
Sbjct: 692 KEYVEYDNEEAGNGLSSTQHENENGVHLSATNQAHFQRSRSSQSSYNVDADEDSNEDDNI 751

Query: 739 QSFSFSRHSDIAQPAKNKLFV 759
           +SFSFSR S   +PA NKLFV
Sbjct: 752 KSFSFSRTSLPKEPAPNKLFV 772

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  139 bits (350), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 119/395 (30%), Positives = 191/395 (48%), Gaps = 27/395 (6%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSK-NSLIIKNDKSISRQHITFKWEING 59
           MW++RY    ED    ++SCCLQ S++YSIGRSSK N+L+IKNDKSISRQHI+F+W    
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQW---- 56

Query: 60  GLNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSE 119
              +   ++ ++N GKLT IN  FLK  E   I +   S  T I++G++P  + + W  +
Sbjct: 57  ---VSHDYVDIVNDGKLTYINDAFLKPKETTRI-SISASKETNIKVGSAPVIVNLVW-ED 111

Query: 120 IWNIPSHLTEFRTTLSQFGISTESS-----IDDGPINLMISDFPSSDDNGMRELYALVNA 174
           ++   + +++   +L   GI    S     I+D    L I      +     +L AL+  
Sbjct: 112 VFIDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIK---IKEIKWPHQLIALIRG 168

Query: 175 IPLKKLRLLVDVCKTLLPASVRNL-KFDEMWKDVLNSPEFNVF-NFDASVLSSKFMKLNR 232
                   LVD+    L  S  N+  FDE+W   ++S ++  + NF   V  + F     
Sbjct: 169 ANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNF--KVDRNSFRDFTI 226

Query: 233 IIVLTTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQI 292
           I      S+   + + +      LL+F N +S  ++    +     L+L S     +  +
Sbjct: 227 IYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPV 286

Query: 293 QCTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTLHTPE--IEVGPA 350
              +N +          A+T   +V   +  + F R       + K +  P+  +E    
Sbjct: 287 YEILNKIDICSTGSFFKAVTE-NNVSTLVHRELFLR--RYTDITQKEMRRPKEPVEDTAV 343

Query: 351 ILKKRRLNRRRVQPLDSLSFFAGGLSSKSSSEHQD 385
            LKKRRLNRR+VQPL+ L FFAGG ++ ++ +  D
Sbjct: 344 PLKKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSD 378

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 116/417 (27%), Positives = 204/417 (48%), Gaps = 58/417 (13%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MW+I Y     D  ++++SCCL+ +++YSIGRS K+ L +KNDKSISRQH+TF W     
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHW----- 55

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
                + LSL+NQGKLT +N + L   E  +  A ++ +   +ELG +P  +  AW + +
Sbjct: 56  TGNLNNQLSLLNQGKLTRVNSRILNPAETLLFNA-DIEHPAEVELGATPVVVCGAWTNHV 114

Query: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGP-----INLMISDFPSSDDNGMRE---LYALV 172
           +NIP    +F + L  +G     +I+ GP     I  +I   P   +N        Y+LV
Sbjct: 115 YNIPIEFQQFESQLKDYGF----NINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLV 170

Query: 173 NAIPLKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVF-NFDASVLSSKFMKLN 231
           N   + K   L  +   L P +V     D  ++++L++ +   F N +   L  +   + 
Sbjct: 171 NKSIILKSSFLTSLLNLLNP-NVTTFNID--FQNLLDASKIEDFRNINLESLKVELTGIK 227

Query: 232 RIIVLTTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQ 291
            I++   T++     A +  +N+  +  ++  +++ +        + ++LT++N      
Sbjct: 228 LIVLNDNTTDLIYFIAAMEVINLPTITTED-DTIFINTVKSHSEERLILLTTSNSRHIET 286

Query: 292 IQC-------------TINGLITSVIEDALPAI--TNTKSVPCEIQNKKFERVSEV---- 332
           I+               IN LI  + +D+   I   + +++    +N+ + ++S      
Sbjct: 287 IKVHTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDN 346

Query: 333 ----QSTSSKTL--HTPEIEVGPAI---------LKKRRLNRRRVQPLDSLSFFAGG 374
                +T S +L   T E+ + P++         +K+RRLNR+RVQPLDSL FF GG
Sbjct: 347 NKVNSNTISDSLLKQTSEL-IKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGG 402

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 131/245 (53%), Gaps = 45/245 (18%)

Query: 534 SPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVE 593
           SPVK      +S TP +F+ A+Q+ KNRE +R  S  V++ D+EL+EE IN+  NLA+VE
Sbjct: 598 SPVK------RSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVE 651

