Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6375.434ON31231216560.0
Suva_2.5405.434ON31231215670.0
YDR368W (YPR1)5.434ON31231215650.0
Smik_4.6345.434ON31231215410.0
SAKL0G02530g5.434ON31231211491e-159
TBLA0A02825singletonON31131211371e-157
NDAI0C016005.434ON31331211331e-156
Suva_8.1735.434ON31231211281e-155
Skud_15.2835.434ON31231211251e-155
Smik_15.2985.434ON31231211201e-154
YOR120W (GCY1)5.434ON31231211181e-154
CAGL0I01100g5.434ON31030911071e-152
CAGL0A02816g5.434ON31030911041e-152
KAFR0E03850singletonON31131310821e-148
NCAS0H020605.434ON32230610661e-146
KNAG0C049105.434ON31331210651e-146
TDEL0E019105.434ON31131210511e-144
TBLA0A065105.434ON31231210401e-142
ZYRO0F10032g5.434ON31030910161e-138
Kwal_47.18084na 1ON30930910151e-138
Kpol_1062.295.434ON31130910141e-138
KLTH0E00220gsingletonON30630110121e-138
KLTH0A00528gsingletonON30630110121e-138
KLTH0E15532gsingletonON30930210081e-137
NCAS0F033805.434ON31331310051e-137
KLLA0B14707gsingletonON31030610031e-136
TPHA0G00210singletonON3113129991e-136
NDAI0B056705.434ON3183129971e-135
KLTH0F16060g5.434ON3093089731e-132
TBLA0A02835singletonON3113129651e-131
TPHA0E017605.434ON3103099551e-129
KLTH0A03476gna 1ON3083039391e-127
KAFR0E038405.434ON3103129361e-126
TDEL0D00230singletonON3123059261e-125
Kwal_55.214265.434ON3083089111e-123
KLLA0D10109gsingletonON3093029111e-122
AER401W5.434ON3133108451e-112
NDAI0A070003.108ON3202865653e-70
NCAS0I024203.108ON3202965515e-68
Kwal_56.226113.108ON3213115193e-63
KLTH0C10010g3.108ON3213125045e-61
ZYRO0B06138g3.108ON3283205039e-61
KAFR0G013503.108ON3243135002e-60
SAKL0C10626gsingletonON3223184967e-60
KNAG0K020703.108ON3233004951e-59
YBR149W (ARA1)3.108ON3443084892e-58
KLLA0F02728g3.108ON3303024784e-57
Smik_2.2883.108ON3443104795e-57
Smik_2.289singletonON3443084761e-56
TDEL0D051603.108ON3253184741e-56
Suva_4.3983.108ON3443174743e-56
Skud_2.2763.108ON3443084716e-56
SAKL0C09922g3.108ON3223114707e-56
Ecym_55085.409ON3263304402e-51
ACL107C5.409ON3543084342e-50
TPHA0E018605.409ON3263304183e-48
KLTH0F16610g5.409ON3293294123e-47
KLLA0E21627g5.409ON3293114105e-47
CAGL0I01122g5.409ON3263334071e-46
NCAS0A066605.409ON3263314071e-46
ZYRO0A06336g5.409ON3273084062e-46
KLLA0F03256g7.468ON2852794013e-46
KNAG0B03780singletonON3263094044e-46
TDEL0E021505.409ON3293134029e-46
SAKL0F14278g7.468ON2862773911e-44
SAKL0G01914g5.409ON3293113941e-44
Kwal_55.215365.409ON3293123941e-44
KLTH0F01892gna 2ON3022963921e-44
Kwal_47.18893na 3ON2892943902e-44
NDAI0D016005.409ON3273323932e-44
Ecym_7160na 4ON2712793831e-43
KNAG0D013707.468ON2822763841e-43
TBLA0A00630singletonON3283103862e-43
CAGL0C04543g7.468ON2872753822e-43
Kwal_33.13276na 2ON3022883823e-43
Skud_8.1655.409ON3273113844e-43
KAFR0C05320singletonON3273063844e-43
YHR104W (GRE3)5.409ON3273113835e-43
KLTH0G02420gna 3ON2892943796e-43
Kwal_47.182197.468ON2932923799e-43
Smik_8.1825.409ON3273113792e-42
Kpol_1013.827.468ON2852873762e-42
ZYRO0G17600g7.468ON2832793719e-42
YJR096W7.468ON2822813702e-41
KAFR0G009207.468ON2862923692e-41
TBLA0F01720singletonON3263113704e-41
Suva_15.3005.409ON3273113696e-41
KLTH0G05786g7.468ON2862753657e-41
SAKL0F02574gna 3ON2892913632e-40
Smik_10.3847.468ON2822813562e-39
TDEL0C033207.468ON2832863562e-39
Skud_10.3187.468ON2822783527e-39
Suva_12.1847.468ON2822873501e-38
KLLA0F05775g7.285ON3093163493e-38
NCAS0H005607.468ON2842763457e-38
CAGL0J09394g7.285ON3113123461e-37
ABL209Cna 4ON3102753432e-37
Kwal_47.19278na 5ON3143123399e-37
ZYRO0E09614gna 5ON3083103381e-36
Kpol_1020.137.285ON3133243363e-36
NCAS0A137407.285ON3093033337e-36
NDAI0A023007.285ON3133263275e-35
Skud_4.1317.285ON3123163267e-35
Smik_4.1137.285ON3123143232e-34
KLTH0G00638gna 5ON3133073223e-34
SAKL0F00704gna 5ON3153263206e-34
YDL124W7.285ON3123153092e-32
KNAG0C041107.285ON3113023023e-31
Kpol_381.8singletonON3092772971e-30
SAKL0F09746g7.285ON3122922953e-30
ZYRO0C09196g7.285ON3123112943e-30
KAFR0B012007.285ON3152742935e-30
TBLA0F019807.285ON3023122925e-30
TDEL0D02790singletonON3293132935e-30
Ecym_32647.285ON3113112383e-22
Kwal_33.13274singletonON108961736e-15
Suva_12.272singletonON2652041093e-05
Suva_4.1227.285ON2061941031e-04
TDEL0A08000singletonON3192161023e-04
NDAI0C01480singletonON343290910.007
Kwal_33.13275singletonOFF6734810.010
Ecym_22962.604ON340181860.027
NDAI0J00730singletonON343297830.065
NCAS0C02450singletonON343273830.067
KLTH0E01474gsingletonON313182820.086
TBLA0E05040singletonON342308810.11
Smik_3.208singletonON344291770.31
Suva_5.2077.378ON767194760.54
KAFR0D039801.75ON34997750.61
Suva_9.17singletonON308207750.63
Kpol_1050.555.105ON45296740.94
KLTH0E16852gsingletonON37593721.3
YNL331C (AAD14)na 6ON376118721.4
NDAI0B009305.76ON94084721.6
YDL243C (AAD4)singletonON32993711.7
KLLA0E24421gna 7ON36848711.9
KNAG0M023402.604ON309207712.0
Smik_14.1na 6ON37693693.0
Suva_14.10na 6ON37693693.1
YER091C (MET6)7.378ON767196693.6
YFL056C (AAD6)singletonON21293674.0
KLLA0B09658g3.462ON34276684.0
YCR107W (AAD3)singletonON363101684.3
Ecym_20263.25ON45150684.6
NCAS0A058104.53ON44795685.0
KAFR0B013007.269ON615101685.2
Suva_8.1225.677ON58597685.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.637
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   642   0.0  
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   608   0.0  
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   607   0.0  
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   598   0.0  
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   447   e-159
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     442   e-157
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   441   e-156
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   439   e-155
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   437   e-155
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   436   e-154
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   435   e-154
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   431   e-152
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   429   e-152
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     421   e-148
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     415   e-146
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   414   e-146
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   409   e-144
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   405   e-142
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   395   e-138
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   395   e-138
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   395   e-138
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   394   e-138
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   394   e-138
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   392   e-137
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     391   e-137
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   390   e-136
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 389   e-136
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   388   e-135
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   379   e-132
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     376   e-131
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   372   e-129
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   366   e-127
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   365   e-126
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   361   e-125
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   355   e-123
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   355   e-122
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   330   e-112
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   222   3e-70
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   216   5e-68
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   204   3e-63
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   198   5e-61
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   198   9e-61
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   197   2e-60
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   195   7e-60
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   195   1e-59
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   192   2e-58
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   188   4e-57
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   189   5e-57
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   187   1e-56
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   187   1e-56
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   187   3e-56
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   186   6e-56
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   185   7e-56
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   174   2e-51
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   171   2e-50
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   165   3e-48
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   163   3e-47
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   162   5e-47
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   161   1e-46
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             161   1e-46
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   160   2e-46
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   159   3e-46
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               160   4e-46
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   159   9e-46
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   155   1e-44
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   156   1e-44
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   156   1e-44
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   155   1e-44
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   154   2e-44
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               155   2e-44
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   152   1e-43
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   152   1e-43
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     153   2e-43
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   151   2e-43
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   151   3e-43
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   152   4e-43
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   152   4e-43
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   152   5e-43
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   150   6e-43
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   150   9e-43
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   150   2e-42
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   149   2e-42
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   147   9e-42
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   147   2e-41
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   146   2e-41
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     147   4e-41
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   146   6e-41
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   145   7e-41
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   144   2e-40
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   141   2e-39
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   141   2e-39
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   140   7e-39
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   139   1e-38
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   139   3e-38
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   137   7e-38
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   137   1e-37
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   136   2e-37
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   135   9e-37
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   134   1e-36
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   134   3e-36
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   132   7e-36
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     130   5e-35
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   130   7e-35
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   129   2e-34
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   128   3e-34
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   127   6e-34
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   123   2e-32
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   120   3e-31
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   119   1e-30
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   118   3e-30
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   117   3e-30
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   117   5e-30
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   117   5e-30
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     117   5e-30
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...    96   3e-22
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    71   6e-15
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    47   3e-05
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    44   1e-04
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              44   3e-04
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               40   0.007
Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig...    36   0.010
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    38   0.027
NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {...    37   0.065
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    37   0.067
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    36   0.086
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             36   0.11 
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    34   0.31 
Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON...    34   0.54 
KAFR0D03980 Chr4 (783660..784709) [1050 bp, 349 aa] {ON} Anc_1.7...    33   0.61 
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     33   0.63 
Kpol_1050.55 s1050 complement(123375..124733) [1359 bp, 452 aa] ...    33   0.94 
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    32   1.3  
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    32   1.4  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    32   1.6  
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    32   1.7  
KLLA0E24421g Chr5 (2171139..2172245) [1107 bp, 368 aa] {ON} simi...    32   1.9  
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    32   2.0  
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    31   3.0  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    31   3.1  
YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}  ...    31   3.6  
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    30   4.0  
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    31   4.0  
YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putati...    31   4.3  
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    31   4.6  
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    31   5.0  
KAFR0B01300 Chr2 (242298..244145) [1848 bp, 615 aa] {ON} Anc_7.2...    31   5.2  
Suva_8.122 Chr8 (222064..223821) [1758 bp, 585 aa] {ON} YOR073W ...    31   5.5  

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
           TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 301 VNMKWASFPIFE 312
           VNMKWASFPIFE
Sbjct: 301 VNMKWASFPIFE 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/312 (92%), Positives = 305/312 (97%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           MPATL+NSSATLKLNTGASIP LGFGTWRSVDN+GYHSVIAALK GYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           EVG+AIKDSG+ REEIFITTKLWGTEQRDPEAAL++SLKRLGLDYVDLYLMHWPVPLKTD
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
           T+TDG+ LCIPTLEDGT+DVDTKEWNF+KTWDLMQ+LPKTGKT+AVGVSNFSINNIKELL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           KSPSNKLVPATNQ+EIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           KHGVEP+QLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFK I +LSKVHGEKRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 301 VNMKWASFPIFE 312
           VNM+W SFPIFE
Sbjct: 301 VNMQWNSFPIFE 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/312 (92%), Positives = 304/312 (97%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           MPATL+NSSATLKLNTGASIP LGFGTWRSVDNNGYHSVIAALK GYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           EVGRAIKDSG+ REEIFITTKLWGTEQRDPEAALN+SLKRLGLDYVDLYLMHWPVPLKTD
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            VTDGNVLCIPTLEDGTVD+DTKEWNFIKTW+LMQELPKTGKT+AVGVSNFSINNIKELL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           +SP+NK+VPATNQ+EIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           KHGVEP+QLIISWSIQRGYVVLAKSVNPER+VSNFKIFTLPEDDFK I +LSKVHG KRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 301 VNMKWASFPIFE 312
           V+MKW SFPIF+
Sbjct: 301 VDMKWGSFPIFQ 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/312 (90%), Positives = 303/312 (97%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           MPATL+NSSA+LKLNTGASIP LGFGTWRSV+NNGYHSVIAALK GYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           EVGRAIKDSG+ RE+IFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT+
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
           T+TDGNVLCIPTL+DGTVDVDT+EWNFIKTWDLMQELPKTGKT+AVGVSNFSINNIK LL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           +SPSNKLVPA NQ+EIHPLLPQ+ELIAFCKEKGIVVEAYSPFGS NAPLL+EQAIIDMAK
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           KHGV P+QLIISWSIQRGYVVLAKSVNPER+VSNFKIFTLPEDDFK I +LSKVHGEKRV
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 301 VNMKWASFPIFE 312
           V+MKW+SFPIF+
Sbjct: 301 VDMKWSSFPIFK 312

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  447 bits (1149), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 209/312 (66%), Positives = 254/312 (81%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M   L+NSSAT+KLNTGA IP LG GTWRS D   Y+SV++A+K GYRHID+AAIY NEE
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
            VG+AI+DSG+ R E+F+TTKLWGT+QR+PE AL+ SLKRLGLDYVDLYL+HWP+  KTD
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            + D + L +PT +DG  DVD K+WNF+KTW+L+QELP TGK +AVGVSNFS+NN+KELL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NKLVPA NQVE+HPLLPQDELI F K KGIV+EAYSP GS  +PLLKE  II++AK
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+GVEP+Q++I+W IQRGYV+L KSVNP+RV SNFK+F L ++D   I  +SK  G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 301 VNMKWASFPIFE 312
           V+  W SFPIFE
Sbjct: 301 VHPDWPSFPIFE 312

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  442 bits (1137), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 251/312 (80%), Gaps = 1/312 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M A L+N +AT+KLNTGA+IPA+G GTWRS +N+GY SVIAA K GYRHID AAIY NE+
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AI + G+ R E+F+TTKLWGT+QRDPE ALN+SLKRLGLDYVDLYL+HWPV  KTD
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
           T+ DGN+L IP  +DG  D+D  EWNFIKTW+LMQ L KTGKT+A+G+SNFSINNIKELL
Sbjct: 121 TIKDGNLLTIPK-KDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            +P+  + PA NQVE+HPLLPQDELIAFCKEKGIV+EAYSP G  NAP+LK++ II++AK
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           ++ V+  Q++ SW +QRGYVVL KSV   R++SN K FTL +DD   I +L KV GE R 
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 301 VNMKWASFPIFE 312
            ++    FP+F+
Sbjct: 300 CDLGIKGFPMFQ 311

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  441 bits (1133), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 205/312 (65%), Positives = 252/312 (80%), Gaps = 1/312 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSV-DNNGYHSVIAALKTGYRHIDAAAIYLNE 59
           M +TL+NS+AT KLNTGA+IPA+G GTW+S  +N GY +V+ ALK GYRHID AAIY NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
           ++VG+AI DSGI REEIF+TTKLWGT+ RDPE ALN+SL+RLGLDYVDLYLMHWPV  K 
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
           D++ DGN   +P L +G  D+D   WNF+KTW+LMQELPKTGKTRAVGVSNFSINN+K L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           L SP NKLVPA NQVE HPLLPQDEL  FCKEKGI++EAYSP GS NAP+L E  II++A
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 240 KKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKR 299
           KKH V+P+Q++ISW +Q+G+VVL KSV+ ER+ +NF+ F L +D+  ++ +LSK  GE+R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 300 VVNMKWASFPIF 311
           +V   WA F  F
Sbjct: 301 IVQPNWAPFVPF 312

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  439 bits (1128), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 253/312 (81%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M ATL+ S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AIKDSG+ REEIF+TTKLW T+  +P  AL++SLKRLGLDYVDLYLMHWPV L  +
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            + DG++L IPT EDG+  VD   WNFIKTW+LMQELPKT KTRAVGVSNFSINN+K+LL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP N+L PA NQVE+HPLLPQ+ELI FCK KGI+VEAYSP GS +APLLKE  ++++AK
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+ V+P  ++ISW  QRGYVVL KSVNP+R+ +N K+FTL ++DF+AI ++SK  GEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 301 VNMKWASFPIFE 312
           VN  W+ F  F+
Sbjct: 301 VNPDWSPFEAFK 312

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  437 bits (1125), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 253/312 (81%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           MPATL++S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AI+DSG+ RE+IF+TTKLW T+  +P  AL++SL+RLGLDYVDLYLMHWPV L  D
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            + DGN+L +PT +DG+  VD   WNFIKTW+LMQELPKTGK +AVGVSNFSINN+K+LL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            S  NKL PA NQVEIHPLLPQ+ELI FC+ KGI++E YSP GS +APLLKE  I+++AK
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+ V+P+ ++ISW  QRGYVVL KSVNP+RV +N KIFTL ++DF+AI  +SK  GEKRV
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 301 VNMKWASFPIFE 312
           V+  W+ F  F+
Sbjct: 301 VHPNWSPFEAFK 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  436 bits (1120), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 249/312 (79%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M  TL +S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALK GY+HID AAIY NE+
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AIKDSG+ REEIF+TTKLW T+  +P  AL+ESL+RLGLDYVDLYL+HWP  L T+
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            + DG++L +PT  DG+  VD   WNFIKTW+LMQELPKTGKT+A+GVSNFSINN+K+LL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NKL PA NQVEIHPLLPQ+ELI FCK K I++EAYSP GS +APLLKE  I+ +AK
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+ V+P  ++ISW  QRGYVVL KSVNP+R+ +N KIFTL  +DF+AI ++SK  GEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 301 VNMKWASFPIFE 312
           VN  W+ F  F+
Sbjct: 301 VNPNWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  435 bits (1118), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 251/312 (80%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           MPATL +S+  L LNTGA IP +G GTW+S +N+ Y +V+ ALK GYRHID AAIY NE+
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AIKDSG+ REEIF+TTKLW T+  +PE AL++SLKRLGLDYVDLYLMHWP  L   
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            + + ++L +PT +DG+  VD   WNFIKTW+LMQELPKTGKT+AVGVSNFSINN+K+LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            S  NKL PA NQVEIHPLLPQDELI FCK KGIVVEAYSP GS +APLLKE  I+++AK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+ V+P  ++ISW +QRGYVVL KSVNP+R+ +N KIFTL  +DF+AI ++SK  GEKRV
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 301 VNMKWASFPIFE 312
           V+  W+ F +F+
Sbjct: 301 VHPNWSPFEVFK 312

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 246/309 (79%), Gaps = 1/309 (0%)

Query: 3   ATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEV 62
           A L  +++TLKLNTGA IP +G GTW+S +N GY++ + ALK GYRHID AAIY NEEE+
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61

Query: 63  GRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           GRAI+DS I R E+F+TTKLWGT+ R+P  AL++SLKRLGLDYVDLYLMHWPV LKTD +
Sbjct: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121

Query: 123 TDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKS 182
            DGN+L IP  EDG+ DVD ++WNF+KTW+LMQELPK  K RA+GVSNFSINN+KELL S
Sbjct: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180

Query: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
             NK+VPA NQ+EIHPLLPQDELI FCKEKGIV+EAYSP GS +AP+LKE+ I ++AKK+
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 243 GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVN 302
           GV   QL+ISW  QRGYVVL KSV PER+  N + F L ++DF  + + +K HGE+RVV+
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 303 MKWASFPIF 311
             W  F  F
Sbjct: 301 PNWGPFKPF 309

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  429 bits (1104), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 248/309 (80%)

