Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6365.433ON23423411341e-159
Suva_2.5395.433ON2272349031e-124
YDR367W (KEI1)5.433ON2212348791e-120
Smik_4.6335.433ON2212348331e-113
KAFR0E039305.433ON2112336752e-89
CAGL0A02794g5.433ON2162346673e-88
NCAS0F033705.433ON2112286533e-86
KNAG0C049205.433ON2172206273e-82
TDEL0E019205.433ON2202325883e-76
Kpol_1062.305.433ON2142335553e-71
ZYRO0F10010g5.433ON2082305543e-71
SAKL0G02508g5.433ON2282215407e-69
TPHA0E017705.433ON2172255283e-67
TBLA0A065205.433ON2062234659e-58
Kwal_55.214325.433ON2072114432e-54
NDAI0B056605.433ON1611784211e-51
TBLA0G020105.433ON2132144242e-51
AER256C5.433ON2392204243e-51
KLTH0F16082g5.433ON2062104022e-48
KLLA0E21099g5.433ON2242334034e-48
Ecym_47625.433ON2212253921e-46
Smik_13.4928.843ON54358656.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.636
         (234 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   441   e-159
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   352   e-124
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   343   e-120
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   325   e-113
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   264   2e-89
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   261   3e-88
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   256   3e-86
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   246   3e-82
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   231   3e-76
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   218   3e-71
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   218   3e-71
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   212   7e-69
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   207   3e-67
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   183   9e-58
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   175   2e-54
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   166   1e-51
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   167   2e-51
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   167   3e-51
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   159   2e-48
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   159   4e-48
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   155   1e-46
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...    30   6.7  

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  441 bits (1134), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/234 (93%), Positives = 218/234 (93%)

Query: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60
           MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA
Sbjct: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60

Query: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDF 120
           YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTI                ENPTDF
Sbjct: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDF 120

Query: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180
           GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF
Sbjct: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180

Query: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234
           NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE
Sbjct: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  352 bits (903), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/234 (75%), Positives = 187/234 (79%), Gaps = 7/234 (2%)

Query: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60
           MR+S + LPK    SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA
Sbjct: 1   MRSSLVALPK----SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 56

Query: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDF 120
           YLWSVFTLIVF+QGLYLIHKPNLLVFSQIC+LYTVDTI                E     
Sbjct: 57  YLWSVFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGN--- 113

Query: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180
            SI    + TA +T   +PI  GKLTARS D SGQ A+E+YEYSITI ITL SLIFRFYF
Sbjct: 114 ASIVADASSTATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYF 173

Query: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234
           N IL SFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQK CY+LCKNLLE
Sbjct: 174 NFILASFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  343 bits (879), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 187/234 (79%), Gaps = 13/234 (5%)

Query: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60
           MR+S LTLPK    SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQW+A
Sbjct: 1   MRSSLLTLPK----SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIA 56

Query: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDF 120
           YLWSVFTLIVFSQGLYLIHKPNLLVFSQIC+LYT+DTI                E+    
Sbjct: 57  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDT--- 113

Query: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180
              AN   + AL++N   PI  GKLT R  D S QSATE+YEY++TI ITL SLIFRFYF
Sbjct: 114 ---ANIDGNNALQSN---PISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYF 167

Query: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234
           N IL SFVQELLHHPKYLVDRDDVEQ+LKNKPIWKRLWAKSQK CY+LCKNLLE
Sbjct: 168 NFILASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  325 bits (833), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/234 (70%), Positives = 184/234 (78%), Gaps = 13/234 (5%)

Query: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60
           MR+  LTLPK    SFLGFMPLYLAVEIVLGISILNKCSG YGILALFTGHPLDFMQWVA
Sbjct: 1   MRSFLLTLPK----SFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVA 56

Query: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDF 120
           YLWSVFTLI+FSQGLYLIHKPNLL+FSQIC LYT+DT+                   T +
Sbjct: 57  YLWSVFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWF---------TTQW 107

Query: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180
            ++ ++    A ++N  + I   +LT R+ D S QSATE+YEYSITI ITL SLIFRFYF
Sbjct: 108 FTLEDTAGGVASQSNNSNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYF 167