Query: 594 PNEDLLRKPQILGTNSVRTRAQKNESGI--MRQEWHERKNFKTFIKVWPKFKMQNEGNKG 651
            N D+           V +  +KN   I  +  +W  RKNFK F+K  PK++M+   + G
Sbjct: 652 TNVDI-----------VISEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPS-G 699

Query: 652 DTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNG-KENEDMLGLIEMENLVSNTGVSG 710
           D   + FIR++AFL+ R YVP++++  NN+        E        + E L SN G S 
Sbjct: 700 DNGVASFIRNSAFLLAREYVPMQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSN-GASM 758

Query: 711 NTSSAVIQQGPRTQNTFINEDISDEGNQQSFSFSRHS----------DIAQPAK-NKLFV 759
           NT    I Q      TF ++D+  E  +QSFSFSR S           I +  K N LFV
Sbjct: 759 NT----ITQ------TFSSDDL--ETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFV 806

Query: 760 TEDDD 764
           TEDDD
Sbjct: 807 TEDDD 811

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score =  125 bits (315), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 225/882 (25%), Positives = 371/882 (42%), Gaps = 178/882 (20%)

Query: 1   MWVIR--YQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEIN 58
           MWV +  YQ + + G + +ISC L   + + +GR+SK++L+I+ +K +SR H+       
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLR------ 53

Query: 59  GGLNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVS 118
             L +   H++++  G    +  +    G   + + P  S +  +E+G+      + W  
Sbjct: 54  --LEVIDDHVNILLLGSQLKVGGEDASKGS-VLPFGPSQSPVI-LEVGSHSVQCILEWAQ 109

Query: 119 EIWNIPSHLTEFRTTLSQ----FGISTESSIDDGPINLMISDFPSSDDNGM-RELYALVN 173
             + +P+ L +    L +     GI   +S      + +I   P  DD    + L+ALV 
Sbjct: 110 WEFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIR--PHEDDQDYEKYLFALVK 167

Query: 174 AIPLKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSP-EFNVFNFDASVLSSKFMKLNR 232
            IP+  L  L      LL   V +  FD   + +      F  F   A+ L+     +NR
Sbjct: 168 GIPILHLEFLKQFT-ALLRQPVTD--FDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNR 224

Query: 233 ---IIVLTTT-----------SNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKY 278
                +L  T            +   LSA L+ + +       +   Y+H  G+   +K 
Sbjct: 225 KHDFEMLKYTLEIGGGTVHFCHDINDLSACLKTIPIN----GALALKYDH--GISAEVKK 278

Query: 279 LILTSTNKT--ENGQIQCTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTS 336
           +  T   +    +G    T++ L  +++ D L  +  +K  P  ++      V  V ST 
Sbjct: 279 VDDTRYCEVLHSHGIQLFTVHELTKAILYDKLAQLL-SKRPPTMMK-----LVEPVPSTI 332

Query: 337 SKTLHTPEIEVGPAIL-----------KKRRLNRRRVQPLDSLSFFAGGLSSKSSS--EH 383
           S+T    +  + P  L            K R   ++ QPLDSLSFFAGGLS ++SS    
Sbjct: 333 SQTQEMKQESLSPISLGNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGT 392

Query: 384 QDFADAEKLSPGLGLKTVISSPN-IGRMDETSSLAVRNIQKVDE--NNEKENGQKSTGAI 440
            D    E +S  LG  T   SPN +  +  T S   R   KV+   N      QK+    
Sbjct: 393 ADLVKQESMS--LGADTHYGSPNDVQSLPATQSPKKRRRPKVEPLGNLMTSQLQKAFDDP 450

Query: 441 VISSPELYAEH-----ISEDSEDKPPRLSPL-----TVTRPGLQSNPLISRTTPAHYMED 490
            ISS ++         + E    K P   P+     T  +  ++SN    + +P +  E 
Sbjct: 451 TISSAKVSPTEQEIIPVRESQAKKTP--DPIGAFNGTSQKGSIESNSRKRQPSPGYPYEP 508

Query: 491 KRIAENYENGKSSTRDII----QTLEENHEPPEQS---QEKNSYSQV------------- 530
             +     NG     DI+    ++L+E  +PP +    QE + YS+V             
Sbjct: 509 --LPAGVGNG-----DILNKQWKSLDE--QPPSKKPRMQETDLYSEVMSGSSEEYREELT 559