Query: 4   TLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           +L+NS+ATLKLNTGA IP +G GTWRS  N+GY SV+AALK GYRHIDAAAIY NE++VG
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVG 61

Query: 64  RAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVT 123
           RAIKDSG+ R+EIFITTKLWGTE R+P  AL+ SLKRLGLDYVDLYLMHWPV LK     
Sbjct: 62  RAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSE 121

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
           + ++L IP   DG  D+D ++W+FIKTW+LMQELPKTGKT+A+GVSNFSINN+K L  SP
Sbjct: 122 EKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSP 181

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
               VPA NQVEIHPL PQ ELI +CK + I++EAYSPFGSA+AP+LKE  +  +A+K+ 
Sbjct: 182 KFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYN 241

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNM 303
           +  +QLIISWS+QRGYVVL KSV+ ER+ +N K+ TL ++D + I +LSKV GEKR+V +
Sbjct: 242 ISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQL 301

Query: 304 KWASFPIFE 312
            W+ FP FE
Sbjct: 302 DWSPFPTFE 310

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  421 bits (1082), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 210/313 (67%), Positives = 258/313 (82%), Gaps = 3/313 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNN-GYHSVIAALKTGYRHIDAAAIYLNE 59
           M +TL+N++ TLKLNTGAS+P LG GTWR+ D+  GY++V +AL+ GYRHID AAIY NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
           E VGRAI++SGI R+EIF+TTKLWGT+ RDP AAL++SL+RLGLDYVDLYLMHWPVP++ 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
                 ++L  P   DG++ V++ +W+FIKTW+LMQELPKT KTRA+GVSNFSINNI +L
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVES-DWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           LKSP NK+VPA NQVE+HPLLPQ EL+ FC+EKGIVVEAYSPFGS +APLL EQAII++A
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 240 KKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKR 299
           KKH V  +Q+I+SW I+RG  VL KSV+ ERVVSNFK F+LPEDDF  I ++SK  GEKR
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 300 VVNMKWASFPIFE 312
           VVN  W+ F IFE
Sbjct: 299 VVNFDWSPFKIFE 311

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  415 bits (1066), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 192/306 (62%), Positives = 241/306 (78%), Gaps = 1/306 (0%)

Query: 7   NSSATLKLNTGASIPALGFGTWRSV-DNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRA 65
           NS+ T KLNTGA+I A+G GTW+S  +N GY +VIAALK GYRHID AAIY NE +VG+A
Sbjct: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75

Query: 66  IKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDG 125
           I DSG+ REEIF+TTKLW T+  DP A LN+SLKRLGLDYVDLYLMHWPV L   ++ DG
Sbjct: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135

Query: 126 NVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSN 185
           N L IP L DG  DV+   W+++KTW+LMQELPKTGKTRAVGVSNFSINN+K++L SP N
Sbjct: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195

Query: 186 KLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVE 245
           K+VPA NQVEIHPLLPQ+EL+ +C  KGI++EAYSP GS NAP+L E  +I++AKKHGV+
Sbjct: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255

Query: 246 PSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKW 305
            +Q++ISW +QRGY+VL KSV+ ER+ +NFK   L +++ + I ++SK  GE+R+V   W
Sbjct: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315

Query: 306 ASFPIF 311
             F  F
Sbjct: 316 EPFVPF 321

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  414 bits (1065), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 250/312 (80%), Gaps = 1/312 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVD-NNGYHSVIAALKTGYRHIDAAAIYLNE 59
           M ATL  +++ LKLNTGA+I A+G GTWRS    + Y SVIAAL+ GYRHID AAIY NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            EVGRAI++SG+ R EIF+TTKLW T+ ++PE AL++SLKRLGLDYVDLYLMHWPV ++ 
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
           + + +G+ +  PTL +G  D+D  +WNF+KTW+LMQ+LP+TGKTRA+GVSNFSINN+K+L
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           L SP NK+VPA NQVE+HPLLPQ EL+ FC  KGIV+EAYSP GSA+AP+LKE  II++A
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 240 KKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKR 299
           KK+GV  +Q++ISW++QRGY+VL KSVN ER+ +N   FTL  +DF+A+ ++SKV G KR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 300 VVNMKWASFPIF 311
           +++  W  F  F
Sbjct: 301 IIDPDWEPFKPF 312

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  409 bits (1051), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 195/312 (62%), Positives = 238/312 (76%), Gaps = 1/312 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M ATL N+++T+KLNTG +IP +G GTWRS + +GY +V AALK GYRHID AAIYLNEE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           EVG+AI+DSGI REE+FITTKLW T+QR+P+ AL +SL+RLGL+YVDLYLMHWPVPLKT 
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            +TDGN+L  P  EDG  DVDT EW+F+KTW+LMQELPKT K R+VGVSNFSINN+KELL
Sbjct: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NKLVPA  QVEIHPLLPQ  L  FCKE  I VEAYSP G   AP+L +  I  +A 
Sbjct: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           +H  +   +++SW +QRG V L KS  PERVVSN + F L +++  +I +LSK  G+KR 
Sbjct: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299

Query: 301 VNMKWASFPIFE 312
                + FP+FE
Sbjct: 300 NAPDMSPFPLFE 311

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  405 bits (1040), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 240/312 (76%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           MPA L+NS   + LN G  IP++G GTW+S +N+GY+SVI ALK GYRHID AAIY NE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           EVGRAIKDSG+ R++IFITTKLW TE ++P+ AL  SLKRLGLDYVDLYLMHWPV L   
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            + D + L +P L DGT DVD + W++IKTW+L+QELP TG TR+VGVSNFSINN++++L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NKL PA NQVE+HPLLPQ EL  +C  K I +EAYSPFGS NAP LK++ I+D+A 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+GV P+Q+I SW +QR  VVL KSV+ ERV+SNFK+F L ++D   I  L+KV+GEKR+
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 301 VNMKWASFPIFE 312
               W  FP+FE
Sbjct: 301 NKPDWDPFPVFE 312

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  395 bits (1016), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 239/309 (77%), Gaps = 1/309 (0%)

Query: 4   TLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           TL+NS++TLKLNTG +IP +G GTWRS +N GY +VI ALK GYRHID AA+Y NE EVG
Sbjct: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62

Query: 64  RAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVT 123
           +AI+DSG+ R EIF+TTKLW T+QR+P+ AL++SL+RLGLDYVDLYL+HWPVPL+T+ + 
Sbjct: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
           DGN+       DG+ DVD  EWNFIKTW+LMQ+L ++GKT+A+GVSNFS+NN+K+LL +P
Sbjct: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
           + K+ PA NQVE+HPLLPQ++LI F KE GIV+EAYSP G  NAP+L +  + ++AK +G
Sbjct: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNM 303
           VE   ++ISW++Q+G V L KSV P R+V N K+ TL + D   +  L K  GE+R    
Sbjct: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301

Query: 304 KWASFPIFE 312
            ++ FPIF+
Sbjct: 302 DFSPFPIFQ 310

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 185/309 (59%), Positives = 242/309 (78%), Gaps = 2/309 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           MPA L+N++   KLNTGA+IP LGFGTWRS +  GY++V++A+K GYRHID+AA+Y NE 
Sbjct: 1   MPA-LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEA 59

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
            VGRAI+DSG+ REE+F+TTKLW T+QR+P  AL++SL+RLGLDYVDLYL+HWP+P+KTD
Sbjct: 60  AVGRAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTD 119

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            +TDGN+  IPT EDG  DVDT EW++IKTW LMQELP TGKTRAVGVSN S++ +++LL
Sbjct: 120 RITDGNLFSIPTKEDGKPDVDT-EWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLL 178

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
               NK+VPA  QVE HPLLPQ++L+ FC +  I++EAYSP GS  +PL+ E  I ++AK
Sbjct: 179 ADKGNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAK 238

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+  +P+Q+IISW I+RGYVVL KSV P R+ SN +   L ++DF+ I  L    GEKRV
Sbjct: 239 KYNADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRV 298

Query: 301 VNMKWASFP 309
            + +W +FP
Sbjct: 299 NDPEWFTFP 307

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  395 bits (1014), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 185/309 (59%), Positives = 232/309 (75%), Gaps = 1/309 (0%)

Query: 4   TLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           +L+N    +KLNTGA +PA+G GTW+S++N+ Y +V+ ALKTGYRHID AAIY NE EVG
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVG 61

Query: 64  RAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVT 123
           +AI+DSG+ R EIF+TTKLWGT+QR P+ AL +SL+RLGLDYVDLYL+HWP+PL      
Sbjct: 62  KAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCE 121

Query: 124 D-GNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKS 182
           + GN L  P L +G  DVD   WNF+KTW+LMQELP TGK +AVGVSNFSINNIKELL S
Sbjct: 122 ESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSS 181

Query: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
           P NKLVPA NQ+E+HPLLPQ EL+ FCKEKGIVVEAYSP G   A +LKE  + ++AKK+
Sbjct: 182 PGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKY 241

Query: 243 GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVN 302
            +  + L++SW +QRG VVL KSV   R++SN +  TL  +D + I +LSK  GEKR   
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCA 301

Query: 303 MKWASFPIF 311
             ++ F  F
Sbjct: 302 PDFSPFNTF 310

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 231/301 (76%)

Query: 12  LKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKDSGI 71
           L++NTG  IP LG GTW++ D + Y +V+AAL++GYRHID AAIY NE  VGRAI+DSG+
Sbjct: 6   LQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSGV 65

Query: 72  AREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCIP 131
            RE+IF+TTKLW T+QRDP++ALN SL+RLGLDYVDLYLMH+PV LKTD + DGNVL IP
Sbjct: 66  PREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSIP 125

Query: 132 TLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNKLVPAT 191
              DG  DVD   W+F+KTW LMQ+LPK+GKT+A+GVSNFSI NI+E+LK      VPA 
Sbjct: 126 VRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPAA 185

Query: 192 NQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPSQLII 251
           NQ+EIHP LPQDELI +CK KGI+VEAYSP GS+ + +L +  +I +A+KH VEP+Q++I
Sbjct: 186 NQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQILI 245

Query: 252 SWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKWASFPIF 311
           SW + RGY +L KSVN +RV SN KI  L  +D + I  + +  G KR V+  WA FP++
Sbjct: 246 SWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPFPMY 305

Query: 312 E 312
           E
Sbjct: 306 E 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 231/301 (76%)

Query: 12  LKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKDSGI 71
           L++NTG  IP LG GTW++ D + Y +V+AAL++GYRHID AAIY NE  VGRAI+DSG+
Sbjct: 6   LQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSGV 65

Query: 72  AREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCIP 131
            RE+IF+TTKLW T+QRDP++ALN SL+RLGLDYVDLYLMH+PV LKTD + DGNVL IP
Sbjct: 66  PREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSIP 125

Query: 132 TLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNKLVPAT 191
              DG  DVD   W+F+KTW LMQ+LPK+GKT+A+GVSNFSI NI+E+LK      VPA 
Sbjct: 126 VRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPAA 185

Query: 192 NQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPSQLII 251
           NQ+EIHP LPQDELI +CK KGI+VEAYSP GS+ + +L +  +I +A+KH VEP+Q++I
Sbjct: 186 NQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQILI 245

Query: 252 SWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKWASFPIF 311
           SW + RGY +L KSVN +RV SN KI  L  +D + I  + +  G KR V+  WA FP++
Sbjct: 246 SWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPFPMY 305

Query: 312 E 312
           E
Sbjct: 306 E 306

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 234/302 (77%), Gaps = 1/302 (0%)

Query: 7   NSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI 66
           NSSA  KL TGA+IP LGFGTWRS + +GY++V+ ALK GYRHID AA+Y NE  VGRAI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 67  KDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGN 126
           +DSG+ R+++F+TTKLW T+ RDP  AL++SL+RLGLDYVDLYL+HWP+PL+T  +TDGN
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 127 VLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNK 186
           +  +PT EDG  DVD ++W+++KTW++MQ+LP T KTRAVGVSNFS+  ++ LL +   K
Sbjct: 126 LFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 187 LVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEP 246
           ++PA NQVE HPLLPQD+L  FC E  I++EAYSP GS  +PL++E A+ ++A KH  +P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 247 SQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKWA 306
           +Q++ISW I+RGYV+L KSV P R+ SNFKI  L +DDF  I ++ K  GEKR+ +  W 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 307 SF 308
            F
Sbjct: 305 HF 306

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  391 bits (1005), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 247/313 (78%), Gaps = 1/313 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVD-NNGYHSVIAALKTGYRHIDAAAIYLNE 59
           M  TL+ S+ATLKLNTGA+IP +  GTWRS+   +GY SVIAALK GYRHID AAIY NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
           ++VG+AI+DSGI REEIF+T+KLW T+Q +P  AL ++L RLGLDY+DLYLMHWPV   T
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
             V   + + IP  E+G  D++   WNF+KTW+LMQELP TG T+AVGVSNFSINN+KEL
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           L SP NKL PA NQ+EIHPLLP+ +LI FC+EKGI++EAYSP GS NAP+LKE  II+++
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 240 KKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKR 299
           KK  V P+QLIISW +QRGYVVL KS + ER+++N K+FTL ++DF+AI +L+K  G  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 300 VVNMKWASFPIFE 312
           VV+  W+ FP+F+
Sbjct: 301 VVDPDWSPFPLFK 313

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  390 bits (1003), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 234/306 (76%)

Query: 7   NSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI 66
           N S +LKLNTGASIP +G GTW+S + + Y++V++AL+ GYRHID AAIY NEE VG+ I
Sbjct: 5   NESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGI 64

Query: 67  KDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGN 126
           +DSG+ REEIF+TTKLWGT+QRDPEAAL+ SL+RLGLDYVDLYL+HWPVPL   ++TDGN
Sbjct: 65  RDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGN 124

Query: 127 VLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNK 186
            L  P   DG +D+D +EWNFIKTW+ MQ LPK+GKT+A+GVSNFSI NI+ LL +  + 
Sbjct: 125 YLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPDF 184

Query: 187 LVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEP 246
           +VPA NQ+EIHP LPQ ELI +CK KGI++EAYSP GS+++ +L +  I  +A K+  EP
Sbjct: 185 IVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAEP 244

Query: 247 SQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKWA 306
           + ++ISW   RGYVVL KSVNP+R+ +N K+  L  +D + I  L++  G KR V   ++
Sbjct: 245 ANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDFS 304

Query: 307 SFPIFE 312
            F IFE
Sbjct: 305 PFAIFE 310

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 232/312 (74%), Gaps = 1/312 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M  T +N   T  +     IPA+  GTW++  N  Y +V+ ALK GYRHID AAIY NEE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           EVG+AI+DSGI R++IF+TTKLWGTEQR+P  AL+ SLKRLGLDYVDLYLMHWPV LK D
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
           ++TD ++L IP L  G  D+D + WNFIKTW+LMQELP T K +A+GVSNFSINN+ ELL
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            +P+ K +PA NQ EIHPLLPQ+ELI +C++K I+VEAY P G +N PL+    I ++A 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K GV   QL+ISW IQRGYVVL KSV  ER+V+NF+  T+P ++F+ + +L+K  G +R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 301 VNMKWASFPIFE 312
           VN+ ++ FP ++
Sbjct: 300 VNIDFSPFPTYQ 311

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 185/312 (59%), Positives = 242/312 (77%), Gaps = 7/312 (2%)

Query: 8   SSATLKLNTGASIPALGFGTWRSVD-NNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI 66
           S   LKL+TGASIP +G GTWRSV  N+ YHSVIAALK GYRHID AAIY NE +VG+AI
Sbjct: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66

Query: 67  KDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGN 126
           +DSG+ R EIF+T+KLW  +  DP+ ALN++LKRLGLDY+DLYLMHWPV     ++ D +
Sbjct: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126

Query: 127 -----VLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLK 181
                 + IPT  +G VDV+   WNFIKTW+LMQ LP++GKT+AVGVSNFSINN+ +LL 
Sbjct: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186

Query: 182 SPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241
           + + K+VPA NQ+E+HPLL Q+EL+ +CKEK I+VEAYSPFGS NAP+LK++ I  +AKK
Sbjct: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246

Query: 242 HGVEPSQLIISWSIQR-GYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
             ++  Q+++SW IQR GYVVL KSV+ ER+++N K+ TLP++DF+AI +L K  GE RV
Sbjct: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306

Query: 301 VNMKWASFPIFE 312
           V+  W+ FP+F+
Sbjct: 307 VDPDWSPFPLFK 318

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  379 bits (973), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 169/308 (54%), Positives = 232/308 (75%), Gaps = 1/308 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M   L+  +AT KLNTGA IP LG GTWRS   NGY++ +AA+K GYRHID AA+ +NE+
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
            VGRAI+DSG+ REE+F+TTKLW T+ RDP+ AL++SLKRLGLDYVDLY+MHWPV  +++
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            V   N + IP  +DG  DVD + W+++KTW+LMQELP TGKT A+GV+NFS++ +K+L+
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NK+VPA +Q+E HP LPQ+++++FCK+  I++EAYSP GS  APLL E  + +++K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K  VEP+QL++SW +QRG+ VL KS  P R+ +N   F +PE D + I +L++  G KR+
Sbjct: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299

Query: 301 VNMKWASF 308
            N  W SF
Sbjct: 300 HNPTWFSF 307

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  376 bits (965), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 174/312 (55%), Positives = 234/312 (75%), Gaps = 1/312 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M  TL+N + T+ LN G  IP +G GT+ S  N  Y +V+ A K GYRH+D AA Y NEE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+A+KD G+ R E+++TTK+W TE RDPEAAL++SLKRLGL+Y+DLYLMHWPV LKTD
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
           T+ DG ++CIP L DG  DVD K+W F++ W+ MQ+L K+GK +++GVSNFSINNIKELL
Sbjct: 121 TIKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            +P+  +VP  NQVE+ PLLP DELI FC+ K I+ +AY PFG + APL+K+  ++++AK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
            +GV+  Q+I SW +QRGYVVL KSV   R++SN K FTL + D   + ++SK  GEKR+
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 301 VNMKWASFPIFE 312
            N+ ++ FPIFE
Sbjct: 300 NNVNFSPFPIFE 311

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 181/309 (58%), Positives = 224/309 (72%), Gaps = 2/309 (0%)

Query: 4   TLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           TL NS+A + LN G  +P +G GTW+S +N+ Y +V+AALK GYRHID AAIY NEEEVG
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 64  RAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLK-TDTV 122
           RAIKDSG+ R EIF+TTKLWGT+ R P+ ALN+SL+RLGLDYVDLYLMHWPVP+      
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 123 TDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKS 182
            D N L IP  EDGT D+D   W+FIKTW+LMQ LPK+ K +++GVSNFSINNIK+LL S
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180

Query: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
           P NK VP  NQVE+HPLLPQ EL+ FCK K IVVEAYSP GS  AP+L+   I +++KK 
Sbjct: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240

Query: 243 GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVN 302
            + P+ ++ SW IQR  VVL KSV   R++SN +   LP ++F  + ++S   GEKR V 
Sbjct: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300

Query: 303 MKWASFPIF 311
             W  F  F
Sbjct: 301 PNWTPFIPF 309

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  366 bits (939), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 227/303 (74%), Gaps = 2/303 (0%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRA 65
           + S++  KLNTGASIP +G GT+ S D  GY +V+ A+K GYRHID AA+Y NE+ VGRA
Sbjct: 5   KPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRA 64

Query: 66  IKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDG 125
           I+DSG+ REE+F+TTK+W T+ R+P  AL ESL RLGLDYVDL+LMHWP  L+T+ +TDG
Sbjct: 65  IRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDG 124

Query: 126 NVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSN 185
           N++ +P  ED   DVDT EWN+IKTW LMQ+LP +GKT+AVGVSNFS+  +++LL  P +
Sbjct: 125 NMITVPKREDEKPDVDT-EWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGS 183

Query: 186 KLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVE 245
           K+VPA NQVE+HPLLPQ  L  FCK+K I++ AYSP GS  APLL +  I+++A KH  +
Sbjct: 184 KVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKAD 243