Query: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234
           NLIL SFVQELLHHPKYLVDRDDVEQ+LKNKPIWKRL+AKSQK CY+LCKNLL 
Sbjct: 168 NLILASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLLN 221

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  264 bits (675), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 158/233 (67%), Gaps = 23/233 (9%)

Query: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60
           MRT+  +LPK    SFLG +PLYLAVEIVLGI+  NK SGA+GILALFTGHPL FMQWV 
Sbjct: 1   MRTTSFSLPK----SFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVF 56

Query: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDF 120
           YLWS  TL VF+QGL+ IHKPN+L FSQI + Y++DT+                E+ T+ 
Sbjct: 57  YLWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTE- 115

Query: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180
                               +   +T R+ D S Q A++ YEYS+TIFITL SL+FRFYF
Sbjct: 116 ------------------AAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYF 157

Query: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           N IL SFVQELL HPKY+ D+DD+EQDLKNK IWKR W K QKSCY+LCKNLL
Sbjct: 158 NFILASFVQELLRHPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  261 bits (667), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 130/234 (55%), Positives = 163/234 (69%), Gaps = 18/234 (7%)

Query: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60
           MR + ++ PK    SF GF+PLYL VEIVLGI+ILNKCSGAYGILALFTGHPLD+MQW++
Sbjct: 1   MRLNKISFPK----SFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWIS 56

Query: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDF 120
           YLWSVFTLIVFSQGL++IHKP L+VFSQI + +T DT+                 +   F
Sbjct: 57  YLWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWF--------SAQWF 108

Query: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180
            S      +T+      +P+   +   RS D + Q A+E YEY++T+  TL +L+FR YF
Sbjct: 109 QSANEEKHETS------APVGVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYF 162

Query: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234
           N IL SFVQELL HPKY+VD+DDVEQDLKNK   KR W KSQK CY+LC++ L+
Sbjct: 163 NFILASFVQELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  256 bits (653), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 132/228 (57%), Positives = 156/228 (68%), Gaps = 23/228 (10%)

Query: 6   LTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSV 65
           +TLPK F +SF G +PLYL VEIVLGI+I NKCSGAYGILALFTGHPLDF+QWV YLWS+
Sbjct: 6   ITLPKCF-QSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSI 64

Query: 66  FTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIAN 125
           FTLI+F+QGLY IHKP LL FSQI + Y++DTI                E PT       
Sbjct: 65  FTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTE-PTG------ 117

Query: 126 STADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILG 185
              + AL+              R+     Q ATE YEY +TIFITL +L FR YFN +L 
Sbjct: 118 --TEEALQ-------------RRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLA 162

Query: 186 SFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           +FVQELLHHPKYLVD+DDVEQDLKNKP+WKR W K+QK  Y++C +LL
Sbjct: 163 AFVQELLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  246 bits (627), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 152/220 (69%), Gaps = 13/220 (5%)

Query: 14  KSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQ 73
           K+F G  PLY+ VEIVLG+++LNKCSGA+GILALFTGHPLD MQW +YLWSVFTL+V++Q
Sbjct: 10  KTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVYAQ 69

Query: 74  GLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIANSTADTALR 133
           GLY IHKP LL FSQI +++++DT+                E+ TD    A  TA +A+ 
Sbjct: 70  GLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTD---AAMGTAASAV- 125

Query: 134 TNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELLH 193
                     +L  R A+   Q ATE+YEY  TI IT+ SL+FR YFN +L SFVQELL 
Sbjct: 126 ---------ARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLR 176

Query: 194 HPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           HP+YLVD+DD+EQDLKNK   +R W  SQKS Y +C+++L
Sbjct: 177 HPQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  231 bits (588), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 154/232 (66%), Gaps = 17/232 (7%)

Query: 2   RTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAY 61
           R+  + LPK    SFLGF+PLY+ VEI LGISI+NKCSGAYGILALFTGHPLD MQWV Y
Sbjct: 5   RSKSMGLPK----SFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLY 60