Query: 531 -------DRKS-----------PVKELLQKRKSNTP-LSFVEAIQETKNREVERFKSTIV 571
                  D +S           PV    +++    P  + V+AI++ K REV R ++TIV
Sbjct: 560 RSKLNSLDEESIKSRKRTSSEKPVNSCKRRQAPAVPEQNIVDAIKQIKEREVNRIRTTIV 619

Query: 572 QLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGT--NSVRTRAQKNESGIMRQEWHER 629
           +L  +EL+E+ I QLK+LAIV+P  D+LR+   + T  +S  T A              R
Sbjct: 620 ELGPEELTEDAIRQLKSLAIVQP-VDMLRQQHTVDTVGSSPLTFA--------------R 664

Query: 630 KNFKTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKE 689
           KN+K F KVWPK+         + +NS   R+A  +  R Y+PL  Y  + ++       
Sbjct: 665 KNYKNFKKVWPKYM--------NRKNSPETRNATAISNRKYLPLELYETDLQSRTL---- 712

Query: 690 NEDMLGLIEMENLVSNTGVSGNTSSAVIQQG---PRTQNTFINEDI---SDEGNQQSFSF 743
            ED     + +N+  +T  SG ++     +G   P   + F N  +    + G +  F+F
Sbjct: 713 FEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGNDNAGPEPIFNF 772

Query: 744 SR------HSDIAQPAK-----NKLFVTED--DDKNNMVNDS 772
           S       +S  A PA      N LFV +D  +D + M + S
Sbjct: 773 SSRSREDTNSPTASPAPNLTHDNTLFVVDDENEDGDGMADTS 814

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 186/718 (25%), Positives = 330/718 (45%), Gaps = 98/718 (13%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           M ++RY+N + DG ++ +SCCL     Y+IGRSSKN   IKNDKSISRQH++  W+ +  
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSS- 59

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGE--KFIIYAPEVSNLTTIELGTSPFHIEVAWVS 118
            + K   + + N GK+T I  K+L   E  +F +   ++     + +GTSP  +E+    
Sbjct: 60  -DDKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLIDKKLE----VNIGTSPITLEIFNQE 114

Query: 119 EIWNIPSHLTEFRTTLSQFGISTESSIDDGPINL-------MISDFPSSDDNGMRELYAL 171
            + N    + + + + S+  ++  + + D P+ L       +I +   +D   + EL++ 
Sbjct: 115 VVCN---SIEDIQNSDSKLILNNLNILQDDPLTLKREGPTIIIKENSYTD--ILLELFSN 169

Query: 172 VNAIPLKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLN 231
           V  IP+    + ++  + +  A+     +D+++    N  +  + +       S+  K  
Sbjct: 170 VFGIPI----VTIEELRGIANANDFYSYWDKIYSRKKNKGKACMLDLSTCYYISEVDKYV 225

Query: 232 RIIVLTTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQ 291
             + +      R L+A ++ L  K    D +K + +++     S K+ +L  +N    G+
Sbjct: 226 DYVKVAI----RSLNAEIKILKDK---DDLVKDIRKNISKGNIS-KFFVL--SNDITQGE 275

Query: 292 IQCTINGLITSVIEDALPAITNTKS--VPCEIQNKKFERVSEVQSTSSKTLHTPEIEVGP 349
            +   N  +TS+ +      TN     V  +  + K E   EV+S     +   +    P
Sbjct: 276 -EAPFNISVTSIAKLLEAVKTNNMKDIVMHDYSSFKIEIPREVKSPKDDNIIEKQ---EP 331

Query: 350 AILKKRRLNRRRVQPLDSLSFFAGGLS-------SKSSSEHQDFADAEKLSPGLGLKTVI 402
              K+RR+NR +V+PLD+LSFFAGG+S       +K S++ Q   + EK           
Sbjct: 332 PAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHSINTKPSNDVQSHQETEK----------- 380

Query: 403 SSPNIGRMDETSSLAVRNIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDS-EDKPP 461
                    + ++  + +IQ V+ N ++    KST      +    A+   +DS  +KP 
Sbjct: 381 ---------DVNNSKIESIQDVESNQDQTKYDKSTELQKSKAVSKNADDKLQDSTAEKPI 431

Query: 462 RLSPLTVT---RPGLQSNPL-ISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEP 517
             +P T T    P +    +  S       ME  R+     N K ++ D    L +N   
Sbjct: 432 NFNPTTKTPSFSPSINDKAIENSNANLDPTMEKTRV-----NKKPASLDTKNNLLDNKLI 486