Query: 246 PSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKW 305
           P+Q+II W ++RGYV L KSV P R+ SN +I  L + + + I ++ K  GEKRVV+ +W
Sbjct: 244 PAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEW 302

Query: 306 ASF 308
             F
Sbjct: 303 FDF 305

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  365 bits (936), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 232/312 (74%), Gaps = 4/312 (1%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVD-NNGYHSVIAALKTGYRHIDAAAIYLNE 59
           M A L+NS+ TLKLN G+ IP +G GTW++ D  + Y++V AAL  GYRHID AAIY NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            +VG AI+DSG+ REEIF+TTKLW  +  +PE AL+ESL+RLGLDYVDLYLMHWPV L  
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
             + +   L +    DGT  V+T +W FI TW+LMQ+LPK  K R++GVSNFS+NN+K+L
Sbjct: 121 SYMKESP-LELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           LK+P+  +VP  NQVE+HPLLPQ EL+ +C++  I VEAYSP GS +APLL E  +ID+A
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 240 KKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKR 299
           KK+GV+P+ +++SW +QR  +VL KSV+ ERV +N K FTLPE+DF AIG +S+  GE+R
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 300 VVNMKWASFPIF 311
           + N  +  F  F
Sbjct: 298 INNPNFEPFKTF 309

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  361 bits (926), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/305 (55%), Positives = 224/305 (73%), Gaps = 1/305 (0%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD 68
           + + KLNTGA +PA+G GTW+S + + Y +V++ALK GY+HID AAIY NE  VG+AI+D
Sbjct: 8   TPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKAIRD 67

Query: 69  SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVL 128
           SGI R+E+FITTKLW T+ RDP+AAL+ SL+RLGLDYVDLYL+H+PV  KTD + DGN  
Sbjct: 68  SGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIEDGNPF 127

Query: 129 CIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNKLV 188
           C P L +G  DVD  +W+F+KTW L+Q LP++GK +AVGVSNFSINN+K LL+S     V
Sbjct: 128 CFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDEKFAV 187

Query: 189 PATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK-HGVEPS 247
           PA NQVEIHP LPQ ELI FCK K IVVEAYSP GS  + +L +  +  +A+K    +P+
Sbjct: 188 PAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXDAQPA 247

Query: 248 QLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKWAS 307
           Q++I+W I RGY VL KSV P+R+ +N +I  + ++D   + +L  + G KR +   W+ 
Sbjct: 248 QILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEPDWSP 307

Query: 308 FPIFE 312
           FPIFE
Sbjct: 308 FPIFE 312

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  355 bits (911), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 226/308 (73%), Gaps = 2/308 (0%)

Query: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60
           M   L+  +AT  LNTGA IP LG GTWR     GY +++AALK GYRHID+AA+ +NE+
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
            +G+AI+DSG+ R+E+F+TTKLW T+ RDP AAL++SLKRLGL+YVDLY+MHWP+  + D
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            +   N + IP   +G   VDT +W+++KTW+LMQ+LP T KTRA+GV+NFS+  +  LL
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           KSP+NK++PA +Q+E HP LP DE++AFC+EKGI++EAYSP G    PL+ E  I +++K
Sbjct: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K  VEP+QL+ISW ++RG  VL KS    R+ SN ++F L ++D++ I ++++  G KR 
Sbjct: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298

Query: 301 VNMKWASF 308
            N  W SF
Sbjct: 299 HNPPWFSF 306

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 177/302 (58%), Positives = 223/302 (73%), Gaps = 2/302 (0%)

Query: 11  TLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKDSG 70
           +LKLNTGASIP LGFGTW S   + Y +VI ALKTGYRHIDAAA+Y NE  VG+ I+DSG
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSG 69

Query: 71  IAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCI 130
           I REEIF+TTKLW T+QRDP +AL+ESL+RLGLDYVDL+L+HWPVPLK     + N+L  
Sbjct: 70  IPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGGPE-NLLKY 128

Query: 131 PTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNKLVPA 190
           PT       +DT++W+FIKTW+LMQ LPKTGKTRAVGVSNFSI N+++LL S  + LVPA
Sbjct: 129 PT-PGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPA 187

Query: 191 TNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPSQLI 250
            NQ EIHP LPQ ELI +CK KGIVVEAY P GS+++ +L +  I ++A K+ V+P+ ++
Sbjct: 188 VNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVL 247

Query: 251 ISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKWASFPI 310
           I+W I RGY VL KS  P R+ SN     L  +D + I  LS+  G KR V+  +  +P+
Sbjct: 248 INWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPL 307

Query: 311 FE 312
           FE
Sbjct: 308 FE 309

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  330 bits (845), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 163/310 (52%), Positives = 225/310 (72%), Gaps = 1/310 (0%)

Query: 3   ATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEV 62
           ATL+ S+ T+ LNTGA IP  G GTW+S D++   +V AALK GY+HID A+ Y NEE V
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELV 64

Query: 63  GRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           G+A+K+SGI REE+FITTK+W  +QRDP  AL+ SLK+LG +YVDL LMHWPVP K    
Sbjct: 65  GKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPEN 124

Query: 123 TDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKS 182
           +  +   +P   DG V  D +EW+F+KTW LMQ+L  TGK +A+GVSNFSINN++ELL +
Sbjct: 125 STLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNA 183

Query: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
               +VPA NQVE+H  LPQ EL+ +C++KGIVVEAYSP GS++APLLK+  +  +A+K+
Sbjct: 184 EGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKY 243

Query: 243 GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVN 302
           GV P+ +++++   RG VVL KSV   R++SNF+ F + E+D K + D+ K  G +R V+
Sbjct: 244 GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVD 303

Query: 303 MKWASFPIFE 312
             ++ FP+F+
Sbjct: 304 PDFSPFPLFQ 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  222 bits (565), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 178/286 (62%), Gaps = 12/286 (4%)

Query: 12  LKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD- 68
             LN G  IPA+G GT    D       +V AA++ GYRHID A  Y  E  +G+A+K+ 
Sbjct: 11  FNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALKEL 70

Query: 69  ---SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDG 125
              + I REE+FITTK+W T   +P  ++++SLK LG+DYVDL L HWPV  +    + G
Sbjct: 71  FESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENSQG 130

Query: 126 NVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSINNIKELLKS 182
           N++ +P  +DG    + K+ +++ T+  ++++   PK  + RA+GVSN+ I  ++ L K 
Sbjct: 131 NIIGLPRDKDGNALFE-KDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLFKE 189

Query: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
              K+ PA NQVE+HP LPQ EL  FC +  I++ AYSP GS  AP LK +++ D+AKK+
Sbjct: 190 --CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKKY 247

Query: 243 GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAI 288
            VEP+ ++ S+ I +G VVL +S+NP+R+ +N     L +DD   +
Sbjct: 248 KVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKL 293

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  216 bits (551), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 176/296 (59%), Gaps = 12/296 (4%)

Query: 6   RNSSATLKLNTGASIPALGFGTW--RSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           RN+     LN G  IPA+G GT   +        +V AA++ GYR ID A  Y  E  +G
Sbjct: 5   RNTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIG 64

Query: 64  RAIK----DSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            A+K    D  I RE++FITTK+W     DP  ++NESLK LG+DYVD+ L HWP+  K 
Sbjct: 65  EALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKK 124

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSINNI 176
               +G ++  P  +DG V +  +  ++I T+ LM+++   PK  + RA+GVSN+ I  +
Sbjct: 125 TYDENGTIIGKPLDKDGKV-IFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYL 183

Query: 177 KELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAII 236
           + ++K    K+ P  NQVE+HP LPQ EL  FC + GI++ AYSP GS  AP  K   + 
Sbjct: 184 ERVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQ 241

Query: 237 DMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLS 292
           + AKKH V P+ ++ S+ +++G VV+ +S+NPERV SN     L +++ K++ D  
Sbjct: 242 EYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  204 bits (519), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/311 (36%), Positives = 189/311 (60%), Gaps = 14/311 (4%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           +N+     LN G  +PALG GT   ++       +V AA+K+GYRHID A  Y  E+ +G
Sbjct: 5   KNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIG 64

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            A+K+      I RE+IFITTK+W T     + +++ SL+ LG+DYVDL L HWP+    
Sbjct: 65  EALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNR 124

Query: 120 DTVTDG-NVLCI-PTLEDGTVDVDTKEWNFIKTWDLMQE--LPKTGKTRAVGVSNFSINN 175
               +G + +C  PT EDG+   + K  ++++T+  +++  L K  + R++GVSN+ +  
Sbjct: 125 LQDPEGIDGICRNPTHEDGSPHYNEK-GDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEY 183

Query: 176 IKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ LLK    K+VPA NQVE+HP LPQ EL  FC +  I +EA+SPFG+  +P++K + +
Sbjct: 184 LERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELV 241

Query: 236 IDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVH 295
             +A+K+   P+ ++I++ +++G V + +SVNP+ + SN +   L ++D   +     V 
Sbjct: 242 QKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFG-VE 300

Query: 296 GEKRVVNMKWA 306
             KR+V+ ++A
Sbjct: 301 NPKRLVDEEFA 311

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  198 bits (504), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 114/312 (36%), Positives = 181/312 (58%), Gaps = 14/312 (4%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           +N+     LN G  +PA+G GT   V+       +V AA+K+GYRHID A  Y  E+ VG
Sbjct: 5   KNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVG 64

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            A+K+      + RE+IF+TTK+W T     + +++ SL+ LGLD+VDL L HWP+    
Sbjct: 65  EALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNR 124

Query: 120 DTVTDG--NVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL--PKTGKTRAVGVSNFSINN 175
               DG   V   P  EDG+   + K  ++++T+  +++L   K  + RA+GVSN+ +  
Sbjct: 125 LEDPDGIDGVRRNPYHEDGSPHYNEK-GDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEY 183

Query: 176 IKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ LLK    ++VPA NQVE HP LPQ EL  FC +  I +EAYSP G+ NAPL+  + +
Sbjct: 184 LERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELV 241

Query: 236 IDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVH 295
             +A K+      ++I++ +++G V + +SVNP+ + SN +   L ++D   +     V 
Sbjct: 242 KKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFG-VE 300

Query: 296 GEKRVVNMKWAS 307
             KR+V+  +A+
Sbjct: 301 NTKRIVDEPFAA 312

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  198 bits (503), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 125/320 (39%), Positives = 185/320 (57%), Gaps = 20/320 (6%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDNNGY--HSVIAALKTGYRHIDAAAIYLNEEEVG 63
           + +  +  LN G  +PALG GT       G    +V AA+K GYRHID A  Y +E  VG
Sbjct: 8   KGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVG 67

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPL-- 117
            AIK+      I RE+IFIT+K+W     D E +LNESL+ LG+DY+DL+L HWP+    
Sbjct: 68  EAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVK 127

Query: 118 KTDTVTDGNVLCIPTLEDGT--VDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFS 172
           + DT     +   P   +G    +VD    ++++T+  M+++   P   + R++GVSNF 
Sbjct: 128 QEDTHGINGLARNPETPNGEPYYEVDG---DWLETYVQMEKIYLDPSDNRVRSIGVSNFP 184

Query: 173 INNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKE 232
           +  ++  L   + K  PA NQVE+HP LPQ EL  FC+   I++EAYSP GS NAP +  
Sbjct: 185 VQYLERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHL 242

Query: 233 QAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLS 292
           Q + D+A+K+ + PS ++ S+ I++G  V+++SVN  R+ SN +   L E++   +  L 
Sbjct: 243 QLVQDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLG 302

Query: 293 KVHGEKRVVNMKW-ASFPIF 311
            +   KR VN KW A  P F
Sbjct: 303 -ITKPKRFVNEKWNAVVPGF 321

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  197 bits (500), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/313 (37%), Positives = 182/313 (58%), Gaps = 14/313 (4%)

Query: 6   RNSSATLKLNTGASIPALGFGTW--RSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           +++    KLN G +IPALGFGT+  R        +V AA+K GYRHID A +Y +E  VG
Sbjct: 5   KSTEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVG 64

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPV--PL 117
            AIK+      ++R ++F+TTK+W     + E +LNESL+ LGLDYVDL L HWP+  P 
Sbjct: 65  EAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPR 124

Query: 118 KTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSIN 174
             D     N L     +D    +  ++ +F++T+  ++++   P   + RA+GVSN++I 
Sbjct: 125 VEDEKNGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIE 184

Query: 175 NIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQA 234
            ++ L K    K+ P  NQVEIHP LPQ EL  FC   GI++ AYSP GS  AP LK   
Sbjct: 185 YLEALFKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPL 242

Query: 235 IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKV 294
           +  +A+K+ +  + ++IS+ I++G  V+ +S+NP R+ S  +     +++ K + ++  +
Sbjct: 243 VHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVG-I 301

Query: 295 HGEKRVVNMKWAS 307
               R V+  +A 
Sbjct: 302 EEPARFVDAAFAQ 314

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  195 bits (496), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 114/318 (35%), Positives = 185/318 (58%), Gaps = 18/318 (5%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           R +     LNTGA IP+LG GT    +       +V  A+K GYR ID A +Y +E  +G
Sbjct: 5   RATEIYFNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIG 64

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            A+++      + RE++FITTK+W       E +L ESLK+L LDYVDL L HWP+    
Sbjct: 65  EALQELFEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVK 124

Query: 120 DTVTDGNVLCIPT-LEDGTVDVDTKEWNFIKTWDLMQELPK--TGKTRAVGVSNFSINNI 176
                G +   P   + G + +D K  +++ TW  ++++ K  +G+ R +GVSN+ +  +
Sbjct: 125 QYDEHGKLKSHPVDPKSGDIVLDEK-GDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYL 183

Query: 177 KELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAII 236
           + LLK    ++VP  NQVE+HPLLPQ+EL  +C   GI++E++SP GS+  P L+   + 
Sbjct: 184 ERLLKE--TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVK 241

Query: 237 DMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHG 296
           +++KK+  EP  +++++ +++G VV+ +S+N  R++ N     L E+D   +  L +   
Sbjct: 242 ELSKKYDCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGR--- 298

Query: 297 EK--RVVNMKWA-SFPIF 311
           EK  RV++  +A S P F
Sbjct: 299 EKPVRVMDEYFATSIPGF 316

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  195 bits (495), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/300 (38%), Positives = 176/300 (58%), Gaps = 15/300 (5%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDNNG--YHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           +++    KLN G ++PALG GT    ++      +V AA+K GYRHID A  Y  E  +G
Sbjct: 5   KSTEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIG 64

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPL-K 118
            A+K+      + R ++FIT+K+W     D + +LNESLK LGLDYVDLYL HWP+   K
Sbjct: 65  DALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQK 124

Query: 119 TDTVTDG--NVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSI 173
            +   DG   +   P  +DG   +  +  +++ T+  M+++   PK  + RA+GVSN+ +
Sbjct: 125 IEDSKDGVNGLKGKPIDKDGNALI-VEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPV 183

Query: 174 NNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQ 233
             +  LLK  + K  PA NQVE+HP LPQ EL  FC+   I + AYSP GS+ APLLK  
Sbjct: 184 EYLDRLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLP 241

Query: 234 AIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSK 293
            + ++++K+ V  + ++IS+ I++G  V+ +S+NP R+       TL E +   + D+ +
Sbjct: 242 LVKELSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGR 301

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  192 bits (489), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 117/308 (37%), Positives = 175/308 (56%), Gaps = 16/308 (5%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           + +     LN G  IPALG GT    +       +V AA+K GYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIK----DSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK    D  I RE++FITTK+W     + + +LNESLK LGL+YVDL L HWP+  + 
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEK 138

Query: 120 DTVTDGNVLCIPT-LEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSINN 175
                G    + T ++D    +   + ++++T+  ++++   P   + RA+GVSNFSI  
Sbjct: 139 IKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 176 IKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ L+K    ++ P  NQVE HP LPQ EL  FC    I++ AYSP GS  AP LK   +
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLV 256

Query: 236 IDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVH 295
             +A+K+ V  + L+IS+ I++G +V+ +S+NP R+ S+ +  +L +D+ + + D     
Sbjct: 257 KKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDF---- 312

Query: 296 GEKRVVNM 303
           GEK  V  
Sbjct: 313 GEKYPVRF 320

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  188 bits (478), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 171/302 (56%), Gaps = 19/302 (6%)

Query: 14  LNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD--- 68
            N G  +PA G GT    +       +V AA+K GYRHID A  Y  EE VG A+++   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 69  -SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGN- 126
              + RE++ IT+K+W T   D + +LNESL RL +DYVDL+L HWP  L T  V D + 
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWP--LCTQKVPDPHG 130

Query: 127 ---VLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSINNIKELL 180
              +   P  + G    D K  ++I+T+  ++++       + RA+GVSNF I  +K +L
Sbjct: 131 VDKIAKEPVDDQGNPLYDEK-GDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVL 189

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           K    + VPA NQVE+HP LPQ EL  FC E  I+V AYSP G   APLL+   +  + +
Sbjct: 190 KE--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCE 247

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+   P+ ++ S+ +++G +V+ +S+N  R+ SN +   L E+D   + +  +   +KR 
Sbjct: 248 KYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQ-KNKKRY 306

Query: 301 VN 302
           +N
Sbjct: 307 IN 308

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  189 bits (479), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 119/310 (38%), Positives = 172/310 (55%), Gaps = 20/310 (6%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           + +     LN G  IPALG GT    +       +V AA+K GYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      I RE++FITTK+W     + + +LNESLK LGLDYVDL L HWP+    
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGK 138

Query: 120 DTVTDG--NVLCIPTLEDG-TVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSI 173
               +G    + +P  + G TV     +W  ++T+  ++++       + RA+GVSNFSI
Sbjct: 139 VKDPEGISGYMKLPVDDSGKTVYASNGDW--LETYKQLEKIYLDSNDHRVRAIGVSNFSI 196

Query: 174 NNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQ 233
             ++ L+K    K+ P  NQVE HP LPQ EL  FC    I++ AYSP GS  AP LK  
Sbjct: 197 EYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIP 254

Query: 234 AIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSK 293
            +  + +K+ V  + L+IS+ I++G +V+ +S+NP R+ SN +   L +D+ + + +   
Sbjct: 255 LVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEF-- 312

Query: 294 VHGEKRVVNM 303
             GEK  V  
Sbjct: 313 --GEKYPVRF 320

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  187 bits (476), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 117/308 (37%), Positives = 171/308 (55%), Gaps = 16/308 (5%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           + +     LN G  IPALG GT    +       +V AA+K GYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVG 78

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      I RE++FITTK+W     + + +LNESLK LGLDYVDL L HWP+  + 
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEK 138

Query: 120 DTVTDGNVLCIPT-LEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSINN 175
                G    + T ++D    V     ++++T+  ++++       + RA+GVSNFSI  
Sbjct: 139 VKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEY 198

Query: 176 IKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ L+K    K+ P  NQVE HP LPQ EL  FC    I++ AYSP GS  AP LK   +
Sbjct: 199 LERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLV 256

Query: 236 IDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVH 295
             + +K+ V  + L+IS+ I++G +V+ +S+NP R+ SN +   L +D+ + + +     
Sbjct: 257 KKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEF---- 312

Query: 296 GEKRVVNM 303
           GEK  V  
Sbjct: 313 GEKYPVRF 320

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  187 bits (474), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 120/318 (37%), Positives = 181/318 (56%), Gaps = 16/318 (5%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           +++  +  LN G  +PA+G GT    +       +V AA+K GYR+ID A  Y +E  VG
Sbjct: 5   KSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVG 64

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPL-- 117
            AIK+      I RE++FIT+K+W     D E +L ESLK LG+DY+DL+L HWP+    
Sbjct: 65  EAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNR 124

Query: 118 KTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSIN 174
           + D      +   P   DG+ D + K  +++ T+  M+ +   PK  + RA+GVSNF + 
Sbjct: 125 REDPHGINGLARNPEKADGSPDFNEKA-DWLDTYKQMERIYSNPKDNRVRAIGVSNFPVE 183