Query: 62  LWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFG 121
           +WS+FTLI+  QGLY IHKPN+L FS I I + +DT+                E      
Sbjct: 61  IWSIFTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGN---- 116

Query: 122 SIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFN 181
             +N+  DT   +   +P+        S+  + Q A+E +EY +T+FIT+ SL  + YF 
Sbjct: 117 --SNNVKDTK-SSYSDAPV------DYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFT 167

Query: 182 LILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
            I+ SFVQELL HP+Y++D+DDVEQDLK++  WKR W KSQKSCY++ K+LL
Sbjct: 168 FIIASFVQELLLHPRYMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLL 219

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  218 bits (555), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 145/233 (62%), Gaps = 29/233 (12%)

Query: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60
           ++T +  LP+    SF GF+PLY+ VE VLGI+ILNKCSGAYGILALFTGHPL+  QWV+
Sbjct: 10  VKTHYSNLPR----SFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVS 65

Query: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDF 120
           YLWSVFTLI++SQGL+ +H P+LL +SQI ++++ DT                       
Sbjct: 66  YLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFL--------------------- 104

Query: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180
                        +   +   +G       D+ GQ A+E YEY+ TI IT+ +L+ R YF
Sbjct: 105 ----TCVFTMIFSSQWFTETGSGMSDGSGVDEYGQGASETYEYTFTILITVVALVSRMYF 160

Query: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           N IL +F QEL  HPKY+VD DDVEQDLKNK    + W KS+KSCY L +++L
Sbjct: 161 NFILAAFNQELFLHPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  218 bits (554), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 146/230 (63%), Gaps = 25/230 (10%)

Query: 4   SFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLW 63
           ++L LPK     FLGF+PLY+ VE+ LG++ILNKCSG +GILALFTGHPL+F+QWV YLW
Sbjct: 3   TYLNLPK----RFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLW 58

Query: 64  SVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSI 123
           S+F+ +V++QGL+   KP+LLVFSQI I +++DT                 E+ T     
Sbjct: 59  SIFSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTP---- 114

Query: 124 ANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLI 183
                                + A +  +  Q A++++E+ +TIFITLASLI R YFN +
Sbjct: 115 -----------------TQKSIAAAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFV 157

Query: 184 LGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           L SFVQ LL HP+Y+VD  DVEQ+L+ +P+WKR+W ++Q  C R  K LL
Sbjct: 158 LASFVQGLLQHPRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  212 bits (540), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 147/221 (66%), Gaps = 5/221 (2%)

Query: 14  KSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQ 73
           KSFLGF+PLY+ VE+ LGISI NK SG YGILALFTGHPLDFMQW  Y  SV TL+V+  
Sbjct: 11  KSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLLVYLS 70

Query: 74  GLYLIHKPNLLVFSQICILYTVDTIXXXXXXX-XXXXXXXXXENPTDFGSIANSTADTAL 132
           GL+ I KPN L +S + +++T+DT+                 EN  + G++  S   +A 
Sbjct: 71  GLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAG 130

Query: 133 RTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELL 192
           R   L P  A +L  R+   + QSA++ YEY++T+  T+ +L  RFYFN IL +FVQ++L
Sbjct: 131 R--ALGP--AKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQML 186

Query: 193 HHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
            HPKY+VD+DDVEQDLKNK +++RL  KS+K CY  C+  L
Sbjct: 187 RHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  207 bits (528), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 139/225 (61%), Gaps = 22/225 (9%)

Query: 9   PKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTL 68
           PK+  KSF GF+PLY+ VE VLGI+I NKCSG YGILALFTGHPL  +QWV+YLWS FTL
Sbjct: 14  PKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTL 73

Query: 69  IVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIANSTA 128
           ++++QGL+ +H PNLL + QI I Y+ DTI                E  ++ G   NS+ 
Sbjct: 74  LIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE--SNAGDNINSST 131

Query: 129 DTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFV 188
                               + DK  Q A+E+ E+  T+ +TL +L+ RFYFN IL SF 
Sbjct: 132 --------------------TVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFT 171