Query: 518 PEQ-----SQEKNSYSQVDRKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQ 572
            EQ     S + N    V R+  + +     KS++    V  IQ  K+R V+R  S IV 
Sbjct: 487 AEQINEALSAKTNDAPVVRRRRTLLDYGNTDKSSS-TDLVRTIQNVKSRGVDRVNSKIVT 545

Query: 573 LEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQK---NESGIMRQEWHER 629
           ++++EL+EE +N+  ++ +V+ N+ L++K            AQK   N +      +  R
Sbjct: 546 VDENELNEEELNKFFDVVVVDVNDKLMKK---------HPNAQKVIDNANIDHNSNFKNR 596

Query: 630 KNFKTFIKVWPKFKMQNEGNK-GDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECN 686
           K++K F K  PK+  Q++ NK   +  SD   +      RN +PLRKY++N K  E +
Sbjct: 597 KDYKLFKKSIPKW--QSKLNKQHHSMTSDNGENLVVSKNRNKIPLRKYNENEKIHEAD 652

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  115 bits (289), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 190/736 (25%), Positives = 320/736 (43%), Gaps = 155/736 (21%)

Query: 1   MWVIR--YQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEIN 58
           MW+ +  YQN  +   ++ IS  ++  K+Y +GR+SK+SL+I +++ +SR H        
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTH-------- 51

Query: 59  GGLNLKASHLSLINQGKLTSINKKFLKVGEKFII------YAPEVSNLTTIELGTSPFHI 112
             L LKA+     N  ++T +  + LK+G K I       + P+ S L  +E+G+     
Sbjct: 52  --LQLKANR----NIIEITLLGAQ-LKIGHKTIEKGISCEFHPKQSPLR-LEVGSHSIEC 103

Query: 113 EVAWVSEIWNIPSHL----TEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMREL 168
           ++ W    + +PS L            Q GI    S+     + ++       D   + L
Sbjct: 104 KLLWTQWEFKVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYD-KYL 162

Query: 169 YALVNAIPLKKLRLLVDVCKTLLPASVR-NLKFDEMWKDVLNSPEFNVFNFDASVL---- 223
           +ALV  +PL ++  L  +   L   +++   K  E+ ++    PEFN        L    
Sbjct: 163 FALVKGLPLVEVGFLKGISSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIV 222

Query: 224 --SSKFMKLNRIIVL--------TTTSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLK 273
               +F  L   I +         T  +  ++++T+    V L+   N  ++   +D  K
Sbjct: 223 PEKDEFDILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSN--NISPAIDTQK 280

Query: 274 PSIKYLILTSTNKTENGQIQCTINGLITSVI----EDAL--PAITNTKSVPCEIQNKKFE 327
           P+   ++L   +    G  Q     L  +V+    E+ L   +I++ + + C   N K +
Sbjct: 281 PTDHNILLEKAHSI--GFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCN-SNDKLK 337

Query: 328 RVS---------EVQSTSSKTLHTPEIEVGPAILKKRRLNRRRVQPLDSLSFFAGGLSSK 378
             S          V +TS   L+T   E  PA  KKRR+N   V+PLDSLSFFAGG   +
Sbjct: 338 TTSTSLEDGLKVNVSATSGLNLNT---EGPPA--KKRRINS--VKPLDSLSFFAGGSIER 390

Query: 379 SSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRNIQKVDENNEKENGQKSTG 438
           S+   ++ ++ + + P              ++ ETS  ++  +         ++G K   
Sbjct: 391 STRVERNSSEKQTVQPA----------EHNKIAETSIASIELLP-------TKSGIKEIT 433

Query: 439 AIVISSPELYAEHISEDSEDKP-PRLSPLTVTRPGLQSNPLISRTTPA--HYMEDKRIAE 495
            +V   PE         +E++P P +SP               + +PA    + D R  +
Sbjct: 434 DVV---PE---------TENEPEPMVSP--------------KKRSPAKNESLADMRAGD 467

Query: 496 NYENGKSSTRDIIQTLEENH----------EPPEQSQEKNSYSQVDRKSPVKELLQKRKS 545
           N+ + K +T ++ ++ E +H          E  E S E+  +   + K           +
Sbjct: 468 NHVSIK-TTLEVEKSAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESKDST------LST 520

Query: 546 NTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQIL 605
            +  S V AI+E K REV R K+TIV++  DEL+EE I +L  LA+VE + D+LRK Q  
Sbjct: 521 QSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVE-SVDMLRKTQ-- 577