Query: 175 NIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQA 234
            +K +LK    K  P  NQVE+HP LPQ EL  FC +  I + AYSP GS  AP++K   
Sbjct: 184 YLKRVLKECPVK--PVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHPL 241

Query: 235 IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKV 294
           I +M++K+    + ++ S+ I++G  V+ +S+N  R+ SN +   L +DD   + DL + 
Sbjct: 242 IKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLSKDDLDKLKDLGRT 301

Query: 295 HGEKRVVNMKW-ASFPIF 311
              KR +N KW A+ P F
Sbjct: 302 E-PKRFINEKWNAAVPGF 318

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  187 bits (474), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 113/317 (35%), Positives = 178/317 (56%), Gaps = 14/317 (4%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           + +     LN G  +PALG GT    +       +V AA+K GYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIKD----SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      I RE++FITTK+W     + E +L+ESLK +GLDYVDL+L HWP+  + 
Sbjct: 79  EAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEK 138

Query: 120 --DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSIN 174
             D      ++  P  + G   + +   ++++T+  ++++   P   + RA+GVSNFSI 
Sbjct: 139 VKDPKGISGLVKTPVHKSGEAMLASN-GDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIE 197

Query: 175 NIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQA 234
            ++ L+K    ++ P  NQVE HP LPQ EL  FC    I++ AYSP GS  AP LK   
Sbjct: 198 YLERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPL 255

Query: 235 IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKV 294
           +  + +K+ V  + ++IS+ I++G +V+ +S+NP R+ S+ +   L +D+ + + D  + 
Sbjct: 256 VKKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFGEK 315

Query: 295 HGEKRVVNMKWASFPIF 311
           +  + +     AS P F
Sbjct: 316 YPVRFIDEPFAASLPEF 332

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  186 bits (471), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 172/308 (55%), Gaps = 16/308 (5%)

Query: 6   RNSSATLKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63
           + +     LN G  IPALG GT    +       +V AA+K GYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIK----DSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK    D  I RE++FITTK+W     + + +LNESLK LGLDYVDL+L HWP+  + 
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEK 138

Query: 120 DTVTDGNVLCIPT-LEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSINN 175
                G    + T ++D    +     ++++T+  ++++   P   + RA+GVSNFSI  
Sbjct: 139 VKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEY 198

Query: 176 IKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ L+K    ++ P  NQVE HP LPQ  +  FC    I++ AYSP GS  AP LK   +
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLV 256

Query: 236 IDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVH 295
             + +K+ +  + ++IS+ I++G +V+ +S+NP R+ S+ +   L +D+ + + D     
Sbjct: 257 KKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDF---- 312

Query: 296 GEKRVVNM 303
           GEK  V  
Sbjct: 313 GEKYPVRF 320

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  185 bits (470), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 168/311 (54%), Gaps = 14/311 (4%)

Query: 12  LKLNTGASIPALGFGTWRSVDN--NGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD- 68
             LN G  IPA+G GT    D       +V AA+K G+R ID A  Y  EE +G A+++ 
Sbjct: 11  FNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQEL 70

Query: 69  ---SGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPL--KTDTVT 123
                + RE++FITTK+W       E +LNESLKRL LDYVDL L HWP     K D   
Sbjct: 71  FAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQDPEG 130

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL---PKTGKTRAVGVSNFSINNIKELL 180
            G ++  P  EDG+   DT   ++++T+  ++ +       + RA+GVSN+ I  ++ L 
Sbjct: 131 SGQLVNHPQHEDGSPFYDTAG-DWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLERLF 189

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           K    K VPA NQVE+HP LPQ EL  +C + GI++ +YSP GS  AP L+   + ++A 
Sbjct: 190 KE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQELAS 247

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300
           K+    + +++S+ I++G +V+ +S+N ER+        L +++   +      H  + +
Sbjct: 248 KYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVEHEYRYI 307

Query: 301 VNMKWASFPIF 311
                   P F
Sbjct: 308 DEAFCVCVPGF 318

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  174 bits (440), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 111/330 (33%), Positives = 172/330 (52%), Gaps = 35/330 (10%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           + T  LN G  +P +G G W+   +     V  A+K GYR  D A  Y NE+E+G    +
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           AI +  + RE++FI +KLW           AL  +L  LGLDYVDLY +H+P+P+K   +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P +  G  D     V  ++   + T+  M++L   G  +++G+SNF    I+
Sbjct: 124 EEKYP---PEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQ 180

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN----------- 226
           +LL+    ++ P   QVE+HP L Q+ L+ + + K I V AYS FG  +           
Sbjct: 181 DLLRGA--RIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKD 238

Query: 227 -APLLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNF---KIFTLPE 282
             PLL+ + ++++AKKH V PSQ+I+ W+ QRG  V+ KS   ER+++N    K  TL +
Sbjct: 239 VTPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSD 298

Query: 283 DDFKAIGDLSKVHGEKRVVN-MKWASFPIF 311
            +   I  L+K     R ++   WA  P F
Sbjct: 299 SEMSDIFSLNK---NLRFLDPWDWARLPGF 325

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  171 bits (434), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/308 (32%), Positives = 163/308 (52%), Gaps = 31/308 (10%)

Query: 11  TLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----RAI 66
           T+KLN GA +P +G G W+  +      V  A+K GYR +D A  Y NE EVG    RAI
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 67  KDSGIAREEIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTD 124
            +  + REE+F+ +KLW    R  D   AL  +L  LGLDY+DL+ +H+P+  K   + +
Sbjct: 92  DEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVPLEE 151

Query: 125 GNVLCIPTLEDGTVDVDTKEWN-----FIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
                + T   G  D             I+T+  +++L   G+ RA+G+SNF    +++L
Sbjct: 152 RYPAGLYT---GAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDL 208

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN------------A 227
           L+    ++ PA  Q+E HP L Q+ L+ + K +G+ V  YS  G  +            A
Sbjct: 209 LR--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAA 266

Query: 228 PLLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPEDD 284
           PLL+ + +  +A++H   P+++++ W+ QR   V+ KS   ER+ +N ++    TL +D+
Sbjct: 267 PLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDE 326

Query: 285 FKAIGDLS 292
            + +  L+
Sbjct: 327 LRELSSLN 334

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  165 bits (418), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 115/330 (34%), Positives = 172/330 (52%), Gaps = 33/330 (10%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           S  + LN G  +P +G G W+  ++     V  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDP---EAALNESLKRLGLDYVDLYLMHWPVPLKTDT 121
           AI +  + REE+F+ +KLW +   DP   + AL  +L  + LDY+DLY +H+P+  K   
Sbjct: 62  AISEGIVKREELFVISKLWNS-YHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVP 120

Query: 122 VTDGNVLCIPT-LEDGTVDVDTKE-WNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
             +       T  ED    + ++E    I T+  M++L   G  +++G+SNF+   I++L
Sbjct: 121 FEEKYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDL 180

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SANAP 228
           L+  S K+ P   Q+E HP L Q  LI +CK   I V AYS FG           + +A 
Sbjct: 181 LR--SCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAK 238

Query: 229 LLKEQAII-DMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPEDD 284
           +L E  +I  +A  H VEPSQ+++ W+ QRG  ++ KS   ER++ N  I    TL E +
Sbjct: 239 VLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQE 298

Query: 285 FKAIGDLS---KVHGEKRVVNMKWASFPIF 311
              I DL+   + +      NMK   FPIF
Sbjct: 299 LSTISDLNIGLRFNDPWDWNNMK---FPIF 325

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  163 bits (412), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/329 (31%), Positives = 174/329 (52%), Gaps = 31/329 (9%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIK- 67
           S T+KLN G  +P +G G W+  +      V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSGIA-REEIFITTKLWGT--EQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
             D GI  RE++F+ +KLW +  + ++ + AL  +L+ LGL+Y+DL+ +H+P+  K    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    G  D     +  ++   + T+  +++    G  +A+GVSNF    + 
Sbjct: 125 EERYP---PGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLH 181

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL     K+ PA  Q+E HP L Q++L+ +CK++GI V AYS FG           + +
Sbjct: 182 DLLAGA--KIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKS 239

Query: 227 APLLKEQAII-DMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPE 282
            P L E  ++  +A  HGV  S++++ W+ QR   ++ KS   ER+++N +I    TL +
Sbjct: 240 TPTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSD 299

Query: 283 DDFKAIGDLSKVHGEKRVVNMKWASFPIF 311
           ++ + I  L+K        N     FP+F
Sbjct: 300 EELQEISSLNKDIRFNDPFNWLDMKFPVF 328

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  162 bits (410), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/311 (32%), Positives = 162/311 (52%), Gaps = 31/311 (9%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           + T+ LN G  +P +G G W+  ++     +  A+K GYR  D A  Y NE+EVG    R
Sbjct: 5   AETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNR 64

Query: 65  AIKDSGIAREEIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           AIK+  + RE++ + +KLW +     +   AL  +L  L LDYVD++ +H+P+  K    
Sbjct: 65  AIKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPF 124

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    G  D     ++ ++   + TW  +++L   GK +++G+SNFS   I+
Sbjct: 125 DEK---YPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQ 181

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL+    ++ P   Q+E HP L Q+ LI + K  GI V AYS FG           + N
Sbjct: 182 DLLRGA--RIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALN 239

Query: 227 APLLKEQAII-DMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPE 282
            P L E   I  +A KH V P Q+++ W+ Q G  ++ KS   ER++ N +I    TL +
Sbjct: 240 TPTLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTD 299

Query: 283 DDFKAIGDLSK 293
           D+ K I  L++
Sbjct: 300 DELKQISGLNQ 310

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  161 bits (407), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/333 (32%), Positives = 166/333 (49%), Gaps = 39/333 (11%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIK- 67
           S+ + LN G  +P +G G W+  ++     V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSGIA-REEIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
             D G+  RE++F+ +KLW +       + AL  +L  +GLDY+DL+ +H+P+  K    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    G  D     +       I T+  +++  + G  +++G+SNFS + ++
Sbjct: 122 EEKYP---PGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQ 178

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL+    K+ P   QVE HP L Q+ L+ +CK+ GI V AYS FG           + N
Sbjct: 179 DLLR--QCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKN 236

Query: 227 AP-LLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPE 282
            P L     I  +A  H V  SQ+++ W+ QRG  ++ KS   ER+  N  I    TL  
Sbjct: 237 TPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTH 296

Query: 283 DDFKAIGDLSKVHGEKRVVNMKW----ASFPIF 311
            + +AI  L+K       +N  W      FPIF
Sbjct: 297 KELEAISKLNK----NLRLNDPWDWLDGKFPIF 325

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  161 bits (407), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 103/331 (31%), Positives = 166/331 (50%), Gaps = 39/331 (11%)

Query: 12  LKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----RAIK 67
           L LN G  +P +G G W+  ++     V  A+K GYR  D A  Y NE EVG    RA+ 
Sbjct: 5   LTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMD 64

Query: 68  DSGIAREEIFITTKLWGTEQRDPEAALN--ESLKRLGLDYVDLYLMHWPVPLKTDTVTDG 125
           D  + R+++F+ +KLW          LN   +LK LGLDY+DLY +H+P+  K   + + 
Sbjct: 65  DGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEER 124

Query: 126 NVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
                P +  G  D     +  +    + T+  ++E  + G  +++G+SNF+   + ++L
Sbjct: 125 YP---PQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADIL 181

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN------------AP 228
           +  S K  P   Q+E HP L Q++L+ +CK   + V  YS FG  +             P
Sbjct: 182 RGCSIK--PVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPP 239

Query: 229 LLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPEDDF 285
           L     I  +A+KH V  +++++ W+ QRG  ++ KS + +R++SN  I    TL E+D 
Sbjct: 240 LFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDL 299

Query: 286 KAIGDLSKVHGEKRVVNMKW----ASFPIFE 312
           K+I  L+    +    N  W    + FPIF 
Sbjct: 300 KSISGLN----QNLRFNDPWDWNNSKFPIFH 326

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  160 bits (406), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 164/308 (53%), Gaps = 25/308 (8%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           ++ + LN G  +P +G G W+  +      +  A+  GYR  D A  Y NE+EVG    R
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 65  AIKDSGIAREEIFITTKLWGT--EQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           AIKD  + REE+F+ +KLW +    ++ + AL  +L  +GLDY+DL+ +H+P+ LK  + 
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 123 TDGNVLCIPTLE-DGTVDVDTKE-WNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            +     + T E D    V ++E    + T+  ++E  + G  +++GVSNFS + + +LL
Sbjct: 122 EEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDLL 181

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SANAP 228
           +    ++ PA  Q+E+HP L Q+  + + + KGI V AYS FG             A  P
Sbjct: 182 RGA--RIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATPP 239

Query: 229 LLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPEDDF 285
           L +   +  +A KH V  SQ+++ W+ Q+   V+ KS   ER+  N  +    TL  D+ 
Sbjct: 240 LFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGDEI 299

Query: 286 KAIGDLSK 293
           K I  L+K
Sbjct: 300 KEISGLNK 307

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  159 bits (401), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 151/279 (54%), Gaps = 37/279 (13%)

Query: 11  TLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD-- 68
           + KL++G +IP++G GT+    N   + V  AL+ GYRH D A +Y NE EVG+ IK   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWL 67

Query: 69  ----SGIAREEIFITTKLWGTEQRDPEA--ALNESLKRL-GLDYVDLYLMHWPVPLKTDT 121
               +   R ++F TTKLW ++    +A  A++  L+ +  L Y+DL L+H P+      
Sbjct: 68  NENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL------ 121

Query: 122 VTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLK 181
              G  L                   ++T++ MQE    GK R++GVSN+   +I+ELL 
Sbjct: 122 --GGKKL------------------RLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLN 161

Query: 182 SPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241
               K  P  NQ+EI P   + EL  FCK+KGI+VEAY+P    +   LK+  ++ +A +
Sbjct: 162 WEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVANE 219

Query: 242 HGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTL 280
            G +  Q +I WS+Q+GY+ L K+ +  R+ SN  +F+ 
Sbjct: 220 VGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  160 bits (404), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 163/309 (52%), Gaps = 27/309 (8%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           S T+ LN G ++P +G G W+   +     V  A+K GYR  D A  Y NE++VG    R
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDPEA---ALNESLKRLGLDYVDLYLMHWPVPLKTDT 121
           AI +  + RE++F+ +KLW T   DP+    AL  +L  + L+Y+DLY +H+P+  K   
Sbjct: 62  AIDEGIVKREDLFVVSKLWNT-YHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVP 120

Query: 122 VTDGNVLCIPT-LEDGTVDVDTKE-WNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
             +       T  ED    + T+E    I T+  M+EL   G T+++G+SN++   +++ 
Sbjct: 121 FEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDT 180

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN------------A 227
           L+    ++ P   Q+E HP L Q++L+ +CK  GI V AYS FG  +             
Sbjct: 181 LR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTP 238

Query: 228 PLLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPEDD 284
           PL     I  +A++H V  SQ+I+ W+ QRG  V+ KS +  R++ N +I    TL   D
Sbjct: 239 PLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 285 FKAIGDLSK 293
            + I  L+K
Sbjct: 299 LEEISSLNK 307

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  159 bits (402), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 105/313 (33%), Positives = 164/313 (52%), Gaps = 33/313 (10%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIK- 67
           S  + LN G  +P +G G W+  +      V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSGIA-REEIFITTKLWGT--EQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
             D GI  REE+F+ +KLW +  + ++ +AAL  +L  + LDY+DL+ +H+P+ LK    
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P L  G+ D     +  +    I T+  +++L   G  +++G+SNFS + I 
Sbjct: 122 KEK---YPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIM 178

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SA 225
           +LL+    ++ P   Q+E HP L Q+ L+ + K +G+ V AYS FG              
Sbjct: 179 DLLR--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKT 236

Query: 226 NAPLLKEQAIIDMAKKHGVE--PSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTL 280
             PL +   II++AK HG E  PSQ+++ W+ Q    V+ KS   ER+  N  I    TL
Sbjct: 237 TPPLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTL 296

Query: 281 PEDDFKAIGDLSK 293
            + + K I  L+K
Sbjct: 297 TDQELKEISALNK 309

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  155 bits (391), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 146/277 (52%), Gaps = 37/277 (13%)

Query: 13  KLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI------ 66
           KL++G ++P++G GT+    N     V  ALK GYRH+D A +Y NE EVG  I      
Sbjct: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70

Query: 67  KDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTDTVT 123
             S   RE++F  TKLW ++    + + A+ E  +++ GL Y+DL L+H P+        
Sbjct: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL-------- 122

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
                             +     ++T+  MQE    G  R++GVSN+ +++I ELL   
Sbjct: 123 ------------------SGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQ+EI P L + EL  +CK +G++VEAY+P    +   +    ++ +AK+ G
Sbjct: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAG 222

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTL 280
               Q++I WS+Q GYV L K+ + +R+ SN  ++ +
Sbjct: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/311 (31%), Positives = 161/311 (51%), Gaps = 31/311 (9%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD 68
           S T+ LN G  +P +G G W+  ++     V  A+K GYR  D A  Y NE+EVG+ IK 
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 69  S---GIA-REEIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           +   GI  RE++F+ +KLW +     + + AL ++L  +GLDY+DL+ +H+P+  K    
Sbjct: 65  AIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVPF 124

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    G  D     +  ++   I T+  +++    G  +++G+SNF+ + ++
Sbjct: 125 EEKYP---PGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQ 181

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SA 225
           +LL+    ++ P   Q+E HP L Q+ L+ +CK  GI V AYS FG              
Sbjct: 182 DLLRGA--RIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKT 239

Query: 226 NAPLLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPE 282
              L +   +  +A  H V  SQ+++ W+ QRG  V+ KS   ER++ N  I    TL +
Sbjct: 240 TPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSD 299

Query: 283 DDFKAIGDLSK 293
            + KAI  L+K
Sbjct: 300 KELKAISALNK 310

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 162/312 (51%), Gaps = 31/312 (9%)

Query: 8   SSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIK 67
           +S T+KLN G  +P +G G W+  +      V  A+K GYR  D A  Y NE+EVG+ I 
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 68  ---DSGIA-REEIFITTKLWGT--EQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDT 121
              D GI  RE++F+ +KLW +  + ++ + AL  +L+ + L+Y+DL+ +H+P+  K   
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYVP 123

Query: 122 VTDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNI 176
             +      P    G  D     +  ++   I T+  ++E  K G  +++G+SNF    I
Sbjct: 124 FEEKYP---PGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILI 180

Query: 177 KELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------S 224
            +LL   + K  P   Q+E HP L Q++LI +C ++ I V AYS FG             
Sbjct: 181 HDLLAGATIK--PVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAK 238

Query: 225 ANAPLLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLP 281
           +   L + + I  +A  HGV  SQ+++ W+ QR   ++ KS   ER++ N +I    TL 
Sbjct: 239 STPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLT 298

Query: 282 EDDFKAIGDLSK 293
           E + + I  L+K
Sbjct: 299 EAELQEISALNK 310

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  155 bits (392), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 154/296 (52%), Gaps = 49/296 (16%)

Query: 7   NSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEE----V 62
           N     KLN G  +P +GFG +          V  AL+ GYRHID A +Y N+++    V
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGV 67

Query: 63  GRAIKDSGIAREEIFITTKLWGTEQ-RDPEAALNESLKRLGLD------YVDLYLMHWPV 115
            R ++++G  REE++ TTKLW T+Q RD   A   +L+ +  D      YVDL L+H P 
Sbjct: 68  HRFLEETGTPREEVWFTTKLWNTQQGRD---ATPRALEEIAADVKEFIGYVDLLLLHSP- 123

Query: 116 PLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQ---ELPKTG--KTRAVGVSN 170
                 +TD                       ++TW +++   + P +   + RA+GVSN
Sbjct: 124 ------LTDAQ-------------------RRLETWAVLERAVQEPASSALEIRAIGVSN 158

Query: 171 FSINNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLL 230
           F + +++ELL+  + K  P  +Q+E+HP LP+ EL AF +E GI+ EAYSP        L
Sbjct: 159 FGVRHLQELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRL 214