Query: 189 QELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           Q+L  HPKY++D+DDVEQDLKNK I  + W KS+K CY   K  L
Sbjct: 172 QQLFLHPKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  183 bits (465), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 95/223 (42%), Positives = 131/223 (58%), Gaps = 31/223 (13%)

Query: 11  IFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIV 70
           I  K F G  PLYL VE+VLGI+I NKC GAYGILALF GHPL+F QWV Y WS+  L +
Sbjct: 14  ILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAI 73

Query: 71  FSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIANSTADT 130
           ++QGL  +H+P L  FSQ+ I ++VDT+                           + A T
Sbjct: 74  YAQGLAKVHRPTLYTFSQVFIFFSVDTLL--------------------------TCAFT 107

Query: 131 ALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQE 190
              T+      A   T R    + Q A++ YEYS+++ +TLASL+ R YFN I+GSF+QE
Sbjct: 108 VYFTHEW---FAANTTTR--PPAAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQE 162

Query: 191 LLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           L   P Y +D D+VE +L++  + +RLW ++Q  CY L + +L
Sbjct: 163 LFFRPAYTLDTDEVETELRHSSLLRRLWLQNQHYCYILSRRIL 205

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  175 bits (443), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 131/211 (62%), Gaps = 6/211 (2%)

Query: 24  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQGLYLIHKPNL 83
           + VEI LGI++LNKCSG YGIL L TGH LDFMQWV YL S+ T+IV+S GL  I+KP++
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 84  LVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIANSTADTALRTNGLSPIMAG 143
           L +S I + +T DT+                +N     S       T L+++  +   +G
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKN-----SELTDPNSTTLQSSAGNNSPSG 115

Query: 144 KLTARSADK-SGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELLHHPKYLVDRD 202
            L ++  D  S QSA++  EY  TI +T+ +L  RFYFN I+ +FVQ LL HPKY+VD+D
Sbjct: 116 NLISKRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQD 175

Query: 203 DVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           DVEQDLK++   +R W +++   Y++C+  L
Sbjct: 176 DVEQDLKHRGFLRRWWIRAETHSYKICRRYL 206

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  166 bits (421), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 111/178 (62%), Gaps = 18/178 (10%)

Query: 56  MQWVAYLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXE 115
           MQWVAYLWS+F LI+F+QGLY IHKP LL FSQI + +T+DT+                 
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQW---- 56

Query: 116 NPTDFGSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLI 175
                     S  ++A++T       +  +  R    + Q AT  YEY +T+ IT  +L 
Sbjct: 57  -------FQGSEGESAVQT-------STGVQKRDTSLASQGATAGYEYFVTMLITFITLT 102

Query: 176 FRFYFNLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           FRFYFN IL SFVQELL +PK+++D+DDVEQDLKNK + KR W K++K CYRLCK++L
Sbjct: 103 FRFYFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  167 bits (424), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 131/214 (61%), Gaps = 17/214 (7%)

Query: 10  KIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLI 69
           K+   SF    PLYL VE++LGI ILNKCSG YGILALFTGHPL  +QW+ Y+WS+FTL+
Sbjct: 11  KVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLL 70

Query: 70  VFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIANSTAD 129
           +++QG++ I KPN+ +FSQI  ++++DTI                ++       +N  ++
Sbjct: 71  IYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDH-------SNKQSE 123

Query: 130 TALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQ 189
            +L+       ++ K          Q A+  YE  + + +TL +LI R Y+NL+L SF+ 
Sbjct: 124 NSLQRTEKDIELSQK----------QGASSTYELFLIVIVTLFTLISRCYYNLVLASFLH 173

Query: 190 ELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQK 223
           +L  +PK+++D+DDVE DLKNK  +K+    S+K
Sbjct: 174 KLFINPKFIIDQDDVETDLKNKSFFKKFGGISKK 207

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  167 bits (424), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 92/220 (41%), Positives = 127/220 (57%), Gaps = 11/220 (5%)

Query: 14  KSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQ 73
           KSF G +PLY+ VE+ LGI+I NK  G +G+LALFTGHPLD +QW+ YLWS  TL+V+  
Sbjct: 31  KSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVYLH 89