Query: 606 GTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFL 665
                 +R  K E+    +  H R+NFK F+KVWP +      NK   Q+      A   
Sbjct: 578 ------SRHMKTETN---KRHHVRRNFKRFVKVWPAYL-----NKAICQDP---MGAQRY 620

Query: 666 ITRNYVPLRKYSKNNK 681
             R  VPL+ Y   NK
Sbjct: 621 SNRQCVPLKVYEPMNK 636

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 110/426 (25%), Positives = 176/426 (41%), Gaps = 47/426 (11%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MW++RYQ   E G    +SCCL+    Y +GRS K+ L IK DKSISR+H+  +   N  
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN-- 58

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
                S L ++N GKLT I    +K+ ++ + +  + S    +E+G  P    V +   I
Sbjct: 59  -----SKLEVLNAGKLTKIGGDNVKM-DQMLEFGADQS--VALEMGAGPVKGTVTYEPAI 110

Query: 121 WNIPSHLT---EFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPL 177
           W IP  L      +  LS + I   +S+       +I +   S  N    L+ALV  IP+
Sbjct: 111 WKIPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNC---LFALVKKIPI 167

Query: 178 KKLRLLVDVCKTLLPASVRNLKFDEMWKDVL--NSPEFNVFNFDASVLSSKFMKLNRII- 234
                + D         +    FD  W+ +   N+P   +   DA+     F+  N+   
Sbjct: 168 MCEGFIGDFVSQFADTQI---DFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTF 224

Query: 235 -----VLTTTSNERRLSATLRGLN------VKLLNFDNMKSLYEHVDGLKPS------IK 277
                ++   S    L   +  L       +K  N   +  L E    L         I+
Sbjct: 225 AIYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQ 284

Query: 278 YLILTSTNKTENGQIQCTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSS 337
              L        G     +N ++ +V+++ + ++ +   VP   Q K  E  S   S + 
Sbjct: 285 EAKLLKNKARSLGFKTRDVNDIVDAVLKNDILSLLD--RVP---QEKALEENSAGGSIAG 339

Query: 338 KTLHTPEIEVGPAILKKRRLNRRRVQPLDSLSFFAGGLSSKSSSEHQDFADAEK---LSP 394
             +    +   P +  KR+   R++QPL+SL+FF GG S     E       E+   L  
Sbjct: 340 SQVLADIVADAPNLRNKRKRANRQIQPLNSLAFFGGGSSLSQKLEQVSTPAKEQNLELQE 399

Query: 395 GLGLKT 400
           GLG+ T
Sbjct: 400 GLGVHT 405

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 82/138 (59%), Gaps = 14/138 (10%)

Query: 543 RKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKP 602
           R++  P+SF +A++ETK+ EV+R +  IV +  +EL+EE IN+L  LA+VE  +DL+R  
Sbjct: 515 REAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVE-TKDLMR-- 571

Query: 603 QILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIRSA 662
                 + R  A   +SG   Q W  RKNFK F+K+WP    +N  +      ++ +R+ 
Sbjct: 572 ------ADREYAVCGQSGGSEQ-WAGRKNFKKFVKLWPSRSSRNSPDSA----TNALRNR 620

Query: 663 AFLITRNYVPLRKYSKNN 680
           A LITR YVPLR Y   N
Sbjct: 621 AHLITREYVPLRPYEGQN 638

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 111/237 (46%), Gaps = 21/237 (8%)

Query: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60
           MW++RYQ    +G   H+SCCL+    YSIGRS+KN L IK+DKSISR H+    E++  
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVEL--EVDQS 58

Query: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120
            N+    L ++  GKLT ++ K +K G+     A E       E+G SP    V      
Sbjct: 59  CNVV---LRVV--GKLTKVSGKSVKAGQHLQFTADEE---VLFEMGASPIKATVVKQQSF 110

Query: 121 WNIPSHLT---EFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPL 177
           W IP  L+        L+ F I   +S+       +I D   S  N    L++L+  IP+
Sbjct: 111 WKIPHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNC---LFSLIKNIPI 167

Query: 178 KKLRLLVDVCKTLLPASVRNLKFDEMW-KDVLNSPEFNVFNFDASVLSS-KFMKLNR 232
            +   + D    +      +  FD  W + V+ + +F  +  +    ++  F+  NR
Sbjct: 168 LREHFIGDFVTQINDV---HADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNR 221

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 102/400 (25%), Positives = 173/400 (43%), Gaps = 67/400 (16%)

Query: 1   MWVIRYQNTVEDGHISHISC-CLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEING 59
           MW++ +    ++   SH  C  LQ    YSIGRS+K +  I+ DKSISR H+  K++   
Sbjct: 1   MWIVSFIFD-DEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD--- 56