Query: 231 KEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFK 286
           ++  ++ +  K G+   ++++ WS  +G+ VL KS NP+R+  N  +     D +K
Sbjct: 215 QDPELLALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVLPAKTDSWK 270

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  154 bits (390), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 150/294 (51%), Gaps = 44/294 (14%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI-- 66
           S T  L  G  IP L  G + +      H+V  ALK+GYRH+D A +Y NE EVG  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 67  ---KDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLG----LDYVDLYLMHWPVPLKT 119
              +   ++R EIF TTK+ G +    E A    +K L     ++Y+DL L+H P+    
Sbjct: 66  FLKETPNVSRSEIFYTTKVSG-DNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATE 124

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
           +                           + TW  +QE    GK RA+GVSN+SI +++EL
Sbjct: 125 ER--------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANA---PLLKEQAII 236
                 K+ P  NQ E++P L + EL  +C++KG+V+EA+SP         P L+E  +I
Sbjct: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQE--LI 216

Query: 237 DMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288
             +  +   P+Q++I WS+Q G++ L KS N +R +SN +   F + + D KA+
Sbjct: 217 KTSYPNQT-PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKAL 269

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  155 bits (393), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 109/332 (32%), Positives = 168/332 (50%), Gaps = 34/332 (10%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIK- 67
           SA + LN G  +P +G G W+   +     +  A+K GYR  D A  Y NE+EVG+ IK 
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 68  --DSG-IAREEIFITTKLWGTEQRDPEAALN--ESLKRLGLDYVDLYLMHWPVPLKTDTV 122
             D G + RE++FI +KLW          LN   +LK LGLDYVDLY +H+P+  K  + 
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSP 121

Query: 123 TDGNVLCIPT-LEDGTVDVDTKE-WNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            +     + T  ED    + T+E    I T+  M++L   G  +++G+SN++   + + L
Sbjct: 122 DERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVADTL 181

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN------------AP 228
           +    ++ P   Q+E HP L Q++L+ +CK   + V AYS FG  +             P
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNTPP 239

Query: 229 LLKEQAIIDMAKKH-GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPEDD 284
           L     I  +A K+  V  SQ+++ W+ QRG  ++ KS   ER++ N  I    TL E+D
Sbjct: 240 LFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAEED 299

Query: 285 FKAIGDLSKVHGEKRVVNMKW----ASFPIFE 312
            + I  L+    +    N  W    + FPIF+
Sbjct: 300 LREISALN----QNLRFNDPWDWNNSKFPIFQ 327

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  152 bits (383), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 140/279 (50%), Gaps = 37/279 (13%)

Query: 11  TLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIK--- 67
           T  L  G  +P+LG G +    N     V  ALK GYRH D A  Y NE EVG  I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 68  ---DSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLG-LDYVDLYLMHWPVPLKTDT 121
               S   R+++F  TKLW ++    EA  A+ + L+++  L Y+DL L+H P       
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPA------ 118

Query: 122 VTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLK 181
                                     + T++ MQE    G  +++GVSN+  ++++EL  
Sbjct: 119 --------------------CGSAKRLATYEAMQESVDAGIVKSIGVSNYERHHLQELYA 158

Query: 182 SPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241
            P+ K  P  NQ+E+ P LP+++L+ +CK  G+ ++AYSP G  +   + +  I  +A +
Sbjct: 159 MPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLATQ 216

Query: 242 HGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTL 280
               P+Q++I+WS+ +GY  L K+ N +R+ SN   + +
Sbjct: 217 KNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNV 255

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  152 bits (384), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 146/276 (52%), Gaps = 36/276 (13%)

Query: 11  TLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI---- 66
           + KL +G +IP +G GT+    +N    V AAL+ GYRH+D A +Y NE EV +      
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 67  -KDSGIAREEIFITTKLWGTE--QRDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTDTV 122
            +   ++RE+IF TTKLW ++      + A+ E ++ +G L Y+DL LMH P+  K   V
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIGGKQ--V 123

Query: 123 TDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKS 182
             G                        TW  MQE    G  R++GVS++   ++++L + 
Sbjct: 124 RRG------------------------TWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEW 159

Query: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
              K  PA NQ+EI P + + +L  +CK KGIVVEAYSP    +   L +  ++ +A++ 
Sbjct: 160 SELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEET 217

Query: 243 GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIF 278
           G  P Q+++ WS+Q GYV L K+    R+  N  +F
Sbjct: 218 GKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVF 253

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  153 bits (386), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/310 (31%), Positives = 161/310 (51%), Gaps = 27/310 (8%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           +A + LN G  +P +G G W+  ++     V  A+K GYR  D AA Y NE+EVG    +
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           A+ +  + R ++FI +KLW T         AL  +L  LGLDY+DLY +H+P+  K    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 123 TDGNVLCIPT-LEDGTV-DVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
            +    C  T  ED  +  +  +   ++ T+  M++L   G T+++GVSN   + ++++L
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL 181

Query: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SANAPL 229
                ++ PA  Q+E HP L Q+ L+ FCK + I V +YS FG           + + P 
Sbjct: 182 MGC--RIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPA 239

Query: 230 LKEQAII-DMAKKHG--VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPED 283
           L +  +I  +A  HG  V  S++++ W+ QR   ++ KS   ER++ N  +    TL E 
Sbjct: 240 LFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTLTEA 299

Query: 284 DFKAIGDLSK 293
           +   I  L+K
Sbjct: 300 ELLEISALNK 309

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  151 bits (382), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 146/275 (53%), Gaps = 37/275 (13%)

Query: 13  KLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD---- 68
           +L  G  IP+L  GT+   ++     V  ALK GYRH D A +Y NE EVG+ I +    
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINE 71

Query: 69  --SGIAREEIFITTKLWGTEQRDPEA--ALNESLKRL-GLDYVDLYLMHWPVPLKTDTVT 123
             +   RE++F TTKLW ++    EA  A+ E ++++ GL Y+D+ L+H P+        
Sbjct: 72  DKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPL-------- 123

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
                             + +   ++TW  MQE    G  +++GVSN+  ++I+ELL   
Sbjct: 124 ------------------SGQRRRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWD 165

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQ+EI P + + EL  +CK   +VVEAY+P   A+   + +  + +++K+ G
Sbjct: 166 ELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPM--AHGYKMNDPGLREISKETG 223

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIF 278
           + P QL+I WS+Q GY+ L K+    R+ SN  ++
Sbjct: 224 MNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  151 bits (382), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 148/288 (51%), Gaps = 33/288 (11%)

Query: 7   NSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI 66
           N     KLN G  IP +GFG +     +    V +ALK GYRHID A +Y N++E  + +
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGV 67

Query: 67  K----DSGIAREEIFITTKLWGTE--QRDPEAALNESLKRLG--LDYVDLYLMHWPVPLK 118
           +    ++G ARE I+ TTKLW ++  + + E AL E    +   + YVDL L+H P    
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGA 127

Query: 119 TDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKE 178
              +    +L     E G+                     K  + +++GVSNF +++++E
Sbjct: 128 KRRLETWAILEQAVQEPGS---------------------KALEIKSIGVSNFGVDHLEE 166

Query: 179 LLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDM 238
           LLK    K+ P  +Q+E+HP LP+ EL  + KEK I  EAYSP        L++  ++ +
Sbjct: 167 LLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPLTQGYR--LQDPELLAL 222

Query: 239 AKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFK 286
             K G+  + +++ WS  +G+VVL KS NPER+  N  +     D +K
Sbjct: 223 EAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVLPSENDSWK 270

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  152 bits (384), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 156/311 (50%), Gaps = 32/311 (10%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P +G G W+   N   + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           AI +  + R+++F+ +KLW           AL ++L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    GT D     +       I T+  +++    G  +++G+SNF  + ++
Sbjct: 122 EEKYP---PGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQ 178

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SA 225
           +LL+    ++ P   Q+E HP L Q+ L+ FCK   I V AYS FG             A
Sbjct: 179 DLLRGC--RIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKA 236

Query: 226 NAPLLKEQAIIDMAKKH-GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLP 281
              L +   I  +++ H G   SQ+++ W+ QRG  V+ KS   ER++ N +I   F+L 
Sbjct: 237 TQTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLT 296

Query: 282 EDDFKAIGDLS 292
           E + K I  L+
Sbjct: 297 EQELKKISALN 307

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  152 bits (384), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 155/306 (50%), Gaps = 30/306 (9%)

Query: 14  LNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIK---DSG 70
           LN G  +P +G G W+  ++     V  A+K GYR  D A  Y NE EVG+ IK   D G
Sbjct: 7   LNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAIDEG 66

Query: 71  -IAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLK----TDTVT 123
            + R ++F+ +KLW +         AL  +L+ LGLDY+DLY +H+P+  K     +   
Sbjct: 67  LVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEEKYP 126

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
            G    +    +G   +   +   + T+  ++E    G  +++G+SNF+   +++LL   
Sbjct: 127 PGFYTGVDDAREGI--LSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLN-- 182

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SANAPLLKE 232
             ++ P   Q+E HP L Q++L+ +CK KGI V AYS FG           + + P L E
Sbjct: 183 GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLLE 242

Query: 233 QAIID--MAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPEDDFKA 287
             II    A      PS++++ W+ QRG  V+ KS   ER++ N  +    TL E++   
Sbjct: 243 HPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEELNE 302

Query: 288 IGDLSK 293
           I  L+K
Sbjct: 303 ISSLNK 308

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  152 bits (383), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 157/311 (50%), Gaps = 32/311 (10%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P +G G W+       + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           AI +  ++R++IF+ +KLW           AL ++L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    G  D     +       I T+  ++E    G  +++GVSNF  + I+
Sbjct: 122 EEKYP---PGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQ 178

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL+    ++ P   Q+E HP L Q+ L+ FCK   I V AYS FG           +  
Sbjct: 179 DLLR--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKT 236

Query: 227 APLLKEQAII-DMAKKH-GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLP 281
            P L E  +I  +++ H G   SQ+++ W+ QRG  V+ KS   ER++ N +I   FTL 
Sbjct: 237 TPTLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLT 296

Query: 282 EDDFKAIGDLS 292
           E + K I  L+
Sbjct: 297 EQELKDISALN 307

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  150 bits (379), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 156/294 (53%), Gaps = 40/294 (13%)

Query: 7   NSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEE----V 62
            +S T  L  G  IP LGFGT+ +        V AA K GYRH+D A +Y NE E    V
Sbjct: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63

Query: 63  GRAIKDS-GIAREEIFITTKLWGTEQRDPEA--ALNESLKRLG-LDYVDLYLMHWPVPLK 118
            + +K+S  ++R+++F TTK+ G      +A  ++ ESL+    L+YVDL+L+H P    
Sbjct: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNP---- 119

Query: 119 TDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKE 178
                     C  T +             + T+  +QE  K GK +A+GVS++SI +++E
Sbjct: 120 ----------CAETEKR------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157

Query: 179 LLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDM 238
           L      ++ P  NQ E++P L + +L+ +CKE+ +V+EA+SP   +      +  +  +
Sbjct: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKR--FSDPVVQKL 215

Query: 239 AKKH--GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288
            K+   G  P+QL+I WS+Q G+V L KSV+ +R  SN     F +  +D K +
Sbjct: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTL 269

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  150 bits (379), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 153/292 (52%), Gaps = 42/292 (14%)

Query: 1   MPATLRNSSAT-----LKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAI 55
           MP+  R  S T      KL++G  +P++G GT+          V  ALK+GYRH+D A +
Sbjct: 1   MPSKARIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVL 60

Query: 56  YLNEEEVGRAIKD------SGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLG-LDYV 106
           Y NE EVG+ I+           R+++F TTKLW ++    + + A+ E ++++  L Y+
Sbjct: 61  YGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYI 120

Query: 107 DLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAV 166
           DL L+H P+                    GT          ++T+  MQE    G  R++
Sbjct: 121 DLLLIHSPL-------------------SGTR-------RRLETYKAMQEAVDEGIVRSI 154

Query: 167 GVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN 226
           GVSN+  ++I ELL     K  P  NQ+EI P + + +L  +CK KG+VVEA+SP    +
Sbjct: 155 GVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--TH 212

Query: 227 APLLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIF 278
              LK   ++ +AK+ G +  +++I WS+Q GYV L KS + ER+  N K +
Sbjct: 213 GYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY 264

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  150 bits (379), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/311 (31%), Positives = 156/311 (50%), Gaps = 32/311 (10%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P +G G W+       + +  A+K GYR  D A  Y NE+EVG    R
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           AI +  +AR+++F+ +KLW           AL ++L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    G  D     +       + T+  ++E    G  +++G+SNF  + ++
Sbjct: 122 EEKYP---PGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQ 178

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL+    ++ P   Q+E HP L Q+ L+ FC+   I V AYS FG           +  
Sbjct: 179 DLLR--GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKT 236

Query: 227 APLLKEQAII-DMAKKH-GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLP 281
            P L E  +I  ++  H G   SQ+++ W+ QRG  V+ KS   ER++ N +I   FTL 
Sbjct: 237 TPTLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLT 296

Query: 282 EDDFKAIGDLS 292
           E + K I  L+
Sbjct: 297 EQELKEISALN 307

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  149 bits (376), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 143/287 (49%), Gaps = 42/287 (14%)

Query: 13  KLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD---- 68
           KL+ G SIP++G GT+   +N   + V  ALK GYRH D A +Y NEEEVG+ I      
Sbjct: 10  KLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLE 69

Query: 69  --SGIAREEIFITTKLWGTEQRDPEA--ALNESLKRL-GLDYVDLYLMHWPVPLKTDTVT 123
                 RE +F TTKLW ++    +A  A+   L ++  L+Y+DL L+H P+        
Sbjct: 70  DPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL-------- 121

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
            G  L                   ++TW  MQE    G  +++GVSN+ +++I ELL   
Sbjct: 122 GGTKL------------------RLETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQ 163

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQ+EI P L + EL  +CK   I VE YSP    +   L +Q +  +A + G
Sbjct: 164 YLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANETG 221

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGD 290
               Q++I WS+Q GY+ L K+    R+ +N  ++     DF    D
Sbjct: 222 KNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVY-----DFNLTSD 263

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  147 bits (371), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 144/279 (51%), Gaps = 40/279 (14%)

Query: 17  GASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD------SG 70
           G  IP+L  G +    +   + V  ALK GYRH D A +Y NE+EVG  I        + 
Sbjct: 12  GIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPAN 71

Query: 71  IAREEIFITTKLWGTEQRDPEA--ALNESLKRLG-LDYVDLYLMHWPVPLKTDTVTDGNV 127
             RE++F TTKLW ++     A   ++E + ++  L Y+DL L+H P+            
Sbjct: 72  NKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPL------------ 119

Query: 128 LCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNKL 187
                         +     ++T+  MQE    G  +++GVSN+   +I+EL K    K 
Sbjct: 120 --------------SGPRRRLETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDKLKH 165

Query: 188 VPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPS 247
            P  NQ+EI P   +++L ++C+ KG++VEA+SP        LKE  ++ +AKK G +  
Sbjct: 166 KPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPLTHGYK--LKEPGLVSLAKKLGRDTG 223

Query: 248 QLIISWSIQRGYVVLAKSVNPERVVSNFKIFTL---PED 283
           Q++I WS+QRG + L K+ NP R+ SN +++     PED
Sbjct: 224 QVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPED 262

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  147 bits (370), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 143/281 (50%), Gaps = 37/281 (13%)

Query: 13  KLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI-----K 67
           KL+ G  IP++  GT+    +     V   +K GYRH D A +Y NE+EVG  I     +
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 68  DSG-IAREEIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTDTVT 123
           D G   REEIF TTKLW ++   +  +AA+ + L  + GL Y+DL L+H P+        
Sbjct: 67  DPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
           +G+ L                   ++TW  MQE    G  +++GVSN+   +I ELL  P
Sbjct: 119 EGSKL------------------RLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWP 160

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQ+EI P + + EL  +CK KG+VVEA++P    +   +    ++ + K+  
Sbjct: 161 ELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCKEVD 218

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDD 284
             P Q++I WS+Q GY+ L K+   +R+  N   +     D
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSD 259

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  146 bits (369), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 104/292 (35%), Positives = 148/292 (50%), Gaps = 44/292 (15%)

Query: 11  TLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKDSG 70
           T KL++   IP +  GT+    +     V  AL  GYRH D A +Y NEEEV + I +  
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 71  I-----AREEIFITTKLWGTE--QRDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTDTV 122
           I      R+EIF TTKLW ++   ++ + A+ E + ++  L Y+DL LMH P+       
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------- 120

Query: 123 TDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKS 182
             G     P + +             +TW  MQE    G  +++GVSNF I ++KEL + 
Sbjct: 121 --GG----PQIRE-------------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQW 161

Query: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSA---NAP-LLKEQAIIDM 238
              K  P  NQ+EI P L + EL  FCK +G+VVEAY+P       N P L+K    ++ 
Sbjct: 162 DGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPLTHGYKINHPDLIKISNELNN 221

Query: 239 AKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288
            K  G    Q++I WS+Q GYV L K+    R+ SN  +  F L ED  K +
Sbjct: 222 TKNTG----QILIRWSLQHGYVPLPKTKTIGRLESNLDVYDFELTEDQMKFL 269

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  147 bits (370), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/311 (30%), Positives = 157/311 (50%), Gaps = 31/311 (9%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           S+   LN G  +P +G G W+  +      V  A+K GYR  D A  Y NE+EVG    R
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           AI +  + R ++FI +KLW T         A+ ++L  LGLDY+DLY +H+P+  K   +
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    G  D     +  ++  ++ T+  M+ L + G  +++GVSN     ++
Sbjct: 122 EEKYP---PGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQ 178

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSA-----------N 226
           ++L     K+ P T Q+E HP L Q  L+ +CK + I+V AYS FG             +
Sbjct: 179 DVLMGC--KIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKED 236

Query: 227 APLLKEQAIID-MAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLPE 282
            P L +  +I  +A K+ V  S++++ W+ Q G  V+ KS   ER++ N  I    TL  
Sbjct: 237 TPNLFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSN 296

Query: 283 DDFKAIGDLSK 293
           ++   I ++++
Sbjct: 297 EELVEISNINR 307

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  146 bits (369), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 95/311 (30%), Positives = 157/311 (50%), Gaps = 32/311 (10%)

Query: 9   SATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P +G G W+  +    + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122
           AI +  + R++IF+T+KLW           AL ++L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
            +      P    G  D     +       I T+  ++     G  +++G+SNF  + ++
Sbjct: 122 EEKYP---PGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQ 178

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL+    ++ P   Q+E HP L Q+ L+ +CK   I V AYS FG           + +
Sbjct: 179 DLLR--GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKS 236

Query: 227 APLLKEQAII-DMAKKH-GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI---FTLP 281
            P L E  ++  +++ H G   SQ+++ W+ QRG  V+ KS   ER++ N +I    TL 
Sbjct: 237 TPTLFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLT 296

Query: 282 EDDFKAIGDLS 292
           + + K I  L+
Sbjct: 297 DQELKEISSLN 307

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  145 bits (365), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 143/275 (52%), Gaps = 37/275 (13%)

Query: 13  KLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD---- 68
           KL++G  +P+LG GT+          V  ALK GYRH+D A +Y NE EVG  ++     
Sbjct: 11  KLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKE 70

Query: 69  --SGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTDTVT 123
                 R ++F TTKLW ++    + + A+ E L ++  L Y+D+ L+H P+        
Sbjct: 71  DPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPL-------- 122

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
                       GT          ++T+  MQE    G  R++GVSN+  ++I ELL   
Sbjct: 123 -----------SGTR-------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWE 164

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQ+EI P + + +L  +CK KG+VVEA+SP    +   +K   ++ +A++ G
Sbjct: 165 ELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAEEVG 222

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIF 278
               Q++I WS+Q GYV L KS + ER+  N +++
Sbjct: 223 RNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVY 257

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/291 (31%), Positives = 151/291 (51%), Gaps = 40/291 (13%)