Query: 74  GLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIANSTADTALR 133
           GL  I++P L  +  + ++Y+ DTI                    D G  A +  D A  
Sbjct: 90  GLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFI---DGDVGVTATAKEDDADA 146

Query: 134 TNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELLH 193
           T        G +T  +   S QSA+++YEY+ T+  TL +L  RFY N ++ SFVQ +  
Sbjct: 147 TQ-------GSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQ 199

Query: 194 HPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           H K+    DDVEQDLK+K +  R +AK Q+ CY LC+  L
Sbjct: 200 HNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  159 bits (402), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/210 (44%), Positives = 133/210 (63%), Gaps = 5/210 (2%)

Query: 24  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQGLYLIHKPNL 83
           + VEI LGI+ILNKCSG YGIL L TGH LDFMQWV YL SVFTL+V+S GL  ++KP L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 84  LVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIANSTADTALRTNGLSPIMAG 143
             ++ + + +T DT+                +       +++ ++ T   + G+S   + 
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKES----ELSDPSSATQQTSGGISS-GSK 115

Query: 144 KLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELLHHPKYLVDRDD 203
            LTAR    S QSA++  EY  TI ++L +L+ RFYFN I+ +FVQ L  HPKYLVD+DD
Sbjct: 116 LLTARGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDD 175

Query: 204 VEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           V+QDLK+K +W+R W +++   YR+C + L
Sbjct: 176 VDQDLKHKKLWQRWWIRAENWSYRVCHHYL 205

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  159 bits (403), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 88/233 (37%), Positives = 132/233 (56%), Gaps = 13/233 (5%)

Query: 2   RTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAY 61
           +++ + LP+ F+       PLY+ VE+ LG+   NK SG YG+LALFTGHPLDF+QW  Y
Sbjct: 4   QSNMVHLPQTFLS-----YPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFY 58

Query: 62  LWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFG 121
           +WS+F L+VF  G+  ++KPN+L+ S +  +++VDTI                E  TD  
Sbjct: 59  IWSIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVT 118

Query: 122 SIANSTADTALRTNGLSPIMAGKLTARSAD-KSGQSATENYEYSITIFITLASLIFRFYF 180
            +   +A TA     L P   G  +  S    + +SA+  YE+ + I +TL  L  RFYF
Sbjct: 119 DL--KSAGTA-----LGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYF 171

Query: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           N I+ +F Q+LL   K+  D++D+E +L N+ I  +   K +K C+ LCK  L
Sbjct: 172 NFIIIAFQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  155 bits (392), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 122/225 (54%), Gaps = 14/225 (6%)

Query: 14  KSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQ 73
           +SF G +PLY+ VE+ LG++I NK  G YGILALFTG PLD +QW  Y+WS   L+VF++
Sbjct: 6   QSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVFTK 64

Query: 74  GLYLIHKPNLLVFSQICILYTVDTIXXXXXXXXXXXXXXXXENPTDFGSIANSTADTALR 133
           GL  ++KP L+ +  +  +Y++DT+                E+         S+    + 
Sbjct: 65  GLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKED--------TSSGSNPVS 116

Query: 134 TNGLSPIMAGK-----LTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFV 188
             G+  +  GK        R      QSA+ +YEYS TI +TL     RFY N I+ SFV
Sbjct: 117 GKGIGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFV 176

Query: 189 QELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233
           + ++   +Y+ + DDVE DLKN  +  R +  +Q+ CY  C+  L
Sbjct: 177 RRMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%)

Query: 117 PTDFGSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASL 174
           P  +  +A S  +T +  +    +  G    R  +KSGQ+  + Y  +I + I LASL
Sbjct: 456 PMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASL 513

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,334,324
Number of extensions: 860115
Number of successful extensions: 3105
Number of sequences better than 10.0: 25
Number of HSP's gapped: 3145
Number of HSP's successfully gapped: 32
Length of query: 234
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 128
Effective length of database: 41,326,803
Effective search space: 5289830784
Effective search space used: 5289830784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)