Query: 60  GLNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSE 119
                 S L + N+GKLT  N++ + + E  +++       T I +G  P  + V +  E
Sbjct: 57  -----GSDLIITNKGKLTKFNEEIIPLDETIVVHNQN----TVINIGGMPIDVNVRYFYE 107

Query: 120 IWNIPSH--LTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPL 177
            W IP    L E ++ +S FG+    S        + SD  SS  +G   L+AL+  +P+
Sbjct: 108 EWKIPHRLELNETKSLVSDFGVKLSESFSKKTTTQICSD--SSSYSGC--LFALLKGVPV 163

Query: 178 KKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPE-FNVFNFDASVLSSKFMKLNRIIVL 236
             +  L  + K L   +   L F  M++ +LN  + F  + +  +VLS+    +  I+  
Sbjct: 164 VSIEFLNQMGKLLQQGNY--LDFQSMYQGLLNRHKLFPSYRYVPNVLSN----MTLIVFE 217

Query: 237 TTTSNERRLSATLRGLNVKLL----NFDNMKSL-YEHVDGLKPSIKYLILTSTNK----- 286
               +  R +  + G + KLL      D   S  +E    L  SI   + + + K     
Sbjct: 218 QKMYDTLRYTIEVGGGDAKLLANSSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEF 277

Query: 287 --------TENGQIQCTINGLITSVIEDALPAITNTKSV----PCEIQNKKFERVSEVQS 334
                     +G     IN  +  ++E+ +  +     V    P  +Q KK      +QS
Sbjct: 278 DKSIAETSLRHGVKLLNINQFVNILLENKINGLKKRDVVDLTSPSPVQQKK------IQS 331

Query: 335 TSSKTLHTPEIEVGPAILKKRRLNRRRVQPLDSLSFFAGG 374
             +            ++  K+  ++  +Q LDSL+FF GG
Sbjct: 332 AKA------------SVNGKKTKSKPNIQSLDSLNFFGGG 359

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 90/371 (24%), Positives = 147/371 (39%), Gaps = 84/371 (22%)

Query: 313 NTKSVPCEIQNKKFERVSEVQSTSSKTLHTPEIEVGPAILKKRRLNRRRVQPLDSLSFFA 372
           NTK++P  I NK    +  + +  +   HT   +     L+K R  R RVQ LD+L    
Sbjct: 407 NTKTLPSYITNK--SSLGGMSTEPANQPHTSTKKDDRTELQKVRRKRPRVQQLDNLMM-- 462

Query: 373 GGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRNIQKVDENNEKEN 432
                +SSS+      A ++ P                D    L +R I     N   E 
Sbjct: 463 -----RSSSQQ-----ATQIEPD---------------DRNDKLKLRRIGDTASNVNAE- 496

Query: 433 GQKSTGAIVISSPELYAEHI-----SEDSEDKPPRLSPLTVTRPGLQSNPLISRTTPAHY 487
                G +  +SP   AE++     + D  +K P LS +++  PG             H 
Sbjct: 497 -----GVLPSNSPS-NAENMIKNIKTPDISNKNPTLSAISLLEPG----------GAEHV 540

Query: 488 MEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVD-RKSPVKELLQKRKSN 546
              K +    + GKS        +E+N           + +++D R   V  L    +  
Sbjct: 541 SAKKNLIS--DGGKSIDAQSSNRIEQNM---------GNMTELDSRPHSVARLETDLQVR 589

Query: 547 TPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILG 606
           +  + + AI ETK +EV+R +  I++++  EL+E  +   K+ A +     +  KP++L 
Sbjct: 590 SSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINT---IQIKPRVLA 646

Query: 607 TNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKF-KMQNEGNKGDTQNSDFIRSAAFL 665
           +  +     K         W  RKNFK F K WP + +   EG   D  ++         
Sbjct: 647 SIPISNGNTK---------WLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQ-------- 689

Query: 666 ITRNYVPLRKY 676
           I R Y+ +RKY
Sbjct: 690 IGREYITMRKY 700

>TPHA0J00970 Chr10 (228616..231243) [2628 bp, 875 aa] {ON} Anc_7.256
           YER070W
          Length = 875

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 685 CNGKENEDMLGLIEMENLVSN-TGVSGNTSSAVIQQGPRTQNTFINEDISDEGNQQSFSF 743
           CN K N+  LG I+  NL       S    +AV          FI  D+S++GN Q+++F
Sbjct: 411 CNRKSNQKNLGTIKSSNLCCEIVEYSAPDETAVCNLASIALPAFI--DVSEDGNTQTYNF 468