Query: 10  ATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI--- 66
            T  L  G  +P LG G +++      + V  ALK GYR +D+A +Y NE E    I   
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 67  --KDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTDT 121
             +   ++R +IF TTK+   +Q     + ++ ESL R+  LDY+DL+L+H P+      
Sbjct: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL------ 120

Query: 122 VTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLK 181
                               T +   + TW   QE  +TGK +A+GVSN+ I +++E+ +
Sbjct: 121 --------------------TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160

Query: 182 SPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241
               K+ P  NQ E++P L + EL  +C +KG+V++AYSP   A    L++  ++ + + 
Sbjct: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR--LQDPELVKLVED 218

Query: 242 HGVEPS--QLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288
              E +  Q++++WS+Q G+V L K+V+ +R+  N K   F L   D K +
Sbjct: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  141 bits (356), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 140/281 (49%), Gaps = 37/281 (13%)

Query: 13  KLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD---- 68
           KL+ G  IP++  GT+    +     V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNE 66

Query: 69  --SGIAREEIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTDTVT 123
                 R +IF TTKLW ++   R  +AA+ + L  + GL+Y+DL L+H P+        
Sbjct: 67  DPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
           +G+ L                   ++TW  MQE    G  +++GVSN+   +I ELL   
Sbjct: 119 EGSKL------------------RLETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWS 160

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             +  P  NQ+EI P + + EL  +CK KG++VEA++P    +   +    ++ + K+  
Sbjct: 161 ELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCKEVD 218

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDD 284
             P Q++I WS+Q GY+ L K+   +R+  N   ++    D
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSD 259

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  141 bits (356), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 144/286 (50%), Gaps = 39/286 (13%)

Query: 14  LNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD----- 68
           L+ G  IP+L  GT+    +   + V  ALK GYRH D A +Y NE +VG  I       
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQED 68

Query: 69  -SGIAREEIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTDTVTD 124
                RE++F TTKLW ++   +  + A+ E L+++  L Y+DL L+H P+         
Sbjct: 69  PKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPL--------- 119

Query: 125 GNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPS 184
                            +     ++T+  MQE    G  +++GVSN+  ++++ELL    
Sbjct: 120 -----------------SGSRKRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEG 162

Query: 185 NKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGV 244
            K  P  NQ+EI P   + EL  +C+ +GIVVE Y+P    +   LK+  ++ +A++ G 
Sbjct: 163 LKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAEEVGK 220

Query: 245 EPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288
              Q++I WS+Q GY+ L K+ N +R+  N  +  F L E   KA 
Sbjct: 221 NTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAF 266

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  140 bits (352), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 138/278 (49%), Gaps = 45/278 (16%)

Query: 14  LNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI------K 67
           L+ G  IP++  GT+    +     V   +K GYRH D A +Y NE+EVG  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 68  DSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTDTVTD 124
                RE+IF TTKLW ++   +  +AA+ + L  + GL Y+DL L+H P+        +
Sbjct: 68  PESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL--------E 119

Query: 125 GNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPS 184
           G+ L                   ++TW  MQE    G  +++GVSN+   +I ELL  P 
Sbjct: 120 GSKL------------------RLETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPD 161

Query: 185 NKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSP----FGSANAPLLKEQAIIDMAK 240
               P  NQ+EI P + + EL  +CK KG++VEA++P    +   N  LLK      + K
Sbjct: 162 LTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPLCHGYKMTNPDLLK------VCK 215

Query: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIF 278
           +    P Q++I WS+Q GY+ L K+   +R+  N   +
Sbjct: 216 EVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAY 253

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  139 bits (350), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 88/287 (30%), Positives = 142/287 (49%), Gaps = 39/287 (13%)

Query: 13  KLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD---- 68
           K + G  +P++  GT+    +     V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHE 66

Query: 69  --SGIAREEIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTDTVT 123
                 RE++F TTKLW ++   +  + A+ + L  + GL Y+DL L+H P+        
Sbjct: 67  DPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
           +G+ L                   ++TW  MQE    G  +++GVSN+   ++ ELL   
Sbjct: 119 EGSKL------------------RLETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWS 160

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQ+EI P + + EL  +CK K +VVEA++P    +   + +  ++ + K+  
Sbjct: 161 QLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCKEVD 218

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288
             P Q++I WS+Q GY+ L K+   +R+ SN     F L +D  K +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDDQMKIL 265

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  139 bits (349), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 161/316 (50%), Gaps = 59/316 (18%)

Query: 14  LNTGASIPAL---GFGT--WRSVDNNGYHS------VIAALKT--GYRHIDAAAIYLNEE 60
           L+ G  IPA+   G GT  ++S + +   S      V   L T  G  HIDAA IY    
Sbjct: 9   LSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTYP 68

Query: 61  EVGRAIKDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           E+G A+KD+   R+EIFIT K    +Q   +P+ AL  SLK+LG+DYVDLYL+H P+   
Sbjct: 69  ELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPI--- 125

Query: 119 TDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKE 178
                         +++  +DV+         W  ++EL K+GK + +GVSNF++ ++++
Sbjct: 126 --------------IKESKLDVEA-------NWKYLEELYKSGKAKNIGVSNFAVKDLEK 164

Query: 179 LLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKE---- 232
           LL     K  P  NQ+E  P L      ++ F ++ GI++EAYSP G    PL +     
Sbjct: 165 LLAVAEVK--PQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLG----PLQRRPEDA 218

Query: 233 ------QAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDD 284
                 Q I +++KK+    +Q+++SW  +RG + +  S   ER+     I  F+L  ++
Sbjct: 219 DKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEE 278

Query: 285 FKAIGDLSKVHGEKRV 300
            + I  L   H   R+
Sbjct: 279 VQKITQLGLQHPALRL 294

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  137 bits (345), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 137/276 (49%), Gaps = 37/276 (13%)

Query: 14  LNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKD----- 68
            N G  IP++  GT+    +     V  ALK GYRH D A +Y NE +VG  I       
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69

Query: 69  -SGIAREEIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTDTVTD 124
                R ++F TTKLW ++      + A+ E L ++ GL Y+D+ L+H P+  +T     
Sbjct: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKR--- 126

Query: 125 GNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPS 184
                                  ++TW  MQE  ++G  + +GVSN+   +++ELL+   
Sbjct: 127 -----------------------LETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163

Query: 185 NKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGV 244
             + P  NQ+EI P + + EL  +CK  G+VVEA++P    +   L +  ++ ++K+ G 
Sbjct: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGR 221

Query: 245 EPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTL 280
              Q++I WS+Q GY+ L K+   +R+  N + +  
Sbjct: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNF 257

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  137 bits (346), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 149/312 (47%), Gaps = 56/312 (17%)

Query: 12  LKLNTGASIPAL---GFGT-WRSV---DNNGYHSVIAALKT-----GYRHIDAAAIYLNE 59
            KLN G  +P +   G GT W  V   D N   +++  LK      G  H+DAA  Y+  
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 60  EEVGRAIKDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWPVPL 117
            EVGRA+ ++   R+EIFIT K W   +   +P   L   LKRLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPF-- 124

Query: 118 KTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIK 177
                               +  +T  ++  + W +M+EL  +GK + +GVSNF+  +++
Sbjct: 125 --------------------ISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLE 164

Query: 178 ELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA- 234
            +LK    K+ P  NQ+E +  L      +  FCK+  I + AYSP G    PL K+ A 
Sbjct: 165 RVLKVC--KVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPAD 218

Query: 235 ---------IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFT--LPED 283
                    I  +A+ +   P Q+++ W  +RG V +  S   ER+    +IF   L +D
Sbjct: 219 GNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDD 278

Query: 284 DFKAIGDLSKVH 295
           +   I  L   H
Sbjct: 279 EVTEITKLGLDH 290

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  136 bits (343), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/275 (31%), Positives = 139/275 (50%), Gaps = 38/275 (13%)

Query: 13  KLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI-----K 67
           +L+ G  IP++G G ++  +      V  AL+ GYR  D+A  Y NE+ V R I      
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 68  DSGIAREEIFITTKLWGTEQRDPEA---ALNESLKRLG-LDYVDLYLMHWPVPLKTDTVT 123
             G  RE+++ TTK+  T+    EA   +L +SL   G L Y+DL L+H P+  +T    
Sbjct: 74  APGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRT---- 128

Query: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183
                                   + TW  ++E    G+ R++GVSN+   ++ ELL   
Sbjct: 129 ----------------------RRLGTWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWE 166

Query: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K+ P  NQVEI+P L + EL+ +C+E  I V+A+SP        L +  +  +A ++ 
Sbjct: 167 GLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYD 224

Query: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIF 278
              +Q+++ WSIQ G++VL K+   ER+  NF I+
Sbjct: 225 KGVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIW 259

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  135 bits (339), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 154/312 (49%), Gaps = 57/312 (18%)

Query: 11  TLKL-NTGASIPALGFGT---WRSVDNNGYH----------SVIAALKTGYRHIDAAAIY 56
           TL+L  +G  IP +GFG+   WR    +G             V +A+  G+ HIDAA  Y
Sbjct: 7   TLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAY 66

Query: 57  LNEEEVGRAIKDSGIAREEIFITTKL--WGTEQRD---PEAALNESLKRLGLDYVDLYLM 111
               EVGR +K+SG+ R++++IT K   W  + R    P  +L+ SL+++ + YVDLYL+
Sbjct: 67  KTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLL 126

Query: 112 HWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNF 171
           H                 +P +   T  +D KE      W  M+E+   G  + +GVSNF
Sbjct: 127 H-----------------VPFITVQTAGIDLKE-----AWRQMEEIYDRGLAKNIGVSNF 164

Query: 172 SINNIKELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPL 229
            + +++ + K    K +P  NQ+E +  L Q    +IA+CK+  IVVE YSP      PL
Sbjct: 165 DVESLEYITK--IGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPL----VPL 218

Query: 230 LK------EQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLP 281
            K      ++ +  +A+K+     Q+++ W  Q G VV+  S    RV  +  I  F L 
Sbjct: 219 TKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELT 278

Query: 282 EDDFKAIGDLSK 293
            +DF +I  + +
Sbjct: 279 AEDFDSITKIGR 290

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 148/310 (47%), Gaps = 57/310 (18%)

Query: 15  NTGASIPALGFGT---WRSVDNNG----------YHSVIAALKTGYRHIDAAAIYLNEEE 61
            T   IP LGFGT   WR     G             ++ A+  G+ HID A  YL  EE
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGRAIKDSGIAREEIFITTKL----W-GTEQRDPEAALNESLKRLGLDYVDLYLMHWPVP 116
           VG A++ S + R+++FIT K     W G +   P  A  + L+ LG+ Y DLY++H P  
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRPDI 132

Query: 117 LKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNI 176
            K               E+  +D+        + W  ++EL + G  +A+GVSNF +  +
Sbjct: 133 TK---------------ENAGIDLQ-------EAWRQVEELYEAGIAKAIGVSNFPLETL 170

Query: 177 KELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLK--- 231
           K++      + +P  +QVE HP L      ++ +C+ K IVVEAYSP     APL +   
Sbjct: 171 KQM--ESYCRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APLFRARP 224

Query: 232 ---EQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFK 286
              +  + ++ KK+G   +Q+++ W I RG V L  S   ER+        F L + D +
Sbjct: 225 GPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVE 284

Query: 287 AIGDL-SKVH 295
            I ++ SK H
Sbjct: 285 LINEVGSKKH 294

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  134 bits (336), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 105/324 (32%), Positives = 157/324 (48%), Gaps = 60/324 (18%)

Query: 14  LNTGASIPALGF-----------GTWRSVDNNGYHSVIAALKT-GYRHIDAAAIYLNEEE 61
           LN G  IP++             G+  +  +     +  AL   G  HIDAA  Y    E
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 62  VGRAIKDSGIAREEIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           + +A+K+S   R EIFIT K + T+ +   DP   LN  LK LGLDYVDLYL+H P    
Sbjct: 70  LAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSPF--- 125

Query: 119 TDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKE 178
            D    G++    TLE              K W  M+ L K GK +++GVSNFS+ NI+E
Sbjct: 126 FDPEFKGSL----TLE--------------KVWKDMETLYKEGKAKSIGVSNFSVKNIEE 167

Query: 179 LLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKE---- 232
           +LK    K  P  NQ+E +  L      ++ +C++  I +EAYSP G    PL K     
Sbjct: 168 ILKIAGIK--PQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPENS 221

Query: 233 ------QAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVV--SNFKIFTLPEDD 284
                   I ++A K+G   SQ++++W   RG + +  S   +R++   N   F L +D+
Sbjct: 222 NELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDE 281

Query: 285 FKAIGDLSKVHGEKRVVNMKWASF 308
              +  L+K+  E+  + + W +F
Sbjct: 282 ---VDTLTKLGLEQPALRIYWTNF 302

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  132 bits (333), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 152/303 (50%), Gaps = 53/303 (17%)

Query: 14  LNTGASIPAL---GFGT-W---RSVDNNGYHSVIAALKT-----GYRHIDAAAIYLNEEE 61
           LN G  IPA+   G GT W      D      ++  LK      G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGIAREEIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           V  A+++S   R+EIFIT K + T+ +   DP A LN SLK LGLDYVDLYL+H P    
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF--- 125

Query: 119 TDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKE 178
              + +G+     TLE+               W  M++L K+GK + +GVSNF + ++++
Sbjct: 126 ---IKNGS-----TLEE--------------CWKQMEKLYKSGKAKNIGVSNFRVEDLEK 163

Query: 179 LLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGS----ANAPLLKE 232
           +LK  + K  P  NQ+E +  L      ++ FCKE  I +EAY+P G      + P  K 
Sbjct: 164 ILKIATIK--PQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKP 221

Query: 233 --QAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERV--VSNFKIFTLPEDDFKAI 288
               I +++KK+    +Q+++ W  +RG + +  S  P+R+    N   F L   +   I
Sbjct: 222 FYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDKI 281

Query: 289 GDL 291
            +L
Sbjct: 282 TEL 284

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  130 bits (327), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 106/326 (32%), Positives = 151/326 (46%), Gaps = 65/326 (19%)

Query: 8   SSATLKLNTGASIPAL---GFGT-WRS------------VDNNGYHSVIAALKTGYRHID 51
           S     LN G  IPA+   G GT W              VD   Y    A    G  HID
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQY----ALTLPGIIHID 59

Query: 52  AAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDL 108
           AA +Y    EV +A+K +   R+EIFIT K +    +   +P A L +SLK L LDYVDL
Sbjct: 60  AAEMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDL 119

Query: 109 YLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGV 168
           YL+H P   K          C  T+E+               W  M++L K GK + +GV
Sbjct: 120 YLLHSPFITKES--------CGYTMEEA--------------WKQMEKLYKDGKAKNIGV 157

Query: 169 SNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSAN 226
           SNFS++++K +LK    K  P  NQ+E +  L      ++ FC++  I+VEAYSP G   
Sbjct: 158 SNFSVDDLKRILKICEIK--PQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLG--- 212

Query: 227 APLLKE----------QAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERV--VSN 274
            PL K+          Q I ++AKK+G    Q+++ W  +R  + +  S   ER+    +
Sbjct: 213 -PLRKKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQD 271

Query: 275 FKIFTLPEDDFKAIGDLSKVHGEKRV 300
              F L  ++ + I  L   H   R+
Sbjct: 272 LFSFDLTSEEVEKITKLGLAHEPSRL 297

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  130 bits (326), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 102/316 (32%), Positives = 161/316 (50%), Gaps = 58/316 (18%)

Query: 14  LNTGASIPAL---GFGT--WRSVDNNGYHS------VIAALKT-GYRHIDAAAIYLNEEE 61
           LN G  IPA+   G GT  +++V+ +   S      ++ AL+  G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGIAREEIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           VG+A+  +   R+EIF+T K + T+ +    P A L  SLK++G DYVDLYL+H P   K
Sbjct: 70  VGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPFVSK 128

Query: 119 TDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKE 178
                + N     TLE+               W  M++L K GK + +GVSNF++ ++++
Sbjct: 129 -----EANGF---TLEEA--------------WKDMEQLYKAGKAKNIGVSNFAVKDLEK 166

Query: 179 LLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA-- 234
           +LK    K  P  NQ+E  P L      +  FC++  I++EAYSP     APL K+ A  
Sbjct: 167 ILKIAEVK--PQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPL----APLQKKTAQD 220

Query: 235 --------IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERV--VSNFKIFTLPEDD 284
                   + ++++K+    +Q+I+ W  +RG + +  S  P+R+    N   F L +++
Sbjct: 221 DSKPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEE 280

Query: 285 FKAIGDLSKVHGEKRV 300
              I +L   H   R+
Sbjct: 281 VDEITELGLAHEPLRL 296

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  129 bits (323), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/314 (29%), Positives = 154/314 (49%), Gaps = 50/314 (15%)

Query: 12  LKLNTGASIPAL---GFGT-WR-------SVDNNGYHSVIAALKT-GYRHIDAAAIYLNE 59
           + LN G  IPA+   G GT W        +  N+    ++ ALK  G  HIDAA IY   
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  EEVGRAIKDSGIAREEIFITTKLWGTE---QRDPEAALNESLKRLGLDYVDLYLMHWPVP 116
            EVG+A+  +   R EIF+T K + T+      P   L+ +LK++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPF- 125

Query: 117 LKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNI 176
                                V  +T  +   + W  M++L ++GK + +GVSNF++ ++
Sbjct: 126 ---------------------VSKETNGFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDL 164

Query: 177 KELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA 234
           + +LK    ++ P  NQ+E  P L      +  FC+E  I++EAYSP G       K+++
Sbjct: 165 ERILKVA--EIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDES 222

Query: 235 ------IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERV--VSNFKIFTLPEDDFK 286
                 + ++++K+    +Q+ + W  +RG + +  S  P+R+    N   F L +++  
Sbjct: 223 LPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVN 282

Query: 287 AIGDLSKVHGEKRV 300
            I +L   H   R+
Sbjct: 283 QITELGLEHEPLRL 296

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  128 bits (322), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/307 (29%), Positives = 146/307 (47%), Gaps = 56/307 (18%)

Query: 15  NTGASIPALGFGT---WRSVDNNGYH----------SVIAALKTGYRHIDAAAIYLNEEE 61
            +G  +P +GFG+   WR     G             V  A+K G+ HIDAA  Y    E
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  VGRAIKDSGIAREEIFITTKL--WG---TEQRDPEAALNESLKRLGLDYVDLYLMHWPVP 116
           VG  I +SG+ RE++++T K   W     + + P  +L  SL ++ + YVDLYL+H    
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVH---- 127

Query: 117 LKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNI 176
                        +P +   T  +D KE      W  M+E+   G  + +GVSNF + ++
Sbjct: 128 -------------VPFINPETAGIDLKE-----AWRQMEEIYDRGWAKNIGVSNFDVESL 169

Query: 177 KELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLK--- 231
            E +++   K  P  NQ+E    + Q    +I++CK+ GI +E YSP      PL K   
Sbjct: 170 -EYIRT-IGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPL----VPLTKGKP 223

Query: 232 ---EQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFK 286
              +  +  MAKK+G    Q+++ W +Q G + +  S   +R+  +  I  F L  +DF 
Sbjct: 224 GPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFT 283

Query: 287 AIGDLSK 293
           +I ++ K
Sbjct: 284 SITEVGK 290

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  127 bits (320), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 156/326 (47%), Gaps = 57/326 (17%)

Query: 11  TLKLNTGASIPALGFGT---WRSVDNNG----------YHSVIAALKTGYRHIDAAAIYL 57
           TLK  +G  +P++GFG+   WR   ++G             V  A++ G+ HID A  Y 
Sbjct: 10  TLK-GSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYK 68

Query: 58  NEEEVGRAIKDSGIAREEIFITTKL--WGTEQRD---PEAALNESLKRLGLDYVDLYLMH 112
             +EVG  I ++ + RE ++IT K   W  E R    P  +L  SLK + LDYVDLY++H
Sbjct: 69  TYKEVGTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIH 128