Query: 744 SRHSDIAQ 751
            +  D+A+
Sbjct: 469 QKLHDVAK 476

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 776 CELITLKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCE 813
           C+LI   K GL P+ F EP +  + + STA+G+ +S +
Sbjct: 386 CQLIDSGKSGLVPAQFVEPVRDKKHTESTASGIIKSIK 423

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 776 CELITLKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCE 813
           C+L+   K GL P+ F EP +  + + STA+G+ +S +
Sbjct: 387 CQLVDSGKSGLVPAQFIEPVRDKKHTESTASGIIKSIK 424

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 776 CELITLKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCE 813
           C+L+   K GL P+ F EP +  + + STA+G+ +S +
Sbjct: 394 CQLVDSGKSGLVPAQFIEPVRDKKHTESTASGIIKSIK 431

>Ecym_8239 Chr8 (487796..492754) [4959 bp, 1652 aa] {ON} similar to
            Ashbya gossypii ACR061C
          Length = 1652

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 92/217 (42%), Gaps = 35/217 (16%)

Query: 244  RLSATLRGLNVKL----------LNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQ 293
            +L++ L  + VKL          L+F + KSL+E +  L PS+    L S  +T NG   
Sbjct: 1041 KLASVLMEIIVKLCRNTLTSRLVLDFLSSKSLFEKIIQLDPSVDKTSLWS-GQTFNGNFN 1099

Query: 294  CTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVS----------EVQSTSSKTLHTP 343
             T + +I+S    AL +    +S   +  +    R+S           V++  S  +H P
Sbjct: 1100 GTSDQIISSPAIGALLSFLRYRSYVLQYLSLDIHRLSTDAQESKISTSVEALISSAIHAP 1159

Query: 344  EIEVGPAILKKRRLNRRRVQPLDSLSFFAGGL---------SSKSSSEHQDFADAEKLSP 394
             I     IL          + L  L+ F GGL         S+K + +  DF D + L  
Sbjct: 1160 TIFRFLDILSYSPFPSTN-ESLKGLNIF-GGLDLNIDKIKPSNKFTGDIYDFDDLDSLLE 1217

Query: 395  GLGLKTVISSPNIGRMDETSSLAVRNIQKVDENNEKE 431
             L ++  +   N   +D TSSLAV  I K + N  K+
Sbjct: 1218 -LVVRLQMVPINHEAIDPTSSLAV--IAKSEANTIKK 1251

>TPHA0E02440 Chr5 complement(518295..519563) [1269 bp, 422 aa] {ON}
           Anc_6.196 YGL081W
          Length = 422

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 303 VIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTLHTPEIE------VGPAILKKRR 356
           +I+D++PA+T+  + PC I + KF        +S ++L  PE +      +   I K+++
Sbjct: 317 IIQDSVPAVTSNITSPCTIYDDKFNHNYSKHKSSKRSLQ-PEFQEINLRKICSPIKKRKK 375

Query: 357 LN 358
           +N
Sbjct: 376 IN 377

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 776 CELITLKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCE 813
           C+LI   K GL P+ F EP    + + STA+G+ +S +
Sbjct: 391 CQLIDSGKSGLVPAQFIEPVHDKKHTESTASGIIKSIK 428

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 8/79 (10%)

Query: 559 KNREVERFKST---IVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQ 615
           +N EV   ++    IV L+DDE S + I Q+ +  +  PN D    P+I   + + + + 
Sbjct: 190 RNSEVTNLRTNDAIIVGLDDDEYSSDEIQQIHDDLVRHPNAD---SPEIYSDSDLESDSN 246

Query: 616 KNESGIM--RQEWHERKNF 632
           ++E  ++  +Q    R NF
Sbjct: 247 EDEESLIPRKQSNKHRDNF 265

>Skud_12.11 Chr12 complement(12871..14109) [1239 bp, 412 aa] {ON}
           YLL057C (REAL)
          Length = 412

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 45/95 (47%), Gaps = 11/95 (11%)

Query: 505 RDIIQTLEENHEPPEQSQEKNSYSQVDRKSPVKELLQKRKSNTPLSFVEAIQETKNREVE 564
           +D + TL   H   EQ++   S   + R++PV  +        PL  V  I + K   V 
Sbjct: 262 QDFLSTLHVIHSSKEQAENSQSQGGIQRRAPVTHI-------HPLVRVHPILKKKCLYVN 314