Query: 113 WPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFS 172
                            +P +   T  +D KE      W  M+E+      R +GVSNF 
Sbjct: 129 -----------------VPNITTKTAGIDLKE-----AWLQMEEIYTRKMARNIGVSNFD 166

Query: 173 INNIKELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLL 230
           + ++ E +KS + K  P  NQ+E    + Q    ++ +C+E  IVVE YSP      PL 
Sbjct: 167 VESL-EYIKSFA-KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPL----VPLT 220

Query: 231 K------EQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPE 282
           K      ++ +  +A K+G    Q+++ W  Q G VV+  +   ER+  +  I  F L +
Sbjct: 221 KGKPGPLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSK 280

Query: 283 DDFKAIGDLSKVHGEKRVVNMKWASF 308
           +DF  I ++ +    +  ++M +  +
Sbjct: 281 EDFDQITNVGREKILRNYMHMLYEKY 306

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  123 bits (309), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 97/315 (30%), Positives = 149/315 (47%), Gaps = 56/315 (17%)

Query: 14  LNTGASIPAL---GFGT-WR-------SVDNNGYHSVIAALKT-GYRHIDAAAIYLNEEE 61
           LN G  IPA+   G GT W        +  N+    ++ ALK  G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGIAREEIFITTKLWGTEQRD--PEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
           VG+A+  +   R  IF+T K     +    P   L+ +LK++G DYVDLYL+H P     
Sbjct: 70  VGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPF---- 125

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
                             V  +    +  + W  M++L K+GK + +GVSNF++ +++ +
Sbjct: 126 ------------------VSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRI 167

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA--- 234
           LK    K  P  NQ+E  P L      +  FC+E  I+VEAYSP G    PL K+ A   
Sbjct: 168 LKVAEVK--PQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLG----PLQKKTAQDD 221

Query: 235 -------IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERV--VSNFKIFTLPEDDF 285
                  + ++++K+    +Q+I+ W  +RG + +  S  P+R+    N   F L  ++ 
Sbjct: 222 SQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEV 281

Query: 286 KAIGDLSKVHGEKRV 300
             I +L   H   R+
Sbjct: 282 DKITELGLEHEPLRL 296

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  120 bits (302), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 143/302 (47%), Gaps = 46/302 (15%)

Query: 5   LRNSSATLKLNTGASIPA---LGFGT-W---RSVDNNGYHSVIAALK-----TGYRHIDA 52
           + ++ A + LN G  +PA   +G GT W   +  D+   H +I  L+      G  HIDA
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 53  AAIYLNEEEVGRAIKDSGIAREEIFITTK--LWGTEQRDPEAALNESLKRLGLDYVDLYL 110
           A +Y    E+  A++ +   R EIFIT K  L     +DP A L +SLK   LDYVDLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 111 MHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSN 170
           +H P   K             TLE                W  M++L K GK + +GVSN
Sbjct: 121 LHSPFVAKEKPGL--------TLEGA--------------WRQMEQLYKDGKAKNIGVSN 158

Query: 171 FSINNIKELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAP 228
           FS+ ++K +L     K  P  NQ+E HP L      ++ FC+++ I +EA++P G     
Sbjct: 159 FSVEDLKRVLSVAEIK--PQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVK 216

Query: 229 LLKEQ------AIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPE 282
             +++       I  ++ K+    +Q+I+ W  +RG + +  S   +R+     +F    
Sbjct: 217 TQEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDL 276

Query: 283 DD 284
           +D
Sbjct: 277 ED 278

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  119 bits (297), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 138/277 (49%), Gaps = 45/277 (16%)

Query: 46  GYRHIDAAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLGL 103
           G  H+DAA  Y    E+ +A+K+S   R EIFIT K     +   +P  ALN +L  LGL
Sbjct: 53  GIVHVDAAEYYRTYPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGL 112

Query: 104 DYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKT 163
           DYVDLY++H+P                        D + K+ +    W  M+ L K GK 
Sbjct: 113 DYVDLYVLHFP----------------------EFDPEYKDLSIETAW--MELLYKEGKA 148

Query: 164 RAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSP 221
           + +GVSNFSI +++ ++K    K  P  NQ+E +  L      ++ +C++ G  +EAYSP
Sbjct: 149 KNIGVSNFSIEHLERVMKIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSP 206

Query: 222 FGSANAPLLKE----------QAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERV 271
                APL ++          + I +++ K+G   S++++ W  +RG V +  S   ER+
Sbjct: 207 L----APLQRKPKNFNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERI 262

Query: 272 VSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNMKWASF 308
           V+   +F+    D + +  ++K+  E+  + + W  F
Sbjct: 263 VNAQNLFSFDLTD-EEVDKITKLGLEQPALRLYWNEF 298

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  118 bits (295), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 141/292 (48%), Gaps = 52/292 (17%)

Query: 14  LNTGASIPA---LGFGT-WRSVDNNG-------YHSVIAALKT-GYRHIDAAAIYLNEEE 61
           LN G  IPA   +G GT W   + N           V  AL   G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGIAREEIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           +G+A++++   R EI+IT K + T  +   +P       LK LG+DY+DLYL+H P    
Sbjct: 70  LGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSPF--- 125

Query: 119 TDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKE 178
              +T+G      TLE              + W  ++EL K+GK + +GVSNF+  +++ 
Sbjct: 126 ---ITEGRNGF--TLE--------------QAWKYLEELYKSGKAKNIGVSNFAKEDLER 166

Query: 179 LLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFG--------SANAP 228
           +LK    K  P  NQ+E    L      +  F KE  I++EAYSP G        + + P
Sbjct: 167 ILKIAEIK--PQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSLP 224

Query: 229 LLKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTL 280
             K   I ++A+K+G   +Q+++ W  +RG + +  S  P RV     IFT 
Sbjct: 225 FYK--YINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTF 274

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  117 bits (294), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 92/311 (29%), Positives = 144/311 (46%), Gaps = 48/311 (15%)

Query: 14  LNTGASIPA---LGFGT-W---RSVDNNGYHSVIAALKT-----GYRHIDAAAIYLNEEE 61
           LN G  IPA   +G GT W      D N  H+++  ++      G  H+D A +Y    E
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 62  VGRAIKDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
              A+K++   R EIF+T K    E+   DP   L+  LKR GL+YVDLYL+H P   K 
Sbjct: 70  FSEALKNTKKPRNEIFVTDKYSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFASK- 128

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
               + N   I                  + W  ++EL   GK + +GVSNF + +++++
Sbjct: 129 ----EKNGFTIE-----------------EAWAQLEELYHEGKAKNIGVSNFRVEDLEKI 167

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA--- 234
           LK    K+ P  NQ+E    L      ++ F ++  I +EAY+P G  +     EQA   
Sbjct: 168 LKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKPF 225

Query: 235 ---IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERV--VSNFKIFTLPEDDFKAIG 289
              I  + +K+    +Q+++ W  +RG + +  S  P+R+    N   F L +D+   I 
Sbjct: 226 YDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEIT 285

Query: 290 DLSKVHGEKRV 300
            L   H   R+
Sbjct: 286 KLGLAHPALRL 296

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  117 bits (293), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 136/274 (49%), Gaps = 48/274 (17%)

Query: 46  GYRHIDAAAIYLNEEEVGRAIKDSGIA--REEIFITTKLWGTEQR---DPEAALNESLKR 100
           G  HIDAA +Y    EVG+A+++S     R+EIFIT K + T+ +   +P   L   LK+
Sbjct: 55  GIVHIDAAEVYRTYPEVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKK 113

Query: 101 LGLDYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKT 160
           LGLDYVDLYL+H P                       +  +   +   + W  M++L K 
Sbjct: 114 LGLDYVDLYLLHSPF----------------------ISKEKNGFTMEEAWKYMEDLYKA 151

Query: 161 GKTRAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEA 218
           GK + +GVSNFS+ +++ +LKS   K  P  NQ+E +  L      ++ FC+E  I V A
Sbjct: 152 GKVKNIGVSNFSMADLQRILKSCEVK--PQVNQIEFNAFLQNQTPGIVNFCRENDIQVVA 209

Query: 219 YSPFGSANAPLLKE----------QAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNP 268
           Y+P G    PL ++          + +  +A+K+    +Q+++ W  +RG + +  S   
Sbjct: 210 YTPLG----PLQRKSKNFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKE 265

Query: 269 ERVVSNFKIFT--LPEDDFKAIGDLSKVHGEKRV 300
           +R+     +FT  L + + + I  L   H  +R+
Sbjct: 266 KRIKDAQYLFTFDLTDSEVEKITQLGLKHEPQRM 299

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  117 bits (292), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 150/312 (48%), Gaps = 44/312 (14%)

Query: 8   SSATLKLNTGASIPAL---GFGT-WRSVDNNGYHS------VIAALKT-GYRHIDAAAIY 56
            ++ + LN G  IP +   G GT W   +    +S      +  AL+  G  HID A +Y
Sbjct: 4   QTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMY 63

Query: 57  LNEEEVGRAIKDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWP 114
               EVG A+++S   R+EIFIT K     +   +P+  L  +L+++GL+YVDLYL+H+P
Sbjct: 64  QTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFP 123

Query: 115 VPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSIN 174
           +               P L D T++         + W +M++L   G  + +GVSNF + 
Sbjct: 124 I-------------IDPKLYDFTLE---------EAWKMMEDLYNEGLAKNIGVSNFRVE 161

Query: 175 NIKELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYS---PFGSANAPL 229
           ++++L KS   K  P  NQ+E +  L      +  +C +  I +EA+    P    N   
Sbjct: 162 DLEQLSKSWVIK--PQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKD 219

Query: 230 LKEQAIIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFT--LPEDDFKA 287
           L    +  +A+K+    +Q+++ W  QR  + +  S  PERV   + IF+  L +D+ + 
Sbjct: 220 LLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEVEF 279

Query: 288 IGDLSKVHGEKR 299
           I  L   H   R
Sbjct: 280 ITKLGSQHDTIR 291

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  117 bits (293), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 90/313 (28%), Positives = 155/313 (49%), Gaps = 54/313 (17%)

Query: 14  LNTGASIPAL---GFGT-W---RSVDNNGYHSVIAALKT-----GYRHIDAAAIYLNEEE 61
           LN G  IPA+   G GT W      ++N    ++  +K      G  H+DAA  Y   +E
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQE 88

Query: 62  VGRAIKDSGIAREEIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKT 119
           +G+A+++S   R+EIFIT K   T +            +K++G+DYVDLYL+H P+  K 
Sbjct: 89  LGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPLIEKE 148

Query: 120 DTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKEL 179
                       TLE+               W  +++L + GK + +GVSNF + +++ +
Sbjct: 149 KNGV--------TLEE--------------VWKDLEKLYEAGKAKNIGVSNFRVEDLQRI 186

Query: 180 LKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA--- 234
           LK    K+ P  NQ+E H  L      ++ F ++  I +EAY+P G    PL ++Q+   
Sbjct: 187 LKVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLG----PLQRKQSDAG 240

Query: 235 -----IIDMAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFT--LPEDDFKA 287
                + ++AKK+G   +Q+++ W  +R  + +  S  P+R+ +   +F+  L +++ K 
Sbjct: 241 DFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKK 300

Query: 288 IGDLSKVHGEKRV 300
           I +L   H   R+
Sbjct: 301 ITELGLKHKPLRL 313

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score = 96.3 bits (238), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 89/311 (28%), Positives = 136/311 (43%), Gaps = 52/311 (16%)

Query: 14  LNTGASIPAL---GFGT-WRSVD--NNGYHSVIAALKT-----GYRHIDAAAIYLNEEEV 62
           LN G SIPA+   G G  W  +    +G  +++  LK      G+ HI  A  Y N   +
Sbjct: 11  LNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNGLL 70

Query: 63  GRAIKDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120
             A+K S   R EI+IT K     +    P  AL  SL RLG DYVDLYL+H P      
Sbjct: 71  SAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNP------ 124

Query: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180
                   C+ +  +G         +  K W  M+ L KTGK + +GVSNF I +++ L 
Sbjct: 125 --------CLDSSPNGI--------SLEKAWKQMELLYKTGKVKNIGVSNFRIEDLERLK 168

Query: 181 KSPSNKLVPATNQVEIHPLLPQD--ELIAFCKEKGIVVEAYSPF--------GSANAPLL 230
            +   ++ P  N++E H  L      +  + K   +++  YSP            + P  
Sbjct: 169 DA---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPFY 225

Query: 231 KEQAIIDMAKKHGVEPSQLIISWSIQRGY--VVLAKSVNPERVVSNFKIFTLPEDDFKAI 288
           +   II +A+K+    +Q+++ W    G   V+    V   +  S+   F L  ++   I
Sbjct: 226 R--YIIGLAEKYNKTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELDMI 283

Query: 289 GDLSKVHGEKR 299
            +L K H   R
Sbjct: 284 TELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 71.2 bits (173), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 55/96 (57%), Gaps = 6/96 (6%)

Query: 7   NSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI 66
           N     KLN G  IP +GFG +     +    V +ALK GYRHID A +Y N++E  + +
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGV 67

Query: 67  K----DSGIAREEIFITTKLWGTE--QRDPEAALNE 96
           +    ++G ARE I+ TTKLW ++  + + + AL E
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQFGREETKKALQE 103

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 85/204 (41%), Gaps = 40/204 (19%)

Query: 27  TWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTE 86
           T+  + N   + ++  LK G + ID A IY + E   +AI +  +  +   I TK  G  
Sbjct: 9   TFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLP-DRFTIHTKASGFS 64

Query: 87  ----QRDP-EAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVD 141
                RD    ++ ESL  LG+  V+ +L+H P P             IP  E       
Sbjct: 65  GGCLTRDNINKSIEESLSLLGVPSVETFLLHSPDP------------EIPLEE------- 105

Query: 142 TKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNK--LVPATNQVEIHPL 199
                   T D +  L + GK    G+SNFS  ++K +     +K  ++P   Q   + L
Sbjct: 106 --------TLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNAL 157

Query: 200 LPQ--DELIAFCKEKGIVVEAYSP 221
                ++L    KE  I + AYSP
Sbjct: 158 SRAIVNDLFPLLKELHISLYAYSP 181

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 81/194 (41%), Gaps = 41/194 (21%)

Query: 46  GYRHIDAAAIYLNE-EEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAAL----NESLKR 100
           G   I A+ IY     EVG A+  +   + EIF+T K   + Q +  A L    + +LK+
Sbjct: 5   GVIDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDK--SSTQTEVSATLAMRPDMALKK 62

Query: 101 LGLDYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQ--ELP 158
           + ++YVD++ +H P                            K+ N +   D M    L 
Sbjct: 63  ISVEYVDMHFLHSPFVF-------------------------KQANVLNLKDAMHTDHLR 97

Query: 159 KTGKTRAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDE--LIAFCKEKGIVV 216
           ++ K    G S+ ++  ++ +LK+   +  P  NQ+++   L      +   C+E  I++
Sbjct: 98  RSNKANNRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILM 155

Query: 217 EAYS---PFGSANA 227
             YS   P    NA
Sbjct: 156 AVYSTLDPLQRKNA 169

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 95/216 (43%), Gaps = 43/216 (19%)

Query: 18  ASIPALGFGTW--RSVDNNGYHSVIAALK-TGYRHIDAAAIYLNEEEVGRAIKDSGIARE 74
           A +P + +G +   ++  + +  + + L+  G    D A IY   E   ++I D GIA +
Sbjct: 2   AELPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSE---KSIGDLGIA-D 57

Query: 75  EIFITTKLWGTEQ----RDP-EAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVLC 129
           ++ I TK    E+    RD    ++ +S   L +D V++Y +H P P+            
Sbjct: 58  DLVIDTKARSFEEGALTRDGIFESIKQSFDELKVDSVEIYYLHAPDPI------------ 105

Query: 130 IPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLK--SPSNKL 187
            P  E               T D + EL K GK +  G+SN++ +++K++ +     N +
Sbjct: 106 TPIEE---------------TIDAINELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKNYV 150

Query: 188 VPATNQVEIHPLLP--QDELIAFCKEKGIVVEAYSP 221
           +P   Q   +      + +L    ++ GI   AYSP
Sbjct: 151 LPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYSP 186

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 113/290 (38%), Gaps = 48/290 (16%)

Query: 46  GYRHIDAAAIY---LNEEEVGRAIKDSGIAREEIFITTKLWG--TEQRDPEAALNESLKR 100
           G R  D A +Y   L+E  +G  +K   I RE + I TK++    E  D     N + +R
Sbjct: 53  GLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIFYPVDETLDLHHG-NSTNER 111

Query: 101 LGLDYVD---LYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL 157
             LD V+   L   H    +K      G    I  L+   +D DT +   ++    + ++
Sbjct: 112 NALDLVNQNGLSRKHIITGVKNSVERLGTY--IDVLQIHRLDHDTPKEEIMRA---LNDV 166

Query: 158 PKTGKTRAVGVSNFSINNIKEL-LKSPSNKLVPATNQVEIHPLLPQD---ELIAFCKEKG 213
              G  R +G S+       EL   +  N      +    + LL ++   ELI FCK+ G
Sbjct: 167 IVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDERELIPFCKKHG 226

Query: 214 IVVEAYSP--FGSANAPLLKE--------------------------QAIIDMAKKHGVE 245
           + +  +SP   G    PL ++                          + +  +A K  + 
Sbjct: 227 VGLIPWSPNARGVLTRPLEQQTTRKLTDPTFIRMGLDKLSEDQKEIVRRVEHLAAKKNIS 286

Query: 246 PSQLIISWSIQRGYVVLAKSVNPERVVSNFKIF--TLPEDDFKAIGDLSK 293
            + L I+W++ +G   +    + ERV    K     L EDD K + +  K
Sbjct: 287 MAMLSIAWTLHKGANPIVGLNSIERVDEAIKAIDVELTEDDIKYLEETYK 336

>Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig
           119] FULL
          Length = 67

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 253 WSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFK 286
           WS  +G+VVL KS NPER+  N  +    +D +K
Sbjct: 2   WSFLQGFVVLVKSSNPERIRQNLAVLPSKDDSWK 35

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 78/181 (43%), Gaps = 51/181 (28%)

Query: 42  ALKTGYRHIDAAAIYLNEEEV-GRAIKD--SGIAREEIFITTKL-------WGTEQRDPE 91
           A+  G   ID +  Y   E + G+A+++      REE FI TK+       +   + +  
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 92  AALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTW 151
            ++  S +RL  DY+DL  +H                          D++  E++  K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH--------------------------DIEYVEYD--KIW 141

Query: 152 DLMQELPK---TGKTRAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAF 208
           + ++EL K    G  R +G+S + ++ +  L  S +   VP     EI PL   D ++++
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVP-----EIGPL---DAVLSY 191

Query: 209 C 209
           C
Sbjct: 192 C 192

>NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {ON}
           
          Length = 343

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 112/297 (37%), Gaps = 62/297 (20%)

Query: 46  GYRHIDAAAIYLN---EEEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESL---- 98
           G R  D A +Y N   E  +G  +K   I RE + I TK++         A++E+L    
Sbjct: 53  GLRTYDTADVYSNGVSERLIGEFLKKYNIKRETVVIFTKIF--------YAVDETLDLPR 104

Query: 99  -----KRLGLDYVD---LYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKT 150
                +R  LD  +   L   H    +K      G    I  L+   +D DT +   ++ 
Sbjct: 105 SNVPNERNDLDLANQGGLSRKHIITGVKNSVERLGTY--IDVLQIHRLDHDTPKEEIMRA 162

Query: 151 WDLMQELPKTGKTRAVGVSNFSINNIKEL-LKSPSNKLVPATNQVEIHPLLPQD---ELI 206
              + ++   G  R +G S+       EL   +  N      +    + LL ++   ELI
Sbjct: 163 ---LNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDERELI 219

Query: 207 AFCKEKGIVVEAYSP--FGSANAPL-------LKEQAIIDM------------------- 238
            FCK  G+ +  +SP   G    PL       L +  I +M                   
Sbjct: 220 PFCKRHGVGLIPWSPNARGILTRPLEQQSTRKLSDPTITNMGLDNLADDQKEIVKRVEHL 279

Query: 239 AKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIF--TLPEDDFKAIGDLSK 293
           A K  +  + L ISW++ +G   +    + ERV    K     L EDD K + +  K
Sbjct: 280 ATKKNISMAMLSISWALHKGANPIVGLNSIERVDEAIKAIDVKLTEDDIKYLEETYK 336

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 109/273 (39%), Gaps = 59/273 (21%)

Query: 46  GYRHIDAAAIYLN---EEEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESL---- 98
           G R  D A +Y N   E  +G  +K   I RE + I +K++          ++ESL    
Sbjct: 53  GLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIF--------FPVDESLDLHQ 104

Query: 99  -KRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQEL 157
             ++  +Y+DL L  +   L    +  G    +  L  GT  +D  + + +     M+E+
Sbjct: 105 GSKVDQEYIDLQL-SFQQGLNRKHIMAGVANSVERL--GTY-IDILQIHRLDKEASMEEI 160

Query: 158 PKT-------GKTRAVGVSNFSINNIKEL-LKSPSNKLVPATNQVEIHPLL---PQDELI 206
            ++       G+ R +G S+       EL   +  N      N    + +L    ++ELI
Sbjct: 161 MRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNREDENELI 220

Query: 207 AFCKEKGIVVEAYSP--FGSANAP-------LLKEQAIIDM------------------- 238
            FCK+ G+ +  +SP   G    P       +L +   I M                   
Sbjct: 221 PFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEIIGVVEAI 280

Query: 239 AKKHGVEPSQLIISWSIQRGYVVLAKSVNPERV 271
           AKK G+  + + ++W + +G   +A   + ERV
Sbjct: 281 AKKKGISMAMVSMAWILNKGANAIAGLNSIERV 313

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 36.2 bits (82), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 73/182 (40%), Gaps = 38/182 (20%)

Query: 48  RHIDAAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKR----LGL 103
             +D A IY   EE   AI    + +  I  T      E    + ++NES++     LG+
Sbjct: 35  EELDTARIYPGSEE---AIGKFELPKSFIIDTKARGFGEGTLTKESINESIEESFGLLGV 91

Query: 104 DYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKT 163
           + V+++ +H P P              P  E               T D +  L K GK 
Sbjct: 92  ESVEIFYLHCPDP------------ATPLEE---------------TLDAIDALYKEGKF 124

Query: 164 RAVGVSNFSINNIKELLKSPSNK--LVPATNQVEIHPLLPQDE--LIAFCKEKGIVVEAY 219
           +  GVSNFS  +++++      K  ++P   Q   + +  + E  L    +E G+   AY
Sbjct: 125 KKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVGRKIETSLFPVLRELGLSFYAY 184

Query: 220 SP 221
           SP
Sbjct: 185 SP 186

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 111/308 (36%), Gaps = 92/308 (29%)

Query: 42  ALKTGYRHIDAAAIYLN---EEEVGRAIKDSGIAREEIFITTKLW--------------G 84
           A   G R  D A +Y N   E  +G  ++   I RE + I TK++               
Sbjct: 49  AYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVFFPVDDKMDISSNRTK 108

Query: 85  TEQRDPEA-------------ALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCIP 131
           TE+ + +              A+  S+KRLG  Y+D+Y +H     + D           
Sbjct: 109 TEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIH-----RCD----------- 151

Query: 132 TLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL----KSPSNKL 187
                       E  F +T   + ++ + G  R +G S+       E+     K   +K 
Sbjct: 152 -----------HETPFEETMRALNDVVEQGDVRYLGASSMLAVEFAEMQFIAEKHGWHKF 200

Query: 188 VPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPF--GSANAPL---------------- 229
           V   +   +     + E+I FCK  GI +  +SP   G    PL                
Sbjct: 201 VNMQSCYNLVYREDEREMIPFCKRHGIALTPWSPIQKGLLARPLGSHTHRESTDGVLIAR 260

Query: 230 ------LKEQAIID----MAKKHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFT 279
                   E+ II+    +A K  ++   + + W IQ+G + +    + ERV    K  T
Sbjct: 261 KLNQFTESEKEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILGMSSIERVDEAIKTLT 320

Query: 280 --LPEDDF 285
             L EDD 
Sbjct: 321 TKLTEDDM 328

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 116/291 (39%), Gaps = 48/291 (16%)

Query: 45  TGYRHIDAAAIY---LNEEEVGRAIKDSGIAREEIFITTKLW----GTEQRDPEAALNES 97
           +G R  D A +Y   L+E  +G  +K   I RE + I TK++     + +    A ++ES
Sbjct: 54  SGMRTFDTADVYSNGLSERILGEFLKHYKIKRETVVILTKVYYPVDESLKLTHSAKISES 113

Query: 98  LKRLGL-DYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQE 156
              LGL +   L   H     K      G    I  L+   +D DT     +K    + +
Sbjct: 114 -DMLGLVNQTGLSRKHILEAAKNSVERLGTY--IDVLQIHRLDHDTPMEEIMKA---LND 167

Query: 157 LPKTGKTRAVGVSNFSINNIKELL----KSPSNKLVPATNQVEIHPLLPQDELIAFCKEK 212
           +   G TR +G S+       EL     K    K + + +   +     + ELI F K+ 
Sbjct: 168 VVGLGYTRYIGASSMLATEFAELQFIAEKHDWTKFICSQSCYSLLYREDERELIPFAKKH 227

Query: 213 GIVVEAYSPFGSA--------------NAPLLK----------EQAII----DMAKKHGV 244
           GI +  +SP                  + P LK          E+ I+    ++AKK G+
Sbjct: 228 GIGLIPWSPNARGVLTRPLNQETDRKISDPTLKRLKFDCLESHEKRIVNRVEEVAKKKGI 287

Query: 245 EPSQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAIGDLSK 293
             + + I+W + +G   +    + ERV    +     L E++ + + +L K
Sbjct: 288 SMAMVSIAWVLSKGACPIVGLNSIERVDEAIRAVDVQLTEEEIQYLEELYK 338

>Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 79/194 (40%), Gaps = 16/194 (8%)

Query: 39  VIAALKTGYRHIDAAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESL 98
           VI  L     H+D A      ++V  AI D       I     +W  + +   A +N+++
Sbjct: 262 VIKGLPVSALHVDFARAPQQFDDVIAAIGDKQTLSVGIVDGRNIWKNDFKKSSAFVNKAI 321

Query: 99  KRLGLDYVDL----YLMHWPVPLKTDTVTDGNV---LCIPTLEDGTVDVDTKEWNFIKTW 151
           ++LG D V +     L+H PV L  +T  D  +       T +   V V TK  +     
Sbjct: 322 EKLGADRVVVATSSSLLHTPVDLTNETKLDAEIKGFFSFATQKLDEVVVITKNVSGQDVA 381

Query: 152 DLMQELPKT----GKTRAVGVSNF-----SINNIKELLKSPSNKLVPATNQVEIHPLLPQ 202
             ++   K+    GK++ +  S+      SI+       SP  + +P   ++   PL P 
Sbjct: 382 AALEANAKSVESRGKSKLIHDSSVKARVASIDQKMSTRASPFEQRLPEQKKIFNLPLFPT 441

Query: 203 DELIAFCKEKGIVV 216
             + +F + K I +
Sbjct: 442 TTIGSFPQTKDIRI 455

>KAFR0D03980 Chr4 (783660..784709) [1050 bp, 349 aa] {ON} Anc_1.75
           YNL274C
          Length = 349

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 10/97 (10%)

Query: 102 GLDYVDLY-------LMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLM 154
           G ++VD         ++   VPL ++T    N      ++DG V V+T     I   DL+
Sbjct: 208 GAEFVDFETLLKESDIISISVPLNSETRHLFNKETFAKMKDGVVIVNTARGPVINESDLI 267

Query: 155 QELPKTGKTRAVGVSNFSINNI--KELLKSPSNKLVP 189
             L KT K RA G+  F    I  +ELL  P    +P
Sbjct: 268 DAL-KTCKVRAAGLDVFEFEPIVPQELLDMPQVVTIP 303

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 78/207 (37%), Gaps = 40/207 (19%)

Query: 44  KTGYRHIDAAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTE-----QRDPEAALNESL 98
           K G + ID A IY + E++   ++          I TK  G       + +   ++ ESL
Sbjct: 31  KAGVKDIDTARIYPDSEKIIGELQ----LPNRFTIHTKASGFSGGCLTKDNINKSIEESL 86

Query: 99  KRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELP 158
             LG+  V+ + +H P P                           E    +T   +  L 
Sbjct: 87  SLLGVPSVETFFLHSPDP---------------------------ETPIEETLGAINSLY 119

Query: 159 KTGKTRAVGVSNFSINNIKELLKSPSNK--LVPATNQVEIHPL--LPQDELIAFCKEKGI 214
           + GK +  G+SNF+  ++K + +   +K  ++P   Q   +      +++L    +E   
Sbjct: 120 EQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDLFPLLRELHF 179

Query: 215 VVEAYSPFGSANAPLLKEQAIIDMAKK 241
              AYSP          EQ + D + +
Sbjct: 180 SFYAYSPIAGGFLAKTPEQVLGDKSGR 206

>Kpol_1050.55 s1050 complement(123375..124733) [1359 bp, 452 aa]
           {ON} complement(123375..124733) [1359 nt, 453 aa]
          Length = 452

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 20/96 (20%)

Query: 165 AVGVSNFSINNIKELLKSPSN----KLVPAT------NQVEIHPLLPQDELIAFCKEKGI 214
           A  V    I N+ +L  S SN    +L+P +      + + +  L PQ  ++A C  +G 
Sbjct: 187 ARSVGQVHITNLSQLKHSDSNPSGTRLLPTSIIKAHKSAIRMLRLNPQGTMVATCSVQGT 246

Query: 215 VVEAYSPFGSANAPLLKE-------QAIIDMAKKHG 243
           ++  +S   + N  LL+E         I DMA  HG
Sbjct: 247 LIRIFS---TLNGSLLREFRRGLDRADIYDMAFSHG 279

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKTGYRHIDAAAIYLN---EEEVGRAIKDSGIAREEIFITTK---------------- 81
           A  + G   ID A  Y N   EE +G  +    I R++I I TK                
Sbjct: 61  AFYEAGGNFIDTANNYQNGQSEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSA 119

Query: 82  -LWGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +R  + ++ +SL++L  D++D+  +HW
Sbjct: 120 NFSGNHRRSLQLSVRDSLRKLQTDWIDILYVHW 152

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 22/118 (18%)

Query: 17  GASIPALGFGTWRSVDNNGYHSVIAAL-KTGYRHIDAAAIYLNEEE---VGRAIKDSGIA 72
           GASI     G   S++      ++ A  + G   ID A  Y NEE    +G  +    + 
Sbjct: 36  GASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL- 94

Query: 73  REEIFITTKL-----------------WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
           R++I I TK                   G  +R    ++ +SL++L  D++D+  +HW
Sbjct: 95  RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 16/84 (19%)

Query: 140 VDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNKLVPATNQV----- 194
           V+ KE   I+ W+ ++E    GK + + + NF INN+K+      NK    TN+      
Sbjct: 281 VERKERERIQ-WNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRIT 339

Query: 195 ----------EIHPLLPQDELIAF 208
                     E+ PL+P  E++++
Sbjct: 340 PEIIIEKIKSELLPLIPDFEILSY 363

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 41  AALKTGYRHIDAAAIYLNEEE---VGRAIKDSGIAREEIFITTKL--------------- 82
           A  + G   ID A  Y NEE    +G  +K   + R++I I TK                
Sbjct: 15  AFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKYEVGGGKSA 73

Query: 83  --WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +     ++ +SL++L  D++D+  +HW
Sbjct: 74  NYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>KLLA0E24421g Chr5 (2171139..2172245) [1107 bp, 368 aa] {ON} similar
           to gnl|GLV|CAGL0K04015g Candida glabrata CAGL0K04015g
           and weakly similar to YGR031W uniprot|P53219
           Saccharomyces cerevisiae YGR031W Hypothetical ORF
          Length = 368

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 6/48 (12%)

Query: 129 CIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNI 176
           C+  L+ G V VD K W    +  L + LP        GV N+ +NNI
Sbjct: 184 CVKLLDQGKVRVDDKLWRHKASESLKRYLPNA------GVRNYVLNNI 225

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/207 (19%), Positives = 86/207 (41%), Gaps = 46/207 (22%)

Query: 44  KTGYRHIDAAAIYLNEEE-VGRAIKDSGIAREEIFITTKL-------WGTEQRDPEAALN 95
           +  +  +D +  Y + E  VG+A+++  I R EI++ TK+       +   + +   ++ 
Sbjct: 38  RRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRENVRMSVM 97

Query: 96  ESLKRLGLDYVDLYLMHWPVPLKTDTVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQ 155
            S++RL                    V +G  L +  L D  V+   +E   +   D +Q
Sbjct: 98  RSVERL--------------------VGEGGYLDVVYLHD--VEFQPQE-ACLAALDELQ 134

Query: 156 ELPKTGKTRAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCK---EK 212
           +L + G  R VGVS + ++ +  L+    +   P             D ++++C    + 
Sbjct: 135 KLKRAGIVRNVGVSGYPLSKLYSLVSLCYDAGTPL------------DCVLSYCHMNLQN 182

Query: 213 GIVVEAYSPFGSANAPLLKEQAIIDMA 239
            ++ E Y+ F S     +   +++ M+
Sbjct: 183 VMLEEYYAKFKSKGVQHVVNASVLSMS 209

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKTGYRHIDAAAIYLNEEE---VGRAIKDSGIAREEIFITTKL--------------- 82
           A  + G   +D A  Y NE+    +G  +K   + R++I I TK                
Sbjct: 61  AFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKKYEAGDGKSA 119

Query: 83  --WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +R    ++ +SL++L  D++D+  +HW
Sbjct: 120 NYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKTGYRHIDAAAIYLNEEE---VGRAIKDSGIAREEIFITTKL-----W--------- 83
           A  + G   ID A  Y NE+    +G  ++   + R++I I TK      W         
Sbjct: 61  AFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL-RDQIVIATKFSTDYKWYDVGKNRSA 119

Query: 84  ---GTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +     ++ +SL++L  D++D+  +HW
Sbjct: 120 NFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}
           MET6Cobalamin-independent methionine synthase, involved
           in methionine biosynthesis and regeneration; requires a
           minimum of two glutamates on the methyltetrahydrofolate
           substrate, similar to bacterial metE homologs
          Length = 767

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 75/196 (38%), Gaps = 22/196 (11%)

Query: 40  IAALKTGYRHIDAAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLK 99
           I  L     H+D        +EV  AI +       I     +W  + +   A +N++++
Sbjct: 263 IKGLPVAALHVDFVRAPEQFDEVVAAIGNKQTLSVGIVDGRNIWKNDFKKSSAIVNKAIE 322

Query: 100 RLGLDYVDL----YLMHWPVPLKTDTVTDGNV---LCIPTLEDGTVDVDTKEWNFIKTWD 152
           +LG D V +     L+H PV L  +T  D  +       T +   V V TK    +   D
Sbjct: 323 KLGADRVVVATSSSLLHTPVDLNNETKLDAEIKGFFSFATQKLDEVVVITKN---VSGQD 379

Query: 153 LMQELPKTGKT-RAVGVSNF-----------SINNIKELLKSPSNKLVPATNQVEIHPLL 200
           +   L    K+  + G S F           SI+       +P  + +P   +V   PL 
Sbjct: 380 VAAALEANAKSVESRGKSKFIHDAAVKARVASIDEKMSTRAAPFEQRLPEQQKVFNLPLF 439

Query: 201 PQDELIAFCKEKGIVV 216
           P   + +F + K I +
Sbjct: 440 PTTTIGSFPQTKDIRI 455

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 41  AALKTGYRHIDAAAIYLNEEE---VGRAIKDSGIAREEIFITTKL--------------- 82
           A  + G   ID A  Y NE+    +G  +    + R++I I TK                
Sbjct: 61  AFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYDVGGGKSA 119

Query: 83  --WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +R    ++ +SL++L  D++D+  +HW
Sbjct: 120 NYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 149 KTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPL-LPQDELIA 207
           +T+D + E  K GK   + +S  +   I+ + K     LV    ++ +    +  + ++ 
Sbjct: 145 ETFDTIVEYVKKGKIGGISLSEVTAEQIRAIHKEYGEYLVCVEVELSMFSAEILSNGIVD 204

Query: 208 FCKEKGIVVEAYSPFG 223
            C E G+ + AYSP G
Sbjct: 205 TCNELGLPIVAYSPLG 220

>YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putative
           aryl-alcohol dehydrogenase; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; mutational analysis has not
           yet revealed a physiological role
          Length = 363

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 43/101 (42%), Gaps = 21/101 (20%)

Query: 33  NNGYHSVIAALKTGYRHIDAAAIYLNEEE---VGRAIKDSGIAREEIFITTKL------- 82
           N  +  +    + G   IDAA    NE+    +G  I+   + R++I I TK        
Sbjct: 50  NRAFELLDTFYEAGGNFIDAANNCQNEQSEEWIGEWIQSRRL-RDQIVIATKFIKSDKKY 108

Query: 83  ----------WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
                      G  +R    ++ +SL++L  D++D+  +HW
Sbjct: 109 KAGESNTANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 149

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 200 LPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPSQL 249
           +P    I +  EK +   AYSP G   A   K++ I   A+   V+P+  
Sbjct: 328 VPSSHTITYAHEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPNAF 377

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 13/95 (13%)

Query: 17  GASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAIKDSGIAR--E 74
           G  +P   +  +++  NN +   IAAL+ G     AAA+ ++  +  + +  SG+A   +
Sbjct: 48  GLEVPGYVYSRFQNPTNNVFEERIAALEGG-----AAAVAVSSGQAAQTLAISGLAHVGD 102

Query: 75  EIFITTKLWGTEQRDPEAALNESLKRLGLD--YVD 107
            I  T+ L+G      + A     KRLG++  +VD
Sbjct: 103 NIVSTSYLYGGTYNQFKVA----FKRLGVEARFVD 133

>KAFR0B01300 Chr2 (242298..244145) [1848 bp, 615 aa] {ON} Anc_7.269
           YIL072W
          Length = 615

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 48/101 (47%), Gaps = 12/101 (11%)

Query: 165 AVGVSNFS--INNIKEL---LKSPSNKLVPATNQVEI---HPLLPQDELIAFCKEKGIVV 216
           A   S F   +  IKEL    K+P+++L PA  ++ I   H L  QD +I   K K I +
Sbjct: 512 AKSTSQFEEWLQEIKELRLICKNPTSEL-PAMEKLAIDDDHDLNTQDPIIIRSKRKNIDL 570

Query: 217 EAYSPFGSANAPLLKEQAIIDMAKKHGVEPSQLIISWSIQR 257
           E Y      N+ L+     IDM K+H    S+ I   S+ +
Sbjct: 571 EQY--LKDENSSLIISDT-IDMKKQHDEPASKKIRKISVSK 608

>Suva_8.122 Chr8 (222064..223821) [1758 bp, 585 aa] {ON} YOR073W
           (REAL)
          Length = 585

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 14/97 (14%)

Query: 159 KTGKTRAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVV-- 216
           +T +TR   V ++++ +++  ++ PS KLV AT  ++IH L          ++  I V  
Sbjct: 367 RTRRTRGKAV-DYTLPSLRAKMRRPSEKLVDATTMIDIHDL-------QVSRKNSITVSN 418

Query: 217 -EAYSPFGSANAPLLKEQAIIDMAKKHGVEPSQLIIS 252
            ++ SP    + P LKE  +   +K +G    + +I+
Sbjct: 419 RKSLSPDPIPDEPQLKEVVV---SKDYGTPKEKQLIT 452

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,193,681
Number of extensions: 1509948
Number of successful extensions: 4513
Number of sequences better than 10.0: 165
Number of HSP's gapped: 4266
Number of HSP's successfully gapped: 175
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)