Query: 565 R-FKSTIVQLEDDELSEEGINQLKNLAIVEPNEDL 598
           R F   IV+L+  E SE  +N L N  +VE + DL
Sbjct: 315 RAFSRKIVELKRQE-SESVLNFLYN--VVESSHDL 346

>ACR293C Chr3 complement(896246..897406) [1161 bp, 386 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLL057C
          Length = 386

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 57/126 (45%), Gaps = 14/126 (11%)

Query: 505 RDIIQTLEENHEPPEQSQEKNSYSQVDRKSPVKELLQKRKSNTPLSFVEAIQETKNREVE 564
           +D +  L   H   EQ+Q       + R+ PV  +        PL  V  + +TK+  V 
Sbjct: 233 QDFLSKLHVLHSAKEQAQNAQEQGGIQRREPVAHI-------HPLVRVHPVLKTKSFFVN 285

Query: 565 R-FKSTIVQLEDDELSEEGINQLKNLAIVEPNEDL-LRKPQILGTNSVRTRAQKNESGIM 622
           R F   IV+L+  E S+  ++ + N  I+E   DL LR     GT +V    + N S I+
Sbjct: 286 RGFTRKIVELKQTE-SDLLLDFIYN--IIENTHDLQLRASWEPGTVTVWDNRRVNHSAII 342

Query: 623 RQEWHE 628
             +W E
Sbjct: 343 --DWEE 346

>TPHA0K01430 Chr11 complement(300282..301283) [1002 bp, 333 aa] {ON}
           Anc_4.145 YGR007W
          Length = 333

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 18/99 (18%)

Query: 149 PINLMISDFPSSDDNGMRELYALVNAIPLKKLRLLVDVCKTLLPASVRNLKFDEMWKDVL 208
           PI L++S    +DDN        VN I  KK R+L  +    +   + N + DE+ KDV 
Sbjct: 234 PIELVVS-IKLADDN--------VNNIMTKKERILSVLACKYVDGIILNAQHDEISKDV- 283

Query: 209 NSPEFNVFNFDASVL----SSKFMKLNRIIVLTTTSNER 243
               +  F  D+ VL     +KF  LN+ +++    + R
Sbjct: 284 ----YKKFQLDSDVLKNHNKNKFQYLNKQVIIDRILSRR 318

>NCAS0G02390 Chr7 (422883..424199) [1317 bp, 438 aa] {ON} Anc_2.141
           YNL128W
          Length = 438

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 4/96 (4%)

Query: 71  INQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEIWNIPSHLTEF 130
           +++G   +   ++LK  E F+ Y P+ + L   +L  S F +E   + E    PS L   
Sbjct: 235 VSKGVTIASQLRYLKYHEMFLYYDPQYNELILKQLKKSHFKLESIQLME----PSSLIYS 290

Query: 131 RTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMR 166
            T L      T +   +G  +L+I +    + N M+
Sbjct: 291 NTYLISIKFQTYNESRNGLTDLLILETDGDNQNQMK 326

>Skud_16.30 Chr16 complement(50752..53643) [2892 bp, 963 aa] {ON}
           YPL249C (REAL)
          Length = 963

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 363 QPLDSLSFFAGGLSSKSSSE----HQDFADAEKLSPG--LGLKTVISSP 405
           Q LD L+   GG+ + + S+    H+ F D EKLSP   +G+ T ++SP
Sbjct: 175 QQLDFLNDMKGGMRNLNESDIENDHEAFVDDEKLSPNTQVGVDTSVNSP 223

>NDAI0C05260 Chr3 complement(1219267..1220940) [1674 bp, 557 aa]
           {ON} Anc_8.501 YDR481C
          Length = 557

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 37/86 (43%), Gaps = 4/86 (4%)

Query: 479 ISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVDRKSPVKE 538
           I  TT  H   D  I   Y N KSS   I+  L+ NHE  E  +    Y  +D K   K 
Sbjct: 462 IGWTTHGHSAVDVNIY-GYANTKSSWYHILDHLQGNHENLEIGEFIRQYLNLDLKDVTKR 520

Query: 539 LLQKRKSNTPLSFVEAIQETKNREVE 564
           +   +   T L  +E IQE +  + E
Sbjct: 521 I---KNVKTKLYDLEKIQEIEETDDE 543

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,276,385
Number of extensions: 4437963
Number of successful extensions: 15539
Number of sequences better than 10.0: 305
Number of HSP's gapped: 16445
Number of HSP's successfully gapped: 319
Length of query: 843
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 725
Effective length of database: 39,950,811
Effective search space: 28964337975
Effective search space used: 28964337975